data_7DAB # _entry.id 7DAB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DAB pdb_00007dab 10.2210/pdb7dab/pdb WWPDB D_1300019000 ? ? BMRB 36391 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'plant peptide hormone' _pdbx_database_related.db_id 36391 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7DAB _pdbx_database_status.recvd_initial_deposition_date 2020-10-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Umetsu, Y.' 1 ? 'Ohki, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'plant peptide hormone' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohki, S.' 1 ? primary 'Mori, M.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Maternally expressed gene14' _entity.formula_weight 6880.867 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Maternally expressed protein 14' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LQDEVGAPPALSAEEGVMETRAECRQGLLPCKDNKCYCCIGGGTRQCYATLAECRHACLPLNTN _entity_poly.pdbx_seq_one_letter_code_can LQDEVGAPPALSAEEGVMETRAECRQGLLPCKDNKCYCCIGGGTRQCYATLAECRHACLPLNTN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLN n 1 3 ASP n 1 4 GLU n 1 5 VAL n 1 6 GLY n 1 7 ALA n 1 8 PRO n 1 9 PRO n 1 10 ALA n 1 11 LEU n 1 12 SER n 1 13 ALA n 1 14 GLU n 1 15 GLU n 1 16 GLY n 1 17 VAL n 1 18 MET n 1 19 GLU n 1 20 THR n 1 21 ARG n 1 22 ALA n 1 23 GLU n 1 24 CYS n 1 25 ARG n 1 26 GLN n 1 27 GLY n 1 28 LEU n 1 29 LEU n 1 30 PRO n 1 31 CYS n 1 32 LYS n 1 33 ASP n 1 34 ASN n 1 35 LYS n 1 36 CYS n 1 37 TYR n 1 38 CYS n 1 39 CYS n 1 40 ILE n 1 41 GLY n 1 42 GLY n 1 43 GLY n 1 44 THR n 1 45 ARG n 1 46 GLN n 1 47 CYS n 1 48 TYR n 1 49 ALA n 1 50 THR n 1 51 LEU n 1 52 ALA n 1 53 GLU n 1 54 CYS n 1 55 ARG n 1 56 HIS n 1 57 ALA n 1 58 CYS n 1 59 LEU n 1 60 PRO n 1 61 LEU n 1 62 ASN n 1 63 THR n 1 64 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name Maize _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Meg14, ZEAMMB73_Zm00001d019033' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Zea mays' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4577 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Nicotiana tabacum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4097 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type TMV _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A076YHT9_MAIZE _struct_ref.pdbx_db_accession A0A076YHT9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LQDEVGAPPALSAEEGVMETRAECRQVLLPCKDNKCYCCIGGGTRQCYATLAECRHACLPLNTN _struct_ref.pdbx_align_begin 26 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7DAB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A076YHT9 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 64 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7DAB _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 27 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A076YHT9 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 52 _struct_ref_seq_dif.details variant _struct_ref_seq_dif.pdbx_auth_seq_num 27 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCA' 1 isotropic 2 1 1 '3D HNCACB' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D 1H-15N NOESY' 1 isotropic 5 1 1 '3D 1H-15N TOCSY' 1 isotropic 6 1 1 '3D HCCH-TOCSY' 1 isotropic 7 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details 'uniformly labeled' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label '13C, 15N' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.2 mM 13C, 15N protein, 50 mM unlabeled potassium phosphate, 50 mM unlabeled potassium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '13C, 15N' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ;0.2mM protein 50mM phosphate buffer (pH6.8) 50mM KCl ; # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7DAB _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 7DAB _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7DAB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'data analysis' Sparky ? Goddard 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DAB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7DAB _struct.title 'plant peptide hormone' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DAB _struct_keywords.text 'STRUCTURE FROM CYANA 2.1, UNKNOWN FUNCTION, Plant protein' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 50 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 57 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 50 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 57 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 24 A CYS 39 1_555 ? ? ? ? ? ? ? 2.146 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 31 A CYS 54 1_555 ? ? ? ? ? ? ? 2.894 ? ? disulf3 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 31 A CYS 58 1_555 ? ? ? ? ? ? ? 1.918 ? ? disulf4 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 36 A CYS 54 1_555 ? ? ? ? ? ? ? 2.129 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 23 ? GLN A 26 ? GLU A 23 GLN A 26 AA1 2 TYR A 37 ? ILE A 40 ? TYR A 37 ILE A 40 AA1 3 GLN A 46 ? TYR A 48 ? GLN A 46 TYR A 48 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 25 ? N ARG A 25 O CYS A 38 ? O CYS A 38 AA1 2 3 N CYS A 39 ? N CYS A 39 O GLN A 46 ? O GLN A 46 # _atom_sites.entry_id 7DAB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ASN 64 64 64 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5400 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-20 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group Other # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_database_status # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 protein 0.2 ? mM '13C, 15N' 1 'potassium phosphate' 50 ? mM unlabeled 1 'potassium chloride' 50 ? mM unlabeled # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.20 2 2 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.41 3 3 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.43 4 4 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.36 5 4 SG A CYS 31 ? ? SG A CYS 36 ? ? 2.15 6 5 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.43 7 6 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.56 8 7 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.46 9 8 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.10 10 9 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.43 11 9 SG A CYS 31 ? ? SG A CYS 36 ? ? 1.92 12 10 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.02 13 11 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.34 14 12 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.47 15 12 SG A CYS 31 ? ? SG A CYS 36 ? ? 1.83 16 13 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.32 17 14 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.31 18 15 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.27 19 16 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.34 20 17 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.68 21 17 SG A CYS 31 ? ? SG A CYS 36 ? ? 2.13 22 18 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.47 23 19 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.39 24 20 SG A CYS 38 ? ? SG A CYS 47 ? ? 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 2 ? ? -178.08 116.11 2 1 ASP A 3 ? ? -155.03 42.80 3 1 SER A 12 ? ? -165.05 88.97 4 1 ALA A 13 ? ? -87.12 -72.96 5 1 GLU A 14 ? ? -179.29 35.73 6 1 ARG A 21 ? ? -144.04 -74.79 7 1 ALA A 22 ? ? -151.18 -69.47 8 1 GLN A 26 ? ? 54.36 -173.96 9 1 LEU A 28 ? ? -150.43 -71.53 10 1 PRO A 30 ? ? -69.76 -88.09 11 1 LYS A 32 ? ? -159.26 -66.29 12 1 ASP A 33 ? ? -59.54 -171.82 13 1 LYS A 35 ? ? 51.53 70.98 14 1 CYS A 36 ? ? -47.54 -80.96 15 1 THR A 44 ? ? -134.20 -77.64 16 1 ARG A 45 ? ? 36.48 68.91 17 1 CYS A 58 ? ? -150.69 -40.81 18 1 ASN A 62 ? ? -174.26 -36.07 19 2 GLN A 2 ? ? -179.36 109.61 20 2 GLU A 4 ? ? -174.83 102.70 21 2 ALA A 10 ? ? -176.73 36.82 22 2 SER A 12 ? ? -165.15 58.44 23 2 ALA A 13 ? ? -98.21 -73.21 24 2 GLU A 14 ? ? -150.94 39.47 25 2 MET A 18 ? ? -147.97 32.61 26 2 GLU A 19 ? ? 63.23 93.11 27 2 ARG A 21 ? ? -147.09 -75.25 28 2 ALA A 22 ? ? -179.21 -67.76 29 2 GLN A 26 ? ? -167.74 -38.80 30 2 LEU A 28 ? ? -170.68 -38.13 31 2 LYS A 32 ? ? -161.57 -43.23 32 2 CYS A 36 ? ? -49.04 -80.66 33 2 THR A 44 ? ? -102.67 -74.22 34 2 ARG A 45 ? ? 37.43 71.82 35 2 LEU A 59 ? ? -48.29 156.83 36 2 PRO A 60 ? ? -69.78 89.13 37 2 ASN A 62 ? ? -134.89 -50.67 38 2 THR A 63 ? ? 50.07 87.87 39 3 GLN A 2 ? ? -59.25 -175.77 40 3 ALA A 7 ? ? -178.28 68.24 41 3 ALA A 10 ? ? -157.64 24.11 42 3 LEU A 11 ? ? -140.99 13.80 43 3 ALA A 13 ? ? -86.99 -76.41 44 3 GLU A 14 ? ? -179.93 34.37 45 3 MET A 18 ? ? -51.97 170.44 46 3 GLU A 19 ? ? 63.60 106.58 47 3 ALA A 22 ? ? -174.07 -69.61 48 3 GLN A 26 ? ? -174.54 -36.52 49 3 CYS A 31 ? ? -51.14 103.52 50 3 LYS A 32 ? ? -154.81 -74.50 51 3 ASN A 34 ? ? 53.96 90.87 52 3 CYS A 36 ? ? -50.77 -81.27 53 3 THR A 44 ? ? -114.86 -77.05 54 3 ARG A 45 ? ? 47.45 70.33 55 3 CYS A 58 ? ? -174.02 -44.73 56 3 LEU A 61 ? ? -79.75 -167.95 57 4 GLN A 2 ? ? -179.24 131.83 58 4 ALA A 10 ? ? -155.02 -68.08 59 4 LEU A 11 ? ? -176.84 101.15 60 4 SER A 12 ? ? -179.31 76.67 61 4 ALA A 13 ? ? -87.17 -73.77 62 4 GLU A 14 ? ? -179.32 38.51 63 4 MET A 18 ? ? -152.16 31.28 64 4 GLU A 19 ? ? 51.68 88.44 65 4 THR A 20 ? ? -67.76 -74.75 66 4 ALA A 22 ? ? -178.97 -67.68 67 4 GLN A 26 ? ? -179.65 33.84 68 4 CYS A 31 ? ? -61.40 95.17 69 4 ASP A 33 ? ? -77.26 -75.60 70 4 CYS A 36 ? ? -51.28 -80.14 71 4 THR A 44 ? ? -95.66 -71.66 72 4 ARG A 45 ? ? 37.51 66.17 73 4 CYS A 58 ? ? -172.87 -43.53 74 4 LEU A 61 ? ? -51.41 104.68 75 4 ASN A 62 ? ? -158.52 23.97 76 5 GLN A 2 ? ? -179.33 -72.80 77 5 ASP A 3 ? ? 59.41 86.84 78 5 VAL A 5 ? ? 59.39 93.41 79 5 ALA A 10 ? ? -165.98 -66.24 80 5 SER A 12 ? ? -171.42 -74.83 81 5 ALA A 13 ? ? -171.04 -66.17 82 5 GLU A 14 ? ? -163.52 31.76 83 5 MET A 18 ? ? -173.77 110.59 84 5 GLU A 19 ? ? -91.32 -72.90 85 5 THR A 20 ? ? -138.69 -73.79 86 5 ARG A 21 ? ? -55.35 -74.73 87 5 ALA A 22 ? ? -178.44 -67.68 88 5 GLN A 26 ? ? -169.38 -38.41 89 5 CYS A 31 ? ? -64.57 92.24 90 5 ASP A 33 ? ? -73.36 -75.73 91 5 CYS A 36 ? ? -50.84 -78.41 92 5 THR A 44 ? ? -105.29 -74.68 93 5 ARG A 45 ? ? 37.33 69.46 94 5 CYS A 58 ? ? -174.70 -42.55 95 5 LEU A 61 ? ? -58.97 103.24 96 5 ASN A 62 ? ? -169.12 31.64 97 6 VAL A 5 ? ? -145.11 46.20 98 6 ALA A 10 ? ? -90.32 -75.70 99 6 SER A 12 ? ? -179.86 -34.66 100 6 ALA A 13 ? ? -175.31 -75.61 101 6 GLU A 19 ? ? -72.77 -74.85 102 6 THR A 20 ? ? -102.09 -74.92 103 6 ARG A 21 ? ? -76.82 -75.08 104 6 ALA A 22 ? ? -178.76 -69.54 105 6 GLN A 26 ? ? -167.24 -38.89 106 6 CYS A 31 ? ? -69.45 89.17 107 6 ASN A 34 ? ? 57.49 95.20 108 6 CYS A 36 ? ? -51.06 -76.89 109 6 THR A 44 ? ? -113.25 -76.08 110 6 ARG A 45 ? ? 49.44 71.70 111 6 CYS A 58 ? ? -175.03 -44.37 112 6 LEU A 61 ? ? -57.87 103.20 113 6 THR A 63 ? ? 37.35 43.54 114 7 GLN A 2 ? ? -179.34 126.37 115 7 ASP A 3 ? ? 63.29 77.73 116 7 GLU A 4 ? ? -160.03 77.81 117 7 ALA A 7 ? ? -171.59 68.74 118 7 ALA A 13 ? ? -87.48 -71.82 119 7 GLU A 14 ? ? -178.03 -50.40 120 7 GLU A 19 ? ? -145.85 -74.55 121 7 THR A 20 ? ? -98.84 -74.65 122 7 ARG A 21 ? ? -65.19 -75.71 123 7 ALA A 22 ? ? -178.78 -66.75 124 7 GLN A 26 ? ? -164.99 26.90 125 7 PRO A 30 ? ? -69.75 -179.17 126 7 LYS A 32 ? ? -126.04 -167.20 127 7 ASN A 34 ? ? 64.16 -168.08 128 7 CYS A 36 ? ? -88.56 -83.77 129 7 THR A 44 ? ? -129.81 -77.54 130 7 ARG A 45 ? ? 36.55 65.18 131 7 CYS A 58 ? ? -168.13 -38.69 132 7 LEU A 61 ? ? -51.66 103.97 133 7 ASN A 62 ? ? -159.29 25.62 134 8 GLN A 2 ? ? 56.75 70.21 135 8 GLU A 4 ? ? -155.95 27.12 136 8 VAL A 5 ? ? 55.60 77.37 137 8 ALA A 7 ? ? 57.60 70.11 138 8 LEU A 11 ? ? 48.61 83.11 139 8 SER A 12 ? ? -164.90 -74.89 140 8 ALA A 13 ? ? -174.37 -75.69 141 8 GLU A 14 ? ? -174.22 -36.89 142 8 VAL A 17 ? ? 51.01 -172.48 143 8 MET A 18 ? ? -178.48 102.45 144 8 GLU A 19 ? ? -52.01 -73.72 145 8 THR A 20 ? ? -153.86 -74.56 146 8 ARG A 21 ? ? -52.75 -75.28 147 8 ALA A 22 ? ? -178.84 -66.85 148 8 GLN A 26 ? ? -179.52 34.24 149 8 PRO A 30 ? ? -69.74 70.36 150 8 CYS A 31 ? ? 50.66 88.81 151 8 ASN A 34 ? ? 51.79 88.86 152 8 LYS A 35 ? ? 63.57 61.49 153 8 CYS A 36 ? ? -49.89 -78.66 154 8 THR A 44 ? ? -103.13 -75.43 155 8 ARG A 45 ? ? 37.26 68.94 156 8 CYS A 58 ? ? -174.47 -43.99 157 8 LEU A 61 ? ? -51.74 107.74 158 8 ASN A 62 ? ? -151.16 -45.18 159 8 THR A 63 ? ? 51.64 87.86 160 9 GLU A 4 ? ? -165.96 97.38 161 9 VAL A 5 ? ? 39.67 38.55 162 9 ALA A 7 ? ? 53.88 72.36 163 9 ALA A 10 ? ? -175.79 -37.71 164 9 SER A 12 ? ? -150.87 -74.97 165 9 ALA A 13 ? ? -168.90 -75.75 166 9 GLU A 14 ? ? -153.55 -67.64 167 9 GLU A 15 ? ? -154.92 23.44 168 9 MET A 18 ? ? -170.24 83.43 169 9 GLU A 19 ? ? -178.19 116.21 170 9 THR A 20 ? ? -105.04 -74.60 171 9 ALA A 22 ? ? -177.11 -64.47 172 9 GLN A 26 ? ? -174.51 32.10 173 9 ASP A 33 ? ? -49.57 166.79 174 9 ASN A 34 ? ? 62.40 -167.81 175 9 LYS A 35 ? ? -47.11 103.28 176 9 CYS A 36 ? ? -87.98 -81.27 177 9 THR A 44 ? ? -146.05 -79.51 178 9 ARG A 45 ? ? 43.72 73.77 179 9 CYS A 58 ? ? -167.31 -41.05 180 9 LEU A 61 ? ? -59.69 103.59 181 9 ASN A 62 ? ? -167.18 28.83 182 10 GLN A 2 ? ? -178.01 115.42 183 10 VAL A 5 ? ? 56.26 88.13 184 10 ALA A 7 ? ? -113.63 73.88 185 10 ALA A 10 ? ? -178.06 -63.81 186 10 SER A 12 ? ? -171.38 -74.86 187 10 ALA A 13 ? ? -164.40 -63.12 188 10 GLU A 14 ? ? -178.99 37.33 189 10 MET A 18 ? ? -174.88 125.14 190 10 GLU A 19 ? ? -130.04 -74.60 191 10 THR A 20 ? ? -101.40 -74.72 192 10 ARG A 21 ? ? -68.45 -75.54 193 10 ALA A 22 ? ? -179.09 -68.93 194 10 GLN A 26 ? ? -147.84 -40.96 195 10 CYS A 31 ? ? -61.42 -167.90 196 10 LYS A 32 ? ? 66.78 -162.95 197 10 ASP A 33 ? ? 71.07 -167.76 198 10 CYS A 36 ? ? -51.30 -84.07 199 10 THR A 44 ? ? -99.48 -74.72 200 10 ARG A 45 ? ? 37.54 60.68 201 10 LEU A 59 ? ? -152.57 -62.84 202 10 ASN A 62 ? ? -175.06 -35.34 203 11 GLN A 2 ? ? -56.11 107.78 204 11 GLU A 4 ? ? 63.02 104.57 205 11 ALA A 10 ? ? -160.59 -75.68 206 11 SER A 12 ? ? -179.55 -74.91 207 11 ALA A 13 ? ? -174.39 -61.42 208 11 GLU A 14 ? ? -172.26 -46.04 209 11 GLU A 19 ? ? 65.01 92.83 210 11 ARG A 21 ? ? -53.27 -75.19 211 11 ALA A 22 ? ? -179.55 -69.30 212 11 GLN A 26 ? ? -152.68 -47.90 213 11 CYS A 31 ? ? 61.88 90.83 214 11 LYS A 32 ? ? -153.11 -75.61 215 11 ASN A 34 ? ? 51.32 88.76 216 11 CYS A 36 ? ? -49.36 -79.93 217 11 THR A 44 ? ? -106.86 -74.92 218 11 ARG A 45 ? ? 37.20 58.93 219 11 CYS A 58 ? ? -133.99 -43.49 220 11 LEU A 61 ? ? 51.77 92.68 221 11 ASN A 62 ? ? -150.68 22.29 222 12 GLN A 2 ? ? -179.25 148.52 223 12 SER A 12 ? ? 179.12 -76.33 224 12 ALA A 13 ? ? 178.55 86.71 225 12 GLU A 19 ? ? -179.36 116.18 226 12 ARG A 21 ? ? -72.45 -76.94 227 12 ALA A 22 ? ? 179.44 -68.14 228 12 LYS A 32 ? ? -127.40 -168.62 229 12 ASP A 33 ? ? -78.03 -75.51 230 12 LYS A 35 ? ? 50.68 70.06 231 12 CYS A 36 ? ? -51.22 -81.67 232 12 THR A 44 ? ? -101.99 -76.45 233 12 ARG A 45 ? ? 36.98 69.03 234 12 CYS A 58 ? ? -170.93 -37.12 235 12 LEU A 61 ? ? -51.56 107.69 236 12 ASN A 62 ? ? -151.39 -45.12 237 12 THR A 63 ? ? 51.61 87.75 238 13 GLN A 2 ? ? 62.26 174.05 239 13 ALA A 10 ? ? -150.35 -68.70 240 13 SER A 12 ? ? -162.55 76.99 241 13 GLU A 14 ? ? -176.66 -46.90 242 13 GLU A 15 ? ? -159.11 25.34 243 13 ALA A 22 ? ? -178.66 -66.51 244 13 GLN A 26 ? ? -164.30 -40.66 245 13 LEU A 28 ? ? -158.54 -41.16 246 13 CYS A 31 ? ? 54.51 91.16 247 13 LYS A 32 ? ? -142.36 -74.91 248 13 ASN A 34 ? ? 53.27 89.99 249 13 CYS A 36 ? ? -50.32 -78.00 250 13 THR A 44 ? ? -113.27 -76.44 251 13 ARG A 45 ? ? 49.01 71.80 252 13 CYS A 58 ? ? -174.51 -44.20 253 13 LEU A 61 ? ? -51.69 108.98 254 13 ASN A 62 ? ? -164.55 -37.37 255 13 THR A 63 ? ? 43.72 -164.63 256 14 GLN A 2 ? ? -179.34 60.08 257 14 LEU A 11 ? ? -71.35 -75.39 258 14 SER A 12 ? ? -145.92 -74.89 259 14 ALA A 13 ? ? -178.35 79.11 260 14 MET A 18 ? ? -172.10 110.97 261 14 ARG A 21 ? ? -51.80 -72.16 262 14 ALA A 22 ? ? -178.46 -66.37 263 14 GLN A 26 ? ? -168.14 -43.41 264 14 LEU A 28 ? ? -178.56 -35.04 265 14 CYS A 31 ? ? 64.85 64.39 266 14 LYS A 32 ? ? -168.32 30.26 267 14 ASP A 33 ? ? -179.50 141.68 268 14 ASN A 34 ? ? 51.14 -166.94 269 14 LYS A 35 ? ? -50.01 102.02 270 14 CYS A 36 ? ? -63.09 -85.76 271 14 THR A 44 ? ? -102.75 -68.05 272 14 ARG A 45 ? ? 37.62 68.65 273 14 CYS A 58 ? ? -162.48 -40.37 274 14 LEU A 61 ? ? -50.61 104.20 275 14 ASN A 62 ? ? -160.53 25.22 276 15 GLN A 2 ? ? -53.44 108.78 277 15 VAL A 5 ? ? 52.01 81.28 278 15 ALA A 10 ? ? -152.08 -47.32 279 15 ALA A 13 ? ? -87.12 -71.93 280 15 GLU A 14 ? ? -179.34 36.41 281 15 GLU A 19 ? ? -54.51 -71.56 282 15 THR A 20 ? ? -151.97 -74.26 283 15 ARG A 21 ? ? -65.53 -74.84 284 15 ALA A 22 ? ? -178.55 -67.40 285 15 LEU A 29 ? ? -178.16 -59.34 286 15 CYS A 31 ? ? -167.76 102.65 287 15 ASN A 34 ? ? 58.55 97.02 288 15 CYS A 36 ? ? -50.65 -77.69 289 15 THR A 44 ? ? -107.83 -75.42 290 15 ARG A 45 ? ? 37.15 71.63 291 15 CYS A 58 ? ? -174.71 -45.80 292 15 ASN A 62 ? ? -143.37 -70.05 293 15 THR A 63 ? ? 60.42 98.20 294 16 GLN A 2 ? ? -178.07 88.56 295 16 ASP A 3 ? ? -156.82 44.02 296 16 ALA A 7 ? ? -179.22 -61.39 297 16 SER A 12 ? ? -173.13 38.98 298 16 ALA A 13 ? ? -164.18 -75.00 299 16 GLU A 14 ? ? -174.03 32.17 300 16 VAL A 17 ? ? 43.30 -164.93 301 16 MET A 18 ? ? -155.09 86.25 302 16 THR A 20 ? ? -158.33 -40.83 303 16 ARG A 21 ? ? -63.04 -74.76 304 16 ALA A 22 ? ? -175.41 -66.26 305 16 GLN A 26 ? ? -179.78 34.25 306 16 CYS A 31 ? ? -61.16 96.37 307 16 LYS A 32 ? ? -149.96 -75.73 308 16 ASN A 34 ? ? 51.48 89.05 309 16 CYS A 36 ? ? -49.93 -79.72 310 16 THR A 44 ? ? -132.59 -80.04 311 16 ARG A 45 ? ? 41.77 71.78 312 16 CYS A 58 ? ? -171.05 -42.43 313 16 ASN A 62 ? ? -173.38 -36.61 314 17 GLU A 4 ? ? 54.66 90.49 315 17 LEU A 11 ? ? -166.46 28.68 316 17 SER A 12 ? ? -163.75 -74.87 317 17 ALA A 13 ? ? -170.36 -75.52 318 17 GLU A 14 ? ? -179.25 -59.24 319 17 VAL A 17 ? ? 43.21 -164.89 320 17 THR A 20 ? ? -176.95 -36.86 321 17 ARG A 21 ? ? -144.55 -74.83 322 17 ALA A 22 ? ? -178.77 -66.31 323 17 GLN A 26 ? ? -163.65 54.69 324 17 LYS A 32 ? ? 178.73 -31.70 325 17 ASP A 33 ? ? -59.68 -169.27 326 17 CYS A 36 ? ? -55.02 -80.58 327 17 THR A 44 ? ? -103.27 -75.71 328 17 ARG A 45 ? ? 37.14 68.56 329 17 CYS A 58 ? ? -170.44 -36.25 330 17 LEU A 61 ? ? -66.19 92.35 331 17 ASN A 62 ? ? -162.25 26.37 332 18 GLN A 2 ? ? -53.66 102.24 333 18 GLU A 4 ? ? -60.58 99.50 334 18 VAL A 5 ? ? 39.64 38.64 335 18 ALA A 7 ? ? -177.21 73.07 336 18 PRO A 9 ? ? -69.79 78.98 337 18 SER A 12 ? ? -151.70 82.78 338 18 ALA A 13 ? ? -87.11 -71.68 339 18 GLU A 14 ? ? -179.31 40.03 340 18 MET A 18 ? ? 63.22 61.32 341 18 GLU A 19 ? ? -79.39 -74.27 342 18 THR A 20 ? ? -118.82 -73.95 343 18 ARG A 21 ? ? -62.69 -74.91 344 18 ALA A 22 ? ? -170.06 -68.97 345 18 ASN A 34 ? ? 62.37 104.42 346 18 CYS A 36 ? ? -50.11 -82.06 347 18 THR A 44 ? ? -118.73 -73.61 348 18 ARG A 45 ? ? 37.46 67.02 349 18 CYS A 58 ? ? -148.09 -40.30 350 18 PRO A 60 ? ? -69.75 71.54 351 18 ASN A 62 ? ? -142.46 22.28 352 19 ASP A 3 ? ? 61.14 97.43 353 19 VAL A 5 ? ? 59.27 91.42 354 19 LEU A 11 ? ? -154.80 21.56 355 19 SER A 12 ? ? 179.81 -75.37 356 19 ALA A 13 ? ? -178.48 -75.72 357 19 GLU A 14 ? ? -151.68 26.65 358 19 MET A 18 ? ? 63.66 88.35 359 19 GLU A 19 ? ? -113.82 -74.68 360 19 THR A 20 ? ? -97.71 -74.76 361 19 ARG A 21 ? ? -72.23 -74.89 362 19 ALA A 22 ? ? -178.06 -65.35 363 19 GLN A 26 ? ? -160.52 25.11 364 19 CYS A 31 ? ? -63.19 93.98 365 19 LYS A 32 ? ? -178.81 -68.99 366 19 ASP A 33 ? ? -60.64 -169.03 367 19 ASN A 34 ? ? -49.99 150.90 368 19 CYS A 36 ? ? -50.62 -79.76 369 19 THR A 44 ? ? -113.12 -75.77 370 19 ARG A 45 ? ? 50.26 71.25 371 19 CYS A 58 ? ? -174.71 -41.30 372 19 ASN A 62 ? ? 179.39 126.48 373 20 GLN A 2 ? ? -179.32 93.71 374 20 GLU A 4 ? ? -55.55 106.19 375 20 PRO A 9 ? ? -69.70 79.20 376 20 LEU A 11 ? ? -160.45 45.97 377 20 SER A 12 ? ? -153.63 22.88 378 20 ALA A 13 ? ? 179.84 84.41 379 20 GLU A 15 ? ? -174.89 31.78 380 20 MET A 18 ? ? -179.20 87.13 381 20 GLU A 19 ? ? -57.56 -74.55 382 20 THR A 20 ? ? 179.69 -40.93 383 20 ARG A 21 ? ? -62.80 -74.90 384 20 ALA A 22 ? ? -178.60 -69.15 385 20 LEU A 28 ? ? -126.78 -78.61 386 20 LEU A 29 ? ? -92.05 -60.59 387 20 CYS A 31 ? ? -179.50 88.17 388 20 ASP A 33 ? ? 63.40 -175.09 389 20 CYS A 36 ? ? -50.07 -78.05 390 20 THR A 44 ? ? -112.07 -75.92 391 20 ARG A 45 ? ? 36.94 73.52 392 20 CYS A 58 ? ? -171.19 -44.92 393 20 ASN A 62 ? ? -167.54 29.07 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? #