data_7CKE # _entry.id 7CKE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CKE pdb_00007cke 10.2210/pdb7cke/pdb WWPDB D_1300017780 ? ? BMRB 36363 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '7CKD is the same peptide with the different disulfide bond pattern.' 7CKD unspecified BMRB 'Solution structure of NCR169 oxidized form 2 from Medicago truncatula' 36363 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7CKE _pdbx_database_status.recvd_initial_deposition_date 2020-07-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Isozumi, N.' 1 ? 'Masubuchi, Y.' 2 ? 'Ohki, S.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 9923 _citation.page_last 9923 _citation.title 'Structure and antimicrobial activity of NCR169, a nodule-specific cysteine-rich peptide of Medicago truncatula.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-021-89485-w _citation.pdbx_database_id_PubMed 33972675 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Isozumi, N.' 1 ? primary 'Masubuchi, Y.' 2 ? primary 'Imamura, T.' 3 ? primary 'Mori, M.' 4 ? primary 'Koga, H.' 5 ? primary 'Ohki, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nodule Cysteine-Rich (NCR) secreted peptide' _entity.formula_weight 4630.519 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nodule-specific cysteine-rich peptide 169' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GEDIGHIKYCGIVDDCYKSKKPLFKIWKCVENVCVLWYK _entity_poly.pdbx_seq_one_letter_code_can GEDIGHIKYCGIVDDCYKSKKPLFKIWKCVENVCVLWYK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 ASP n 1 4 ILE n 1 5 GLY n 1 6 HIS n 1 7 ILE n 1 8 LYS n 1 9 TYR n 1 10 CYS n 1 11 GLY n 1 12 ILE n 1 13 VAL n 1 14 ASP n 1 15 ASP n 1 16 CYS n 1 17 TYR n 1 18 LYS n 1 19 SER n 1 20 LYS n 1 21 LYS n 1 22 PRO n 1 23 LEU n 1 24 PHE n 1 25 LYS n 1 26 ILE n 1 27 TRP n 1 28 LYS n 1 29 CYS n 1 30 VAL n 1 31 GLU n 1 32 ASN n 1 33 VAL n 1 34 CYS n 1 35 VAL n 1 36 LEU n 1 37 TRP n 1 38 TYR n 1 39 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 39 _entity_src_gen.gene_src_common_name 'Barrel medic' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MTR_7g029760 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Medicago truncatula' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3880 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A7KHA7_MEDTR _struct_ref.pdbx_db_accession A7KHA7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EDIGHIKYCGIVDDCYKSKKPLFKIWKCVENVCVLWYK _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CKE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A7KHA7 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 61 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 39 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7CKE _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A7KHA7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 2 '3D 1H-15N TOCSY' 1 isotropic 4 1 2 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 2.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.6 mM peptide, 90% H2O/10% D2O' '90% H2O/10% D2O' label-free solution ? 2 '0.3 mM [U-99% 15N] peptide, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7CKE _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 7CKE _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7CKE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_software.ordinal 1 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CYANA _pdbx_nmr_software.version ? _pdbx_nmr_software.authors 'Guntert P.' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CKE _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7CKE _struct.title 'Solution structure of NCR169 oxidized form 2 from Medicago truncatula' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CKE _struct_keywords.text 'Medicago truncatula, nodule-specific cysteine-rich peptide, antimicrobial peptide, disulfide bond, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 10 A CYS 29 1_555 ? ? ? ? ? ? ? 1.997 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 16 A CYS 34 1_555 ? ? ? ? ? ? ? 1.999 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 28 ? VAL A 30 ? LYS A 28 VAL A 30 AA1 2 VAL A 33 ? VAL A 35 ? VAL A 33 VAL A 35 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 28 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 28 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 35 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 35 # _atom_sites.entry_id 7CKE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LYS 39 39 39 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3960 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-26 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 peptide 0.6 ? mM 'natural abundance' 2 peptide 0.3 ? mM '[U-99% 15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -57.25 176.81 2 1 ASP A 3 ? ? -164.23 78.33 3 1 ILE A 4 ? ? 59.73 83.76 4 1 LYS A 8 ? ? -147.92 25.77 5 1 TYR A 9 ? ? 51.97 77.04 6 1 CYS A 10 ? ? 64.00 157.87 7 1 ILE A 12 ? ? -176.42 -35.67 8 1 VAL A 13 ? ? -176.71 -35.93 9 1 ASP A 14 ? ? -179.45 34.41 10 1 ASP A 15 ? ? -145.90 48.92 11 1 SER A 19 ? ? -177.94 135.06 12 1 LYS A 21 ? ? -177.45 68.05 13 1 PRO A 22 ? ? -69.71 -172.37 14 1 ILE A 26 ? ? -131.97 -70.48 15 2 GLU A 2 ? ? -163.09 29.73 16 2 HIS A 6 ? ? -174.35 83.49 17 2 CYS A 10 ? ? 64.14 157.44 18 2 VAL A 13 ? ? -176.63 -35.65 19 2 ASP A 14 ? ? -177.24 33.61 20 2 ASP A 15 ? ? -163.36 57.14 21 2 SER A 19 ? ? -179.37 132.71 22 2 LYS A 21 ? ? -177.45 68.12 23 2 PRO A 22 ? ? -69.81 -175.30 24 2 PHE A 24 ? ? -168.82 80.08 25 2 LYS A 25 ? ? 62.86 90.87 26 2 TRP A 37 ? ? -65.54 -170.58 27 3 ASP A 3 ? ? -140.36 52.58 28 3 TYR A 9 ? ? 51.80 79.40 29 3 CYS A 10 ? ? 64.07 157.32 30 3 ILE A 12 ? ? -176.52 -35.52 31 3 VAL A 13 ? ? -176.51 -35.65 32 3 ASP A 14 ? ? -179.11 41.48 33 3 ASP A 15 ? ? -153.44 44.21 34 3 SER A 19 ? ? -179.37 137.09 35 3 LYS A 21 ? ? -177.53 68.00 36 3 ILE A 26 ? ? -147.33 -70.42 37 3 LEU A 36 ? ? -75.40 -169.91 38 4 HIS A 6 ? ? -155.26 31.48 39 4 LYS A 8 ? ? -144.96 25.45 40 4 TYR A 9 ? ? 63.16 -170.59 41 4 ILE A 12 ? ? -178.32 -34.78 42 4 VAL A 13 ? ? -176.28 -34.50 43 4 ASP A 14 ? ? -179.16 35.37 44 4 ASP A 15 ? ? -143.79 43.10 45 4 TYR A 17 ? ? -55.35 175.90 46 4 LYS A 18 ? ? -110.20 71.33 47 4 LYS A 21 ? ? 60.87 73.70 48 4 PRO A 22 ? ? -69.72 -170.94 49 4 LEU A 23 ? ? -77.38 -74.33 50 4 TYR A 38 ? ? 66.35 142.25 51 5 ASP A 3 ? ? 52.45 86.40 52 5 ILE A 4 ? ? -91.65 45.21 53 5 CYS A 10 ? ? 60.94 -177.02 54 5 ILE A 12 ? ? -176.67 -37.78 55 5 VAL A 13 ? ? 179.19 86.63 56 5 TYR A 17 ? ? -51.99 170.58 57 5 SER A 19 ? ? 64.21 156.59 58 5 LYS A 21 ? ? -177.18 69.08 59 5 PRO A 22 ? ? -69.75 -170.67 60 5 ILE A 26 ? ? -146.22 -71.89 61 5 TYR A 38 ? ? 63.15 92.63 62 6 LYS A 8 ? ? -147.81 25.56 63 6 CYS A 10 ? ? 63.41 -177.92 64 6 VAL A 13 ? ? -152.97 53.09 65 6 ASP A 15 ? ? -165.91 42.18 66 6 PRO A 22 ? ? -69.76 -170.51 67 6 PHE A 24 ? ? -162.49 -74.53 68 6 TRP A 27 ? ? 58.47 96.45 69 6 LEU A 36 ? ? -76.61 -169.80 70 6 TYR A 38 ? ? 60.95 91.12 71 7 CYS A 10 ? ? 65.63 148.27 72 7 ILE A 12 ? ? -170.85 -44.38 73 7 VAL A 13 ? ? -153.82 55.68 74 7 PHE A 24 ? ? -144.34 36.10 75 7 LYS A 25 ? ? 64.31 156.99 76 7 ILE A 26 ? ? -148.37 -72.98 77 7 TRP A 37 ? ? -70.11 -71.02 78 8 GLU A 2 ? ? -98.81 57.80 79 8 CYS A 10 ? ? 64.95 151.66 80 8 ILE A 12 ? ? -171.82 -44.41 81 8 VAL A 13 ? ? -157.18 -38.94 82 8 ASP A 14 ? ? 178.85 34.52 83 8 ASP A 15 ? ? -146.34 50.21 84 8 TYR A 17 ? ? -61.77 -172.60 85 8 SER A 19 ? ? -158.39 45.55 86 8 LYS A 21 ? ? 58.79 74.38 87 8 PRO A 22 ? ? -69.74 -170.90 88 8 TRP A 27 ? ? 61.90 104.24 89 8 LEU A 36 ? ? -58.59 -176.51 90 9 HIS A 6 ? ? -105.77 55.93 91 9 LYS A 8 ? ? -166.71 40.89 92 9 TYR A 9 ? ? 57.44 179.67 93 9 ILE A 12 ? ? -176.46 -35.59 94 9 VAL A 13 ? ? -176.58 -35.69 95 9 ASP A 14 ? ? -169.51 30.21 96 9 SER A 19 ? ? 62.12 166.53 97 9 LYS A 21 ? ? -156.71 67.54 98 9 PRO A 22 ? ? -69.75 -170.93 99 9 PHE A 24 ? ? -152.68 25.78 100 9 LYS A 25 ? ? 55.29 91.74 101 9 LEU A 36 ? ? -69.30 -169.73 102 10 HIS A 6 ? ? 57.09 77.71 103 10 TYR A 9 ? ? 51.76 75.49 104 10 CYS A 10 ? ? 56.08 -178.23 105 10 VAL A 13 ? ? -151.24 -39.34 106 10 ASP A 14 ? ? -179.87 34.37 107 10 ASP A 15 ? ? -157.44 54.18 108 10 SER A 19 ? ? 66.53 122.29 109 10 PRO A 22 ? ? -69.76 -170.53 110 10 PHE A 24 ? ? -159.78 61.08 111 10 LYS A 25 ? ? 63.13 105.06 112 10 TRP A 27 ? ? 65.24 118.47 113 10 TYR A 38 ? ? 66.35 142.28 114 11 TYR A 9 ? ? 51.90 74.18 115 11 CYS A 10 ? ? 64.59 111.06 116 11 ILE A 12 ? ? -176.38 -35.67 117 11 VAL A 13 ? ? -176.83 -36.58 118 11 ASP A 14 ? ? -179.74 34.62 119 11 ASP A 15 ? ? -148.59 51.21 120 11 LYS A 18 ? ? 56.70 88.32 121 11 LYS A 21 ? ? -167.41 66.90 122 11 PRO A 22 ? ? -69.78 -170.75 123 11 LEU A 23 ? ? -94.38 -64.56 124 11 LYS A 25 ? ? -65.07 90.89 125 11 TRP A 27 ? ? 58.98 92.19 126 11 TYR A 38 ? ? 178.15 143.87 127 12 LYS A 8 ? ? -142.93 44.72 128 12 TYR A 9 ? ? 58.82 -178.08 129 12 VAL A 13 ? ? -150.26 -57.60 130 12 ASP A 14 ? ? -163.21 29.14 131 12 CYS A 16 ? ? 72.35 -69.08 132 12 SER A 19 ? ? -160.64 -169.59 133 12 LYS A 21 ? ? 61.43 74.72 134 12 PRO A 22 ? ? -69.75 -176.39 135 12 TRP A 27 ? ? 63.08 109.14 136 12 TYR A 38 ? ? 51.93 87.13 137 13 TYR A 9 ? ? 51.64 78.18 138 13 CYS A 10 ? ? 63.93 158.19 139 13 ILE A 12 ? ? -177.06 -39.01 140 13 VAL A 13 ? ? -146.99 58.84 141 13 ASP A 15 ? ? -122.82 -59.84 142 13 CYS A 16 ? ? 71.86 -67.88 143 13 TYR A 17 ? ? -49.95 167.40 144 13 LYS A 18 ? ? -96.98 55.12 145 13 PHE A 24 ? ? -151.47 26.44 146 13 LYS A 25 ? ? 62.48 95.86 147 13 ILE A 26 ? ? -85.60 -70.31 148 13 TYR A 38 ? ? 63.03 103.10 149 14 GLU A 2 ? ? 54.19 81.68 150 14 ASP A 3 ? ? 55.14 85.35 151 14 CYS A 10 ? ? 66.29 124.69 152 14 ILE A 12 ? ? -176.69 -35.63 153 14 VAL A 13 ? ? -171.75 -38.39 154 14 ASP A 14 ? ? 179.71 34.60 155 14 ASP A 15 ? ? -152.24 56.39 156 14 TYR A 17 ? ? -108.38 40.16 157 14 LYS A 18 ? ? 66.04 -168.72 158 14 SER A 19 ? ? -124.16 -163.02 159 14 LYS A 21 ? ? 58.73 89.34 160 14 PRO A 22 ? ? -69.81 -169.70 161 14 ILE A 26 ? ? -147.36 -55.21 162 15 GLU A 2 ? ? 59.82 -177.29 163 15 LYS A 8 ? ? -143.45 38.64 164 15 TYR A 9 ? ? 56.47 -177.71 165 15 VAL A 13 ? ? -176.82 -35.52 166 15 ASP A 14 ? ? -171.48 48.04 167 15 ASP A 15 ? ? -164.29 38.10 168 15 LYS A 21 ? ? -177.71 67.81 169 15 PRO A 22 ? ? -69.74 -167.18 170 15 LYS A 25 ? ? 62.91 104.29 171 15 TRP A 27 ? ? 66.74 135.13 172 15 TYR A 38 ? ? 62.24 102.29 173 16 LYS A 8 ? ? -167.99 33.12 174 16 TYR A 9 ? ? 59.26 -172.44 175 16 CYS A 10 ? ? -60.65 -171.23 176 16 VAL A 13 ? ? -176.64 -35.77 177 16 ASP A 14 ? ? -163.31 27.06 178 16 CYS A 16 ? ? 72.51 -68.72 179 16 SER A 19 ? ? 51.55 72.39 180 16 LYS A 20 ? ? -95.56 33.81 181 16 LYS A 21 ? ? 60.35 64.08 182 16 PRO A 22 ? ? -69.73 -170.01 183 16 PHE A 24 ? ? -179.92 90.64 184 16 LYS A 25 ? ? 57.95 96.48 185 16 TRP A 27 ? ? 64.95 115.35 186 16 TRP A 37 ? ? -56.67 177.18 187 17 TYR A 9 ? ? 64.26 -170.15 188 17 ILE A 12 ? ? -178.11 -41.59 189 17 VAL A 13 ? ? -152.86 60.17 190 17 ASP A 15 ? ? -124.02 -60.38 191 17 CYS A 16 ? ? 70.53 -70.03 192 17 LYS A 18 ? ? -77.19 -75.84 193 17 PRO A 22 ? ? -69.77 -176.60 194 17 PHE A 24 ? ? -152.87 59.58 195 17 LYS A 25 ? ? 56.99 80.05 196 17 TRP A 37 ? ? -55.74 176.63 197 18 HIS A 6 ? ? -144.59 56.88 198 18 TYR A 9 ? ? 60.83 168.25 199 18 VAL A 13 ? ? -177.26 -38.22 200 18 ASP A 14 ? ? -168.24 28.58 201 18 ASP A 15 ? ? -143.07 50.89 202 18 LYS A 18 ? ? -163.20 -79.37 203 18 SER A 19 ? ? 50.28 -168.59 204 18 LYS A 21 ? ? 65.44 67.95 205 18 PRO A 22 ? ? -69.82 -165.51 206 18 PHE A 24 ? ? 68.07 154.69 207 18 LYS A 25 ? ? 63.99 85.34 208 18 ILE A 26 ? ? -156.41 -40.46 209 19 ILE A 4 ? ? -54.84 101.39 210 19 HIS A 6 ? ? -157.72 70.43 211 19 TYR A 9 ? ? 51.59 87.85 212 19 CYS A 10 ? ? 63.26 164.14 213 19 ILE A 12 ? ? -179.91 -44.89 214 19 VAL A 13 ? ? -157.72 -39.14 215 19 ASP A 14 ? ? 178.01 34.84 216 19 ASP A 15 ? ? -144.66 50.30 217 19 LYS A 18 ? ? -134.63 -76.52 218 19 SER A 19 ? ? 54.24 -175.83 219 19 LYS A 20 ? ? -91.99 54.90 220 19 LYS A 21 ? ? 63.49 68.17 221 19 PRO A 22 ? ? -69.68 -170.90 222 19 TYR A 38 ? ? -68.98 89.57 223 20 GLU A 2 ? ? 59.01 177.52 224 20 HIS A 6 ? ? -143.58 57.17 225 20 LYS A 8 ? ? -153.02 26.31 226 20 CYS A 10 ? ? 64.53 155.28 227 20 ILE A 12 ? ? -178.44 -33.50 228 20 VAL A 13 ? ? -156.66 -74.66 229 20 ASP A 14 ? ? -150.57 50.21 230 20 ASP A 15 ? ? -135.24 -67.77 231 20 TYR A 17 ? ? -146.26 16.00 232 20 LYS A 18 ? ? 63.66 157.64 233 20 LYS A 21 ? ? 63.45 73.17 234 20 PRO A 22 ? ? -69.77 -170.35 235 20 LEU A 23 ? ? -81.51 -72.44 236 20 PHE A 24 ? ? -142.19 -74.76 237 20 TYR A 38 ? ? 63.03 104.65 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #