data_7DIU # _entry.id 7DIU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DIU pdb_00007diu 10.2210/pdb7diu/pdb WWPDB D_1300019458 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DIU _pdbx_database_status.recvd_initial_deposition_date 2020-11-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Manickam, Y.' 1 0000-0002-2119-062X 'Sharma, A.' 2 0000-0002-3305-0034 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Interaction of metals with PfGrx1' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Manickam, Y.' 1 0000-0002-2119-062X primary 'Sharma, A.' 2 0000-0002-3305-0034 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7DIU _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.584 _cell.length_a_esd ? _cell.length_b 48.584 _cell.length_b_esd ? _cell.length_c 82.721 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DIU _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Glutaredoxin 12436.457 1 1.8.4.2 ? ? ? 2 non-polymer syn '3[N-MORPHOLINO]PROPANE SULFONIC ACID' 209.263 1 ? ? ? ? 3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 1 ? ? ? ? 4 non-polymer syn 'CESIUM ION' 132.905 3 ? ? ? ? 5 non-polymer syn 'PLATINUM (II) ION' 195.078 1 ? ? ? ? 6 water nat water 18.015 72 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Glutaredoxin 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAGTSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFI NKDVVGGCDDLVKENDEGKLKERLQKLGLVN ; _entity_poly.pdbx_seq_one_letter_code_can ;MAGTSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFI NKDVVGGCDDLVKENDEGKLKERLQKLGLVN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLY n 1 4 THR n 1 5 SER n 1 6 GLU n 1 7 ALA n 1 8 VAL n 1 9 LYS n 1 10 LYS n 1 11 TRP n 1 12 VAL n 1 13 ASN n 1 14 LYS n 1 15 ILE n 1 16 ILE n 1 17 GLU n 1 18 GLU n 1 19 ASN n 1 20 ILE n 1 21 ILE n 1 22 ALA n 1 23 VAL n 1 24 PHE n 1 25 ALA n 1 26 LYS n 1 27 THR n 1 28 GLU n 1 29 CYS n 1 30 PRO n 1 31 TYR n 1 32 CYS n 1 33 ILE n 1 34 LYS n 1 35 ALA n 1 36 ILE n 1 37 SER n 1 38 ILE n 1 39 LEU n 1 40 LYS n 1 41 GLY n 1 42 TYR n 1 43 ASN n 1 44 LEU n 1 45 ASN n 1 46 SER n 1 47 HIS n 1 48 MET n 1 49 HIS n 1 50 VAL n 1 51 GLU n 1 52 ASN n 1 53 ILE n 1 54 GLU n 1 55 LYS n 1 56 ASN n 1 57 PRO n 1 58 ASP n 1 59 MET n 1 60 ALA n 1 61 ASN n 1 62 ILE n 1 63 GLN n 1 64 ALA n 1 65 TYR n 1 66 LEU n 1 67 LYS n 1 68 GLU n 1 69 LEU n 1 70 THR n 1 71 GLY n 1 72 LYS n 1 73 SER n 1 74 SER n 1 75 VAL n 1 76 PRO n 1 77 ARG n 1 78 ILE n 1 79 PHE n 1 80 ILE n 1 81 ASN n 1 82 LYS n 1 83 ASP n 1 84 VAL n 1 85 VAL n 1 86 GLY n 1 87 GLY n 1 88 CYS n 1 89 ASP n 1 90 ASP n 1 91 LEU n 1 92 VAL n 1 93 LYS n 1 94 GLU n 1 95 ASN n 1 96 ASP n 1 97 GLU n 1 98 GLY n 1 99 LYS n 1 100 LEU n 1 101 LYS n 1 102 GLU n 1 103 ARG n 1 104 LEU n 1 105 GLN n 1 106 LYS n 1 107 LEU n 1 108 GLY n 1 109 LEU n 1 110 VAL n 1 111 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF3D7_0306300 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'isolate 3D7' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum (isolate 3D7)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36329 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli M15' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1007065 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PQE30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9NLB2_PLAF7 _struct_ref.pdbx_db_accession Q9NLB2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAGTSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFI NKDVVGGCDDLVKENDEGKLKERLQKLGLVN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7DIU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NLB2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 111 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CS non-polymer . 'CESIUM ION' ? 'Cs 1' 132.905 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 MPO non-polymer . '3[N-MORPHOLINO]PROPANE SULFONIC ACID' ? 'C7 H15 N O4 S' 209.263 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PT non-polymer . 'PLATINUM (II) ION' ? 'Pt 2' 195.078 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DIU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '12.5% w/v PEG1000, 12.5% w/v PEG3350, 12.5% v/v MPD, 0.02 M amino acids, 0.1 M MOPS/HEPES sodium' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-06-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7DIU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8790 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17785 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.700 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.643 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.880 1.910 ? ? ? ? ? ? 468 100.000 ? ? ? ? 0.552 ? ? ? ? ? ? ? ? 20.300 ? 1.128 ? ? ? ? ? 1 1 ? ? ? 1.910 1.950 ? ? ? ? ? ? 477 100.000 ? ? ? ? 0.490 ? ? ? ? ? ? ? ? 20.800 ? 1.130 ? ? ? ? ? 2 1 ? ? ? 1.950 1.980 ? ? ? ? ? ? 453 100.000 ? ? ? ? 0.407 ? ? ? ? ? ? ? ? 20.500 ? 1.183 ? ? ? ? ? 3 1 ? ? ? 1.980 2.030 ? ? ? ? ? ? 489 100.000 ? ? ? ? 0.343 ? ? ? ? ? ? ? ? 20.800 ? 1.270 ? ? ? ? ? 4 1 ? ? ? 2.030 2.070 ? ? ? ? ? ? 465 100.000 ? ? ? ? 0.305 ? ? ? ? ? ? ? ? 20.600 ? 1.287 ? ? ? ? ? 5 1 ? ? ? 2.070 2.120 ? ? ? ? ? ? 493 100.000 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 20.800 ? 1.360 ? ? ? ? ? 6 1 ? ? ? 2.120 2.170 ? ? ? ? ? ? 454 100.000 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 20.900 ? 1.448 ? ? ? ? ? 7 1 ? ? ? 2.170 2.230 ? ? ? ? ? ? 495 100.000 ? ? ? ? 0.175 ? ? ? ? ? ? ? ? 20.700 ? 1.553 ? ? ? ? ? 8 1 ? ? ? 2.230 2.290 ? ? ? ? ? ? 465 100.000 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 21.100 ? 1.550 ? ? ? ? ? 9 1 ? ? ? 2.290 2.370 ? ? ? ? ? ? 476 100.000 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 20.800 ? 1.648 ? ? ? ? ? 10 1 ? ? ? 2.370 2.450 ? ? ? ? ? ? 479 100.000 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 21.000 ? 1.651 ? ? ? ? ? 11 1 ? ? ? 2.450 2.550 ? ? ? ? ? ? 489 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 21.100 ? 1.668 ? ? ? ? ? 12 1 ? ? ? 2.550 2.670 ? ? ? ? ? ? 475 100.000 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 21.000 ? 1.684 ? ? ? ? ? 13 1 ? ? ? 2.670 2.810 ? ? ? ? ? ? 483 100.000 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 20.900 ? 1.792 ? ? ? ? ? 14 1 ? ? ? 2.810 2.980 ? ? ? ? ? ? 485 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 21.200 ? 1.856 ? ? ? ? ? 15 1 ? ? ? 2.980 3.210 ? ? ? ? ? ? 491 100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 21.000 ? 1.967 ? ? ? ? ? 16 1 ? ? ? 3.210 3.540 ? ? ? ? ? ? 493 100.000 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 21.000 ? 2.009 ? ? ? ? ? 17 1 ? ? ? 3.540 4.050 ? ? ? ? ? ? 492 100.000 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 20.800 ? 2.106 ? ? ? ? ? 18 1 ? ? ? 4.050 5.100 ? ? ? ? ? ? 510 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 20.300 ? 2.156 ? ? ? ? ? 19 1 ? ? ? 5.100 50.000 ? ? ? ? ? ? 551 98.900 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 18.300 ? 2.279 ? ? ? ? ? 20 1 ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 86.130 _refine.B_iso_mean 31.3659 _refine.B_iso_min 16.340 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DIU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8790 _refine.ls_d_res_low 27.5740 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17785 _refine.ls_number_reflns_R_free 1801 _refine.ls_number_reflns_R_work 15984 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9400 _refine.ls_percent_reflns_R_free 10.1300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1598 _refine.ls_R_factor_R_free 0.1916 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1563 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.0200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8790 _refine_hist.d_res_low 27.5740 _refine_hist.number_atoms_solvent 72 _refine_hist.number_atoms_total 916 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 106 _refine_hist.pdbx_B_iso_mean_ligand 40.96 _refine_hist.pdbx_B_iso_mean_solvent 40.49 _refine_hist.pdbx_number_atoms_protein 819 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8790 1.9296 . . 138 1221 100.0000 . . . 0.2492 0.0000 0.1976 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9296 1.9864 . . 129 1210 100.0000 . . . 0.1786 0.0000 0.1733 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9864 2.0505 . . 134 1253 100.0000 . . . 0.2351 0.0000 0.1605 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0505 2.1237 . . 136 1260 100.0000 . . . 0.2019 0.0000 0.1607 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1237 2.2087 . . 136 1224 100.0000 . . . 0.1787 0.0000 0.1463 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2087 2.3092 . . 142 1226 100.0000 . . . 0.2006 0.0000 0.1537 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3092 2.4309 . . 142 1241 100.0000 . . . 0.1896 0.0000 0.1518 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4309 2.5831 . . 140 1216 100.0000 . . . 0.1952 0.0000 0.1653 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5831 2.7824 . . 140 1220 100.0000 . . . 0.2171 0.0000 0.1536 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7824 3.0620 . . 141 1235 100.0000 . . . 0.1836 0.0000 0.1644 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0620 3.5043 . . 148 1221 100.0000 . . . 0.1954 0.0000 0.1515 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5043 4.4122 . . 140 1240 100.0000 . . . 0.1725 0.0000 0.1344 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4122 27.5740 . . 135 1217 99.0000 . . . 0.1891 0.0000 0.1699 . . . . . . . . . . . # _struct.entry_id 7DIU _struct.title 'Structure of PfGrx1 in the intermediate state with platinum and cesium' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DIU _struct_keywords.text 'REDOX ENZYME, TRX FOLD, GLUTATHIONE, Pt-SAD, Cs-SAD, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 5 ? H N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? ASN A 19 ? SER A 5 ASN A 19 1 ? 15 HELX_P HELX_P2 AA2 CYS A 29 ? GLY A 41 ? CYS A 29 GLY A 41 1 ? 13 HELX_P HELX_P3 AA3 TYR A 42 ? ASN A 43 ? TYR A 42 ASN A 43 5 ? 2 HELX_P HELX_P4 AA4 LEU A 44 ? SER A 46 ? LEU A 44 SER A 46 5 ? 3 HELX_P HELX_P5 AA5 ASP A 58 ? GLY A 71 ? ASP A 58 GLY A 71 1 ? 14 HELX_P HELX_P6 AA6 GLY A 87 ? GLU A 97 ? GLY A 87 GLU A 97 1 ? 11 HELX_P HELX_P7 AA7 GLY A 98 ? LEU A 107 ? GLY A 98 LEU A 107 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 29 A CYS 32 1_555 ? ? ? ? ? ? ? 2.063 ? ? metalc1 metalc ? ? A GLY 41 O ? ? ? 1_555 E CS . CS ? ? A GLY 41 A CS 204 1_555 ? ? ? ? ? ? ? 3.298 ? ? metalc2 metalc ? ? A ASN 45 O ? ? ? 1_555 D CS . CS ? ? A ASN 45 A CS 203 1_555 ? ? ? ? ? ? ? 3.139 ? ? metalc3 metalc ? ? A MET 48 O ? ? ? 1_555 D CS . CS ? ? A MET 48 A CS 203 1_555 ? ? ? ? ? ? ? 2.972 ? ? metalc4 metalc ? ? A HIS 49 ND1 ? ? ? 1_555 G PT . PT ? ? A HIS 49 A PT 206 1_555 ? ? ? ? ? ? ? 2.759 ? ? metalc5 metalc ? ? A GLU 68 O ? ? ? 1_555 D CS . CS ? ? A GLU 68 A CS 203 2_564 ? ? ? ? ? ? ? 3.106 ? ? metalc6 metalc ? ? A ASN 95 O ? ? ? 1_555 F CS . CS ? ? A ASN 95 A CS 205 1_555 ? ? ? ? ? ? ? 3.332 ? ? metalc7 metalc ? ? A ASN 95 OD1 ? ? ? 1_555 F CS . CS ? ? A ASN 95 A CS 205 1_555 ? ? ? ? ? ? ? 3.467 ? ? metalc8 metalc ? ? D CS . CS ? ? ? 1_555 H HOH . O ? ? A CS 203 A HOH 365 1_555 ? ? ? ? ? ? ? 3.091 ? ? metalc9 metalc ? ? F CS . CS ? ? ? 1_555 H HOH . O ? ? A CS 205 A HOH 317 4_455 ? ? ? ? ? ? ? 3.322 ? ? metalc10 metalc ? ? F CS . CS ? ? ? 1_555 H HOH . O ? ? A CS 205 A HOH 332 1_555 ? ? ? ? ? ? ? 3.200 ? ? metalc11 metalc ? ? F CS . CS ? ? ? 1_555 H HOH . O ? ? A CS 205 A HOH 366 1_555 ? ? ? ? ? ? ? 2.990 ? ? metalc12 metalc ? ? F CS . CS ? ? ? 1_555 H HOH . O ? ? A CS 205 A HOH 368 1_555 ? ? ? ? ? ? ? 3.107 ? ? metalc13 metalc ? ? G PT . PT ? ? ? 1_555 H HOH . O ? ? A PT 206 A HOH 315 1_555 ? ? ? ? ? ? ? 2.481 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 75 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 75 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 76 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 76 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.61 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 48 ? ASN A 52 ? MET A 48 ASN A 52 AA1 2 ILE A 21 ? ALA A 25 ? ILE A 21 ALA A 25 AA1 3 ARG A 77 ? ILE A 80 ? ARG A 77 ILE A 80 AA1 4 ASP A 83 ? GLY A 86 ? ASP A 83 GLY A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 51 ? O GLU A 51 N ALA A 25 ? N ALA A 25 AA1 2 3 N PHE A 24 ? N PHE A 24 O ARG A 77 ? O ARG A 77 AA1 3 4 N ILE A 78 ? N ILE A 78 O GLY A 86 ? O GLY A 86 # _atom_sites.entry_id 7DIU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020583 _atom_sites.fract_transf_matrix[1][2] 0.011884 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023767 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012089 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CS N O PT S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MPO 1 201 201 MPO MPO A . C 3 MPD 1 202 202 MPD MPD A . D 4 CS 1 203 321 CS CS A . E 4 CS 1 204 322 CS CS A . F 4 CS 1 205 333 CS CS A . G 5 PT 1 206 301 PT PT A . H 6 HOH 1 301 64 HOH HOH A . H 6 HOH 2 302 43 HOH HOH A . H 6 HOH 3 303 19 HOH HOH A . H 6 HOH 4 304 12 HOH HOH A . H 6 HOH 5 305 61 HOH HOH A . H 6 HOH 6 306 60 HOH HOH A . H 6 HOH 7 307 23 HOH HOH A . H 6 HOH 8 308 1 HOH HOH A . H 6 HOH 9 309 15 HOH HOH A . H 6 HOH 10 310 39 HOH HOH A . H 6 HOH 11 311 67 HOH HOH A . H 6 HOH 12 312 63 HOH HOH A . H 6 HOH 13 313 58 HOH HOH A . H 6 HOH 14 314 7 HOH HOH A . H 6 HOH 15 315 62 HOH HOH A . H 6 HOH 16 316 36 HOH HOH A . H 6 HOH 17 317 69 HOH HOH A . H 6 HOH 18 318 16 HOH HOH A . H 6 HOH 19 319 9 HOH HOH A . H 6 HOH 20 320 28 HOH HOH A . H 6 HOH 21 321 10 HOH HOH A . H 6 HOH 22 322 22 HOH HOH A . H 6 HOH 23 323 20 HOH HOH A . H 6 HOH 24 324 27 HOH HOH A . H 6 HOH 25 325 4 HOH HOH A . H 6 HOH 26 326 45 HOH HOH A . H 6 HOH 27 327 24 HOH HOH A . H 6 HOH 28 328 35 HOH HOH A . H 6 HOH 29 329 41 HOH HOH A . H 6 HOH 30 330 5 HOH HOH A . H 6 HOH 31 331 6 HOH HOH A . H 6 HOH 32 332 18 HOH HOH A . H 6 HOH 33 333 17 HOH HOH A . H 6 HOH 34 334 48 HOH HOH A . H 6 HOH 35 335 46 HOH HOH A . H 6 HOH 36 336 59 HOH HOH A . H 6 HOH 37 337 30 HOH HOH A . H 6 HOH 38 338 2 HOH HOH A . H 6 HOH 39 339 68 HOH HOH A . H 6 HOH 40 340 55 HOH HOH A . H 6 HOH 41 341 11 HOH HOH A . H 6 HOH 42 342 53 HOH HOH A . H 6 HOH 43 343 44 HOH HOH A . H 6 HOH 44 344 65 HOH HOH A . H 6 HOH 45 345 42 HOH HOH A . H 6 HOH 46 346 47 HOH HOH A . H 6 HOH 47 347 51 HOH HOH A . H 6 HOH 48 348 31 HOH HOH A . H 6 HOH 49 349 26 HOH HOH A . H 6 HOH 50 350 3 HOH HOH A . H 6 HOH 51 351 29 HOH HOH A . H 6 HOH 52 352 50 HOH HOH A . H 6 HOH 53 353 14 HOH HOH A . H 6 HOH 54 354 49 HOH HOH A . H 6 HOH 55 355 13 HOH HOH A . H 6 HOH 56 356 38 HOH HOH A . H 6 HOH 57 357 21 HOH HOH A . H 6 HOH 58 358 8 HOH HOH A . H 6 HOH 59 359 40 HOH HOH A . H 6 HOH 60 360 72 HOH HOH A . H 6 HOH 61 361 54 HOH HOH A . H 6 HOH 62 362 25 HOH HOH A . H 6 HOH 63 363 37 HOH HOH A . H 6 HOH 64 364 33 HOH HOH A . H 6 HOH 65 365 66 HOH HOH A . H 6 HOH 66 366 71 HOH HOH A . H 6 HOH 67 367 52 HOH HOH A . H 6 HOH 68 368 70 HOH HOH A . H 6 HOH 69 369 34 HOH HOH A . H 6 HOH 70 370 32 HOH HOH A . H 6 HOH 71 371 57 HOH HOH A . H 6 HOH 72 372 56 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 410 ? 1 MORE -55 ? 1 'SSA (A^2)' 5890 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASN 45 ? A ASN 45 ? 1_555 CS ? D CS . ? A CS 203 ? 1_555 O ? A MET 48 ? A MET 48 ? 1_555 71.1 ? 2 O ? A ASN 45 ? A ASN 45 ? 1_555 CS ? D CS . ? A CS 203 ? 1_555 O ? A GLU 68 ? A GLU 68 ? 1_555 89.4 ? 3 O ? A MET 48 ? A MET 48 ? 1_555 CS ? D CS . ? A CS 203 ? 1_555 O ? A GLU 68 ? A GLU 68 ? 1_555 21.5 ? 4 O ? A ASN 45 ? A ASN 45 ? 1_555 CS ? D CS . ? A CS 203 ? 1_555 O ? H HOH . ? A HOH 365 ? 1_555 68.8 ? 5 O ? A MET 48 ? A MET 48 ? 1_555 CS ? D CS . ? A CS 203 ? 1_555 O ? H HOH . ? A HOH 365 ? 1_555 107.2 ? 6 O ? A GLU 68 ? A GLU 68 ? 1_555 CS ? D CS . ? A CS 203 ? 1_555 O ? H HOH . ? A HOH 365 ? 1_555 105.0 ? 7 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 PT ? G PT . ? A PT 206 ? 1_555 O ? H HOH . ? A HOH 315 ? 1_555 60.8 ? 8 O ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 OD1 ? A ASN 95 ? A ASN 95 ? 1_555 59.0 ? 9 O ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 317 ? 4_455 121.0 ? 10 OD1 ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 317 ? 4_455 98.1 ? 11 O ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 332 ? 1_555 80.2 ? 12 OD1 ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 332 ? 1_555 92.8 ? 13 O ? H HOH . ? A HOH 317 ? 4_455 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 332 ? 1_555 44.7 ? 14 O ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 366 ? 1_555 66.6 ? 15 OD1 ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 366 ? 1_555 124.5 ? 16 O ? H HOH . ? A HOH 317 ? 4_455 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 366 ? 1_555 119.7 ? 17 O ? H HOH . ? A HOH 332 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 366 ? 1_555 88.5 ? 18 O ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 368 ? 1_555 72.8 ? 19 OD1 ? A ASN 95 ? A ASN 95 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 368 ? 1_555 89.5 ? 20 O ? H HOH . ? A HOH 317 ? 4_455 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 368 ? 1_555 166.2 ? 21 O ? H HOH . ? A HOH 332 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 368 ? 1_555 146.9 ? 22 O ? H HOH . ? A HOH 366 ? 1_555 CS ? F CS . ? A CS 205 ? 1_555 O ? H HOH . ? A HOH 368 ? 1_555 63.6 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2021-11-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -22.9593 _pdbx_refine_tls.origin_y 9.7755 _pdbx_refine_tls.origin_z -5.0076 _pdbx_refine_tls.T[1][1] 0.2036 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0033 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0217 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1841 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0015 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.1776 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.6564 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.1956 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.1283 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.6855 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.0231 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.0951 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0580 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0378 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0190 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1073 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0245 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0990 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0197 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0396 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0001 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 5 ? ? ? A 202 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? A 321 ? ? ? A 301 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? S 1 ? ? ? S 72 ? ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15rc1_3423 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? Auto-Rickshaw ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXDE ? ? ? . 7 # _pdbx_entry_details.entry_id 7DIU _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 56 ? ? -170.09 131.27 2 1 LYS A 82 ? ? 71.21 -4.26 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 6 ? CG ? A GLU 6 CG 2 1 Y 1 A GLU 6 ? CD ? A GLU 6 CD 3 1 Y 1 A GLU 6 ? OE1 ? A GLU 6 OE1 4 1 Y 1 A GLU 6 ? OE2 ? A GLU 6 OE2 5 1 Y 1 A LYS 14 ? CE ? A LYS 14 CE 6 1 Y 1 A LYS 14 ? NZ ? A LYS 14 NZ 7 1 Y 1 A LYS 55 ? CD ? A LYS 55 CD 8 1 Y 1 A LYS 55 ? CE ? A LYS 55 CE 9 1 Y 1 A LYS 55 ? NZ ? A LYS 55 NZ 10 1 Y 1 A LYS 101 ? CE ? A LYS 101 CE 11 1 Y 1 A LYS 101 ? NZ ? A LYS 101 NZ 12 1 Y 1 A LYS 106 ? CG ? A LYS 106 CG 13 1 Y 1 A LYS 106 ? CD ? A LYS 106 CD 14 1 Y 1 A LYS 106 ? CE ? A LYS 106 CE 15 1 Y 1 A LYS 106 ? NZ ? A LYS 106 NZ 16 1 Y 1 A VAL 110 ? CG1 ? A VAL 110 CG1 17 1 Y 1 A VAL 110 ? CG2 ? A VAL 110 CG2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ASN 111 ? A ASN 111 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CS ? ? CS ? ? 'SUBJECT OF INVESTIGATION' ? 2 PT ? ? PT ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3[N-MORPHOLINO]PROPANE SULFONIC ACID' MPO 3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 4 'CESIUM ION' CS 5 'PLATINUM (II) ION' PT 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #