data_7D8L # _entry.id 7D8L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7D8L pdb_00007d8l 10.2210/pdb7d8l/pdb WWPDB D_1300018900 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7D8L _pdbx_database_status.recvd_initial_deposition_date 2020-10-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, Z.' 1 0000-0001-6476-9781 'Li, X.' 2 0000-0001-5221-0817 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-464X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 288 _citation.language ? _citation.page_first 6019 _citation.page_last 6034 _citation.title 'The structural mechanism for the nucleoside tri- and diphosphate hydrolysis activity of Ntdp from Staphylococcus aureus.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.15911 _citation.pdbx_database_id_PubMed 33955674 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Z.' 1 ? primary 'Shen, H.' 2 ? primary 'He, B.' 3 ? primary 'Teng, M.' 4 ? primary 'Guo, Q.' 5 ? primary 'Li, X.' 6 0000-0001-5221-0817 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 111.710 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7D8L _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.968 _cell.length_a_esd ? _cell.length_b 35.907 _cell.length_b_esd ? _cell.length_c 59.460 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7D8L _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UPF0374 protein SA1684' 21734.592 1 ? ? ? ? 2 non-polymer syn "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" 539.246 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 133 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHSEYWFNVICMF REDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKG PFAPDFIKVWKERYKKIRQY ; _entity_poly.pdbx_seq_one_letter_code_can ;MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHSEYWFNVICMF REDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKG PFAPDFIKVWKERYKKIRQY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ARG n 1 4 GLU n 1 5 SER n 1 6 ILE n 1 7 PRO n 1 8 LYS n 1 9 GLU n 1 10 GLY n 1 11 GLU n 1 12 ASN n 1 13 ILE n 1 14 LYS n 1 15 ILE n 1 16 GLN n 1 17 SER n 1 18 TYR n 1 19 LYS n 1 20 HIS n 1 21 ASP n 1 22 GLY n 1 23 LYS n 1 24 ILE n 1 25 HIS n 1 26 ARG n 1 27 VAL n 1 28 TRP n 1 29 SER n 1 30 GLU n 1 31 THR n 1 32 THR n 1 33 ILE n 1 34 LEU n 1 35 LYS n 1 36 GLY n 1 37 THR n 1 38 ASP n 1 39 HIS n 1 40 VAL n 1 41 VAL n 1 42 ILE n 1 43 GLY n 1 44 GLY n 1 45 ASN n 1 46 ASP n 1 47 HIS n 1 48 THR n 1 49 LEU n 1 50 VAL n 1 51 THR n 1 52 GLU n 1 53 SER n 1 54 ASP n 1 55 GLY n 1 56 ARG n 1 57 THR n 1 58 TRP n 1 59 ILE n 1 60 THR n 1 61 ARG n 1 62 GLU n 1 63 PRO n 1 64 ALA n 1 65 ILE n 1 66 VAL n 1 67 TYR n 1 68 PHE n 1 69 HIS n 1 70 SER n 1 71 GLU n 1 72 TYR n 1 73 TRP n 1 74 PHE n 1 75 ASN n 1 76 VAL n 1 77 ILE n 1 78 CYS n 1 79 MET n 1 80 PHE n 1 81 ARG n 1 82 GLU n 1 83 ASP n 1 84 GLY n 1 85 ILE n 1 86 TYR n 1 87 TYR n 1 88 TYR n 1 89 CYS n 1 90 ASN n 1 91 LEU n 1 92 SER n 1 93 SER n 1 94 PRO n 1 95 PHE n 1 96 VAL n 1 97 CYS n 1 98 ASP n 1 99 GLU n 1 100 GLU n 1 101 ALA n 1 102 LEU n 1 103 LYS n 1 104 TYR n 1 105 ILE n 1 106 ASP n 1 107 TYR n 1 108 ASP n 1 109 LEU n 1 110 ASP n 1 111 ILE n 1 112 LYS n 1 113 VAL n 1 114 TYR n 1 115 PRO n 1 116 ASN n 1 117 GLY n 1 118 LYS n 1 119 TYR n 1 120 HIS n 1 121 LEU n 1 122 LEU n 1 123 ASP n 1 124 GLU n 1 125 ASP n 1 126 GLU n 1 127 TYR n 1 128 GLU n 1 129 GLN n 1 130 HIS n 1 131 MET n 1 132 ASN n 1 133 GLN n 1 134 MET n 1 135 ASN n 1 136 TYR n 1 137 PRO n 1 138 HIS n 1 139 ASP n 1 140 ILE n 1 141 ASP n 1 142 ILE n 1 143 ILE n 1 144 LEU n 1 145 ARG n 1 146 ARG n 1 147 ASN n 1 148 VAL n 1 149 ASP n 1 150 ILE n 1 151 LEU n 1 152 GLN n 1 153 GLN n 1 154 TRP n 1 155 ILE n 1 156 GLU n 1 157 GLN n 1 158 LYS n 1 159 LYS n 1 160 GLY n 1 161 PRO n 1 162 PHE n 1 163 ALA n 1 164 PRO n 1 165 ASP n 1 166 PHE n 1 167 ILE n 1 168 LYS n 1 169 VAL n 1 170 TRP n 1 171 LYS n 1 172 GLU n 1 173 ARG n 1 174 TYR n 1 175 LYS n 1 176 LYS n 1 177 ILE n 1 178 ARG n 1 179 GLN n 1 180 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SA1684 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain N315 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus N315' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158879 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y1684_STAAN _struct_ref.pdbx_db_accession Q7A4T2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHSEYWFNVICMF REDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKG PFAPDFIKVWKERYKKIRQY ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7D8L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7A4T2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 180 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 180 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 GSP non-polymer . "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" ? 'C10 H16 N5 O13 P3 S' 539.246 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7D8L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG400, 0.1M sodium citrate pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-01-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9875 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9875 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7D8L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.55 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 28764 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.4 _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.53 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.55 _reflns_shell.d_res_low 1.58 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1401 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.888 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.1200 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.6800 _refine.aniso_B[2][2] -0.9800 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 1.0600 _refine.B_iso_max 58.890 _refine.B_iso_mean 17.4800 _refine.B_iso_min 9.280 _refine.correlation_coeff_Fo_to_Fc 0.9380 _refine.correlation_coeff_Fo_to_Fc_free 0.9170 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7D8L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5500 _refine.ls_d_res_low 45.5400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 26411 _refine.ls_number_reflns_R_free 1405 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4700 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2184 _refine.ls_R_factor_R_free 0.2527 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2166 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0990 _refine.pdbx_overall_ESU_R_Free 0.1000 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.0970 _refine.overall_SU_ML 0.0770 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.5500 _refine_hist.d_res_low 45.5400 _refine_hist.number_atoms_solvent 133 _refine_hist.number_atoms_total 1650 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 174 _refine_hist.pdbx_B_iso_mean_ligand 17.53 _refine_hist.pdbx_B_iso_mean_solvent 27.16 _refine_hist.pdbx_number_atoms_protein 1477 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.013 1568 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1372 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.650 1.650 2132 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.407 1.585 3197 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.557 5.000 175 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.311 23.043 92 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.279 15.000 268 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.192 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.087 0.200 198 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1718 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 338 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.55 _refine_ls_shell.d_res_low 1.5890 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 94 _refine_ls_shell.number_reflns_R_work 1819 _refine_ls_shell.percent_reflns_obs 92.3700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2540 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2410 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7D8L _struct.title 'The structure of nucleoside phosphatase Sa1684 complex with GTP analogue from Staphylococcus aureus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7D8L _struct_keywords.text 'nucleotide phosphatase, CYTOSOLIC PROTEIN' _struct_keywords.pdbx_keywords 'CYTOSOLIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 123 ? ASN A 135 ? ASP A 123 ASN A 135 1 ? 13 HELX_P HELX_P2 AA2 PRO A 137 ? LYS A 158 ? PRO A 137 LYS A 158 1 ? 22 HELX_P HELX_P3 AA3 LYS A 159 ? PHE A 162 ? LYS A 159 PHE A 162 5 ? 4 HELX_P HELX_P4 AA4 ALA A 163 ? ARG A 178 ? ALA A 163 ARG A 178 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 90 OD1 ? ? ? 1_555 C MG . MG ? ? A ASN 90 A MG 202 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc2 metalc ? ? A ASP 106 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 106 A MG 202 1_555 ? ? ? ? ? ? ? 2.412 ? ? metalc3 metalc ? ? A ASP 108 O ? ? ? 1_555 D MG . MG ? ? A ASP 108 A MG 203 1_555 ? ? ? ? ? ? ? 2.380 ? ? metalc4 metalc ? ? A ASP 110 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 110 A MG 202 1_555 ? ? ? ? ? ? ? 2.535 ? ? metalc5 metalc ? ? A ASP 110 OD2 ? ? ? 1_555 D MG . MG ? ? A ASP 110 A MG 203 1_555 ? ? ? ? ? ? ? 2.742 ? ? metalc6 metalc ? ? A ASP 123 OD2 ? ? ? 1_555 D MG . MG ? ? A ASP 123 A MG 203 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc7 metalc ? ? A GLU 126 OE2 ? ? ? 1_555 D MG . MG ? ? A GLU 126 A MG 203 1_555 ? ? ? ? ? ? ? 2.476 ? ? metalc8 metalc ? ? B GSP . O3G ? ? ? 1_555 D MG . MG ? ? A GSP 201 A MG 203 1_555 ? ? ? ? ? ? ? 2.627 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 57 ? ILE A 59 ? THR A 57 ILE A 59 AA1 2 LEU A 49 ? GLU A 52 ? LEU A 49 GLU A 52 AA1 3 ILE A 24 ? GLY A 36 ? ILE A 24 GLY A 36 AA1 4 VAL A 40 ? ASN A 45 ? VAL A 40 ASN A 45 AA1 5 ALA A 64 ? HIS A 69 ? ALA A 64 HIS A 69 AA1 6 PHE A 74 ? ARG A 81 ? PHE A 74 ARG A 81 AA1 7 GLY A 84 ? SER A 92 ? GLY A 84 SER A 92 AA1 8 LEU A 102 ? VAL A 113 ? LEU A 102 VAL A 113 AA1 9 TYR A 119 ? LEU A 122 ? TYR A 119 LEU A 122 AA2 1 VAL A 96 ? CYS A 97 ? VAL A 96 CYS A 97 AA2 2 LEU A 102 ? VAL A 113 ? LEU A 102 VAL A 113 AA2 3 ASN A 12 ? TYR A 18 ? ASN A 12 TYR A 18 AA2 4 ILE A 24 ? GLY A 36 ? ILE A 24 GLY A 36 AA2 5 LEU A 49 ? GLU A 52 ? LEU A 49 GLU A 52 AA2 6 THR A 57 ? ILE A 59 ? THR A 57 ILE A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TRP A 58 ? O TRP A 58 N VAL A 50 ? N VAL A 50 AA1 2 3 O LEU A 49 ? O LEU A 49 N SER A 29 ? N SER A 29 AA1 3 4 N LEU A 34 ? N LEU A 34 O ILE A 42 ? O ILE A 42 AA1 4 5 N GLY A 43 ? N GLY A 43 O VAL A 66 ? O VAL A 66 AA1 5 6 N ILE A 65 ? N ILE A 65 O CYS A 78 ? O CYS A 78 AA1 6 7 N ILE A 77 ? N ILE A 77 O TYR A 88 ? O TYR A 88 AA1 7 8 N CYS A 89 ? N CYS A 89 O ILE A 111 ? O ILE A 111 AA1 8 9 N ASP A 110 ? N ASP A 110 O LEU A 122 ? O LEU A 122 AA2 1 2 N VAL A 96 ? N VAL A 96 O LYS A 103 ? O LYS A 103 AA2 2 3 O ASP A 106 ? O ASP A 106 N TYR A 18 ? N TYR A 18 AA2 3 4 N SER A 17 ? N SER A 17 O HIS A 25 ? O HIS A 25 AA2 4 5 N SER A 29 ? N SER A 29 O LEU A 49 ? O LEU A 49 AA2 5 6 N VAL A 50 ? N VAL A 50 O TRP A 58 ? O TRP A 58 # _atom_sites.entry_id 7D8L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020421 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008130 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027850 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018102 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 TRP 154 154 154 TRP TRP A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 TYR 174 174 174 TYR TYR A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 GLN 179 179 ? ? ? A . n A 1 180 TYR 180 180 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GSP 1 201 201 GSP GSP A . C 3 MG 1 202 801 MG MG A . D 3 MG 1 203 901 MG MG A . E 4 GOL 1 204 1401 GOL GOL A . F 5 HOH 1 301 43 HOH HOH A . F 5 HOH 2 302 50 HOH HOH A . F 5 HOH 3 303 68 HOH HOH A . F 5 HOH 4 304 122 HOH HOH A . F 5 HOH 5 305 74 HOH HOH A . F 5 HOH 6 306 123 HOH HOH A . F 5 HOH 7 307 120 HOH HOH A . F 5 HOH 8 308 104 HOH HOH A . F 5 HOH 9 309 16 HOH HOH A . F 5 HOH 10 310 76 HOH HOH A . F 5 HOH 11 311 69 HOH HOH A . F 5 HOH 12 312 28 HOH HOH A . F 5 HOH 13 313 59 HOH HOH A . F 5 HOH 14 314 95 HOH HOH A . F 5 HOH 15 315 25 HOH HOH A . F 5 HOH 16 316 133 HOH HOH A . F 5 HOH 17 317 75 HOH HOH A . F 5 HOH 18 318 1 HOH HOH A . F 5 HOH 19 319 87 HOH HOH A . F 5 HOH 20 320 38 HOH HOH A . F 5 HOH 21 321 7 HOH HOH A . F 5 HOH 22 322 70 HOH HOH A . F 5 HOH 23 323 91 HOH HOH A . F 5 HOH 24 324 12 HOH HOH A . F 5 HOH 25 325 53 HOH HOH A . F 5 HOH 26 326 3 HOH HOH A . F 5 HOH 27 327 27 HOH HOH A . F 5 HOH 28 328 21 HOH HOH A . F 5 HOH 29 329 24 HOH HOH A . F 5 HOH 30 330 13 HOH HOH A . F 5 HOH 31 331 6 HOH HOH A . F 5 HOH 32 332 118 HOH HOH A . F 5 HOH 33 333 78 HOH HOH A . F 5 HOH 34 334 20 HOH HOH A . F 5 HOH 35 335 71 HOH HOH A . F 5 HOH 36 336 79 HOH HOH A . F 5 HOH 37 337 121 HOH HOH A . F 5 HOH 38 338 90 HOH HOH A . F 5 HOH 39 339 45 HOH HOH A . F 5 HOH 40 340 101 HOH HOH A . F 5 HOH 41 341 57 HOH HOH A . F 5 HOH 42 342 10 HOH HOH A . F 5 HOH 43 343 8 HOH HOH A . F 5 HOH 44 344 15 HOH HOH A . F 5 HOH 45 345 77 HOH HOH A . F 5 HOH 46 346 2 HOH HOH A . F 5 HOH 47 347 56 HOH HOH A . F 5 HOH 48 348 17 HOH HOH A . F 5 HOH 49 349 80 HOH HOH A . F 5 HOH 50 350 9 HOH HOH A . F 5 HOH 51 351 85 HOH HOH A . F 5 HOH 52 352 63 HOH HOH A . F 5 HOH 53 353 83 HOH HOH A . F 5 HOH 54 354 31 HOH HOH A . F 5 HOH 55 355 61 HOH HOH A . F 5 HOH 56 356 73 HOH HOH A . F 5 HOH 57 357 96 HOH HOH A . F 5 HOH 58 358 30 HOH HOH A . F 5 HOH 59 359 5 HOH HOH A . F 5 HOH 60 360 40 HOH HOH A . F 5 HOH 61 361 41 HOH HOH A . F 5 HOH 62 362 48 HOH HOH A . F 5 HOH 63 363 54 HOH HOH A . F 5 HOH 64 364 46 HOH HOH A . F 5 HOH 65 365 34 HOH HOH A . F 5 HOH 66 366 127 HOH HOH A . F 5 HOH 67 367 39 HOH HOH A . F 5 HOH 68 368 4 HOH HOH A . F 5 HOH 69 369 36 HOH HOH A . F 5 HOH 70 370 55 HOH HOH A . F 5 HOH 71 371 115 HOH HOH A . F 5 HOH 72 372 22 HOH HOH A . F 5 HOH 73 373 52 HOH HOH A . F 5 HOH 74 374 62 HOH HOH A . F 5 HOH 75 375 58 HOH HOH A . F 5 HOH 76 376 126 HOH HOH A . F 5 HOH 77 377 112 HOH HOH A . F 5 HOH 78 378 11 HOH HOH A . F 5 HOH 79 379 117 HOH HOH A . F 5 HOH 80 380 32 HOH HOH A . F 5 HOH 81 381 132 HOH HOH A . F 5 HOH 82 382 29 HOH HOH A . F 5 HOH 83 383 33 HOH HOH A . F 5 HOH 84 384 66 HOH HOH A . F 5 HOH 85 385 98 HOH HOH A . F 5 HOH 86 386 14 HOH HOH A . F 5 HOH 87 387 103 HOH HOH A . F 5 HOH 88 388 23 HOH HOH A . F 5 HOH 89 389 18 HOH HOH A . F 5 HOH 90 390 44 HOH HOH A . F 5 HOH 91 391 97 HOH HOH A . F 5 HOH 92 392 128 HOH HOH A . F 5 HOH 93 393 37 HOH HOH A . F 5 HOH 94 394 47 HOH HOH A . F 5 HOH 95 395 60 HOH HOH A . F 5 HOH 96 396 86 HOH HOH A . F 5 HOH 97 397 93 HOH HOH A . F 5 HOH 98 398 51 HOH HOH A . F 5 HOH 99 399 109 HOH HOH A . F 5 HOH 100 400 49 HOH HOH A . F 5 HOH 101 401 26 HOH HOH A . F 5 HOH 102 402 84 HOH HOH A . F 5 HOH 103 403 113 HOH HOH A . F 5 HOH 104 404 111 HOH HOH A . F 5 HOH 105 405 94 HOH HOH A . F 5 HOH 106 406 89 HOH HOH A . F 5 HOH 107 407 42 HOH HOH A . F 5 HOH 108 408 110 HOH HOH A . F 5 HOH 109 409 100 HOH HOH A . F 5 HOH 110 410 88 HOH HOH A . F 5 HOH 111 411 106 HOH HOH A . F 5 HOH 112 412 108 HOH HOH A . F 5 HOH 113 413 92 HOH HOH A . F 5 HOH 114 414 119 HOH HOH A . F 5 HOH 115 415 102 HOH HOH A . F 5 HOH 116 416 116 HOH HOH A . F 5 HOH 117 417 114 HOH HOH A . F 5 HOH 118 418 124 HOH HOH A . F 5 HOH 119 419 131 HOH HOH A . F 5 HOH 120 420 105 HOH HOH A . F 5 HOH 121 421 67 HOH HOH A . F 5 HOH 122 422 82 HOH HOH A . F 5 HOH 123 423 129 HOH HOH A . F 5 HOH 124 424 19 HOH HOH A . F 5 HOH 125 425 107 HOH HOH A . F 5 HOH 126 426 81 HOH HOH A . F 5 HOH 127 427 130 HOH HOH A . F 5 HOH 128 428 35 HOH HOH A . F 5 HOH 129 429 64 HOH HOH A . F 5 HOH 130 430 65 HOH HOH A . F 5 HOH 131 431 72 HOH HOH A . F 5 HOH 132 432 125 HOH HOH A . F 5 HOH 133 433 99 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -15 ? 1 'SSA (A^2)' 9490 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASN 90 ? A ASN 90 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD2 ? A ASP 106 ? A ASP 106 ? 1_555 95.5 ? 2 OD1 ? A ASN 90 ? A ASN 90 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 109.1 ? 3 OD2 ? A ASP 106 ? A ASP 106 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 155.3 ? 4 O ? A ASP 108 ? A ASP 108 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 69.0 ? 5 O ? A ASP 108 ? A ASP 108 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 90.4 ? 6 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 85.5 ? 7 O ? A ASP 108 ? A ASP 108 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 OE2 ? A GLU 126 ? A GLU 126 ? 1_555 89.8 ? 8 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 OE2 ? A GLU 126 ? A GLU 126 ? 1_555 158.8 ? 9 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 OE2 ? A GLU 126 ? A GLU 126 ? 1_555 94.4 ? 10 O ? A ASP 108 ? A ASP 108 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O3G ? B GSP . ? A GSP 201 ? 1_555 168.4 ? 11 OD2 ? A ASP 110 ? A ASP 110 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O3G ? B GSP . ? A GSP 201 ? 1_555 99.6 ? 12 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O3G ? B GSP . ? A GSP 201 ? 1_555 86.6 ? 13 OE2 ? A GLU 126 ? A GLU 126 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O3G ? B GSP . ? A GSP 201 ? 1_555 101.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-17 2 'Structure model' 1 1 2021-10-06 3 'Structure model' 1 2 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_database_2.pdbx_DOI' 10 2 'Structure model' '_database_2.pdbx_database_accession' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 7D8L _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH A TYR 72 ? ? O A HOH 301 ? ? 2.18 2 1 OE2 A GLU 128 ? ? O A HOH 302 ? ? 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 146 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 146 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 146 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.52 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.22 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 108 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 73.54 _pdbx_validate_torsion.psi -63.12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A GLN 179 ? A GLN 179 6 1 Y 1 A TYR 180 ? A TYR 180 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31971124 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 GSP ? ? GSP ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" GSP 3 'MAGNESIUM ION' MG 4 GLYCEROL GOL 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #