data_7DL8 # _entry.id 7DL8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DL8 pdb_00007dl8 10.2210/pdb7dl8/pdb WWPDB D_1300019603 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-23 2 'Structure model' 1 1 2021-07-07 3 'Structure model' 1 2 2024-03-27 4 'Structure model' 1 3 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' struct_ncs_dom_lim 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 5 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 6 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 7 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 8 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 9 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 10 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 11 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DL8 _pdbx_database_status.recvd_initial_deposition_date 2020-11-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liao, S.' 1 0000-0002-5083-667X 'Gao, J.' 2 0000-0001-6680-4288 'Tu, X.' 3 0000-0001-7361-3500 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 213 _citation.language ? _citation.page_first 107751 _citation.page_last 107751 _citation.title 'Crystal structure of TbAlba1 from Trypanosoma brucei.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2021.107751 _citation.pdbx_database_id_PubMed 34107324 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gao, J.' 1 ? primary 'Xiao, C.' 2 ? primary 'Liao, S.' 3 ? primary 'Tu, X.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ALBA-Domain Protein' 15265.312 4 ? ? ? ? 2 water nat water 18.015 28 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MMTTGKSDRPRNSVRVGYRGTKFLFVDITKHLLHDGEKEVYVSALGGAINEAVSVVEMLKDQQMVVVKKITTSRQVSEEP DDGPVDKIEIVVTKADGFDAKYEEQQKAREAKRLEKEKNEKEKATALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MMTTGKSDRPRNSVRVGYRGTKFLFVDITKHLLHDGEKEVYVSALGGAINEAVSVVEMLKDQQMVVVKKITTSRQVSEEP DDGPVDKIEIVVTKADGFDAKYEEQQKAREAKRLEKEKNEKEKATALEHHHHHH ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 THR n 1 4 THR n 1 5 GLY n 1 6 LYS n 1 7 SER n 1 8 ASP n 1 9 ARG n 1 10 PRO n 1 11 ARG n 1 12 ASN n 1 13 SER n 1 14 VAL n 1 15 ARG n 1 16 VAL n 1 17 GLY n 1 18 TYR n 1 19 ARG n 1 20 GLY n 1 21 THR n 1 22 LYS n 1 23 PHE n 1 24 LEU n 1 25 PHE n 1 26 VAL n 1 27 ASP n 1 28 ILE n 1 29 THR n 1 30 LYS n 1 31 HIS n 1 32 LEU n 1 33 LEU n 1 34 HIS n 1 35 ASP n 1 36 GLY n 1 37 GLU n 1 38 LYS n 1 39 GLU n 1 40 VAL n 1 41 TYR n 1 42 VAL n 1 43 SER n 1 44 ALA n 1 45 LEU n 1 46 GLY n 1 47 GLY n 1 48 ALA n 1 49 ILE n 1 50 ASN n 1 51 GLU n 1 52 ALA n 1 53 VAL n 1 54 SER n 1 55 VAL n 1 56 VAL n 1 57 GLU n 1 58 MET n 1 59 LEU n 1 60 LYS n 1 61 ASP n 1 62 GLN n 1 63 GLN n 1 64 MET n 1 65 VAL n 1 66 VAL n 1 67 VAL n 1 68 LYS n 1 69 LYS n 1 70 ILE n 1 71 THR n 1 72 THR n 1 73 SER n 1 74 ARG n 1 75 GLN n 1 76 VAL n 1 77 SER n 1 78 GLU n 1 79 GLU n 1 80 PRO n 1 81 ASP n 1 82 ASP n 1 83 GLY n 1 84 PRO n 1 85 VAL n 1 86 ASP n 1 87 LYS n 1 88 ILE n 1 89 GLU n 1 90 ILE n 1 91 VAL n 1 92 VAL n 1 93 THR n 1 94 LYS n 1 95 ALA n 1 96 ASP n 1 97 GLY n 1 98 PHE n 1 99 ASP n 1 100 ALA n 1 101 LYS n 1 102 TYR n 1 103 GLU n 1 104 GLU n 1 105 GLN n 1 106 GLN n 1 107 LYS n 1 108 ALA n 1 109 ARG n 1 110 GLU n 1 111 ALA n 1 112 LYS n 1 113 ARG n 1 114 LEU n 1 115 GLU n 1 116 LYS n 1 117 GLU n 1 118 LYS n 1 119 ASN n 1 120 GLU n 1 121 LYS n 1 122 GLU n 1 123 LYS n 1 124 ALA n 1 125 THR n 1 126 ALA n 1 127 LEU n 1 128 GLU n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 134 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ALBA1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trypanosoma brucei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5691 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 MET 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLU 78 78 ? ? ? A . n A 1 79 GLU 79 79 ? ? ? A . n A 1 80 PRO 80 80 ? ? ? A . n A 1 81 ASP 81 81 ? ? ? A . n A 1 82 ASP 82 82 ? ? ? A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LEU 127 127 ? ? ? A . n A 1 128 GLU 128 128 ? ? ? A . n A 1 129 HIS 129 129 ? ? ? A . n A 1 130 HIS 130 130 ? ? ? A . n A 1 131 HIS 131 131 ? ? ? A . n A 1 132 HIS 132 132 ? ? ? A . n A 1 133 HIS 133 133 ? ? ? A . n A 1 134 HIS 134 134 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 MET 2 2 ? ? ? B . n B 1 3 THR 3 3 ? ? ? B . n B 1 4 THR 4 4 ? ? ? B . n B 1 5 GLY 5 5 ? ? ? B . n B 1 6 LYS 6 6 ? ? ? B . n B 1 7 SER 7 7 ? ? ? B . n B 1 8 ASP 8 8 ? ? ? B . n B 1 9 ARG 9 9 9 ARG ARG B . n B 1 10 PRO 10 10 10 PRO PRO B . n B 1 11 ARG 11 11 11 ARG ARG B . n B 1 12 ASN 12 12 12 ASN ASN B . n B 1 13 SER 13 13 13 SER SER B . n B 1 14 VAL 14 14 14 VAL VAL B . n B 1 15 ARG 15 15 15 ARG ARG B . n B 1 16 VAL 16 16 16 VAL VAL B . n B 1 17 GLY 17 17 17 GLY GLY B . n B 1 18 TYR 18 18 18 TYR TYR B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 GLY 20 20 20 GLY GLY B . n B 1 21 THR 21 21 21 THR THR B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 PHE 23 23 23 PHE PHE B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 PHE 25 25 25 PHE PHE B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 ILE 28 28 28 ILE ILE B . n B 1 29 THR 29 29 29 THR THR B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 HIS 31 31 31 HIS HIS B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 LEU 33 33 33 LEU LEU B . n B 1 34 HIS 34 34 34 HIS HIS B . n B 1 35 ASP 35 35 35 ASP ASP B . n B 1 36 GLY 36 36 36 GLY GLY B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 LYS 38 38 38 LYS LYS B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 VAL 40 40 40 VAL VAL B . n B 1 41 TYR 41 41 41 TYR TYR B . n B 1 42 VAL 42 42 42 VAL VAL B . n B 1 43 SER 43 43 43 SER SER B . n B 1 44 ALA 44 44 44 ALA ALA B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 GLY 46 46 46 GLY GLY B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 ILE 49 49 49 ILE ILE B . n B 1 50 ASN 50 50 50 ASN ASN B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 VAL 53 53 53 VAL VAL B . n B 1 54 SER 54 54 54 SER SER B . n B 1 55 VAL 55 55 55 VAL VAL B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 GLU 57 57 57 GLU GLU B . n B 1 58 MET 58 58 58 MET MET B . n B 1 59 LEU 59 59 59 LEU LEU B . n B 1 60 LYS 60 60 60 LYS LYS B . n B 1 61 ASP 61 61 61 ASP ASP B . n B 1 62 GLN 62 62 62 GLN GLN B . n B 1 63 GLN 63 63 63 GLN GLN B . n B 1 64 MET 64 64 64 MET MET B . n B 1 65 VAL 65 65 65 VAL VAL B . n B 1 66 VAL 66 66 66 VAL VAL B . n B 1 67 VAL 67 67 67 VAL VAL B . n B 1 68 LYS 68 68 68 LYS LYS B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 ILE 70 70 70 ILE ILE B . n B 1 71 THR 71 71 71 THR THR B . n B 1 72 THR 72 72 72 THR THR B . n B 1 73 SER 73 73 73 SER SER B . n B 1 74 ARG 74 74 74 ARG ARG B . n B 1 75 GLN 75 75 75 GLN GLN B . n B 1 76 VAL 76 76 76 VAL VAL B . n B 1 77 SER 77 77 ? ? ? B . n B 1 78 GLU 78 78 ? ? ? B . n B 1 79 GLU 79 79 ? ? ? B . n B 1 80 PRO 80 80 ? ? ? B . n B 1 81 ASP 81 81 ? ? ? B . n B 1 82 ASP 82 82 ? ? ? B . n B 1 83 GLY 83 83 ? ? ? B . n B 1 84 PRO 84 84 84 PRO PRO B . n B 1 85 VAL 85 85 85 VAL VAL B . n B 1 86 ASP 86 86 86 ASP ASP B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 ILE 88 88 88 ILE ILE B . n B 1 89 GLU 89 89 89 GLU GLU B . n B 1 90 ILE 90 90 90 ILE ILE B . n B 1 91 VAL 91 91 91 VAL VAL B . n B 1 92 VAL 92 92 92 VAL VAL B . n B 1 93 THR 93 93 93 THR THR B . n B 1 94 LYS 94 94 94 LYS LYS B . n B 1 95 ALA 95 95 95 ALA ALA B . n B 1 96 ASP 96 96 96 ASP ASP B . n B 1 97 GLY 97 97 97 GLY GLY B . n B 1 98 PHE 98 98 98 PHE PHE B . n B 1 99 ASP 99 99 99 ASP ASP B . n B 1 100 ALA 100 100 100 ALA ALA B . n B 1 101 LYS 101 101 101 LYS LYS B . n B 1 102 TYR 102 102 102 TYR TYR B . n B 1 103 GLU 103 103 103 GLU GLU B . n B 1 104 GLU 104 104 104 GLU GLU B . n B 1 105 GLN 105 105 105 GLN GLN B . n B 1 106 GLN 106 106 106 GLN GLN B . n B 1 107 LYS 107 107 107 LYS LYS B . n B 1 108 ALA 108 108 108 ALA ALA B . n B 1 109 ARG 109 109 109 ARG ARG B . n B 1 110 GLU 110 110 110 GLU GLU B . n B 1 111 ALA 111 111 111 ALA ALA B . n B 1 112 LYS 112 112 112 LYS LYS B . n B 1 113 ARG 113 113 113 ARG ARG B . n B 1 114 LEU 114 114 114 LEU LEU B . n B 1 115 GLU 115 115 115 GLU GLU B . n B 1 116 LYS 116 116 116 LYS LYS B . n B 1 117 GLU 117 117 117 GLU GLU B . n B 1 118 LYS 118 118 118 LYS LYS B . n B 1 119 ASN 119 119 119 ASN ASN B . n B 1 120 GLU 120 120 120 GLU GLU B . n B 1 121 LYS 121 121 121 LYS LYS B . n B 1 122 GLU 122 122 122 GLU GLU B . n B 1 123 LYS 123 123 123 LYS LYS B . n B 1 124 ALA 124 124 124 ALA ALA B . n B 1 125 THR 125 125 125 THR THR B . n B 1 126 ALA 126 126 ? ? ? B . n B 1 127 LEU 127 127 ? ? ? B . n B 1 128 GLU 128 128 ? ? ? B . n B 1 129 HIS 129 129 ? ? ? B . n B 1 130 HIS 130 130 ? ? ? B . n B 1 131 HIS 131 131 ? ? ? B . n B 1 132 HIS 132 132 ? ? ? B . n B 1 133 HIS 133 133 ? ? ? B . n B 1 134 HIS 134 134 ? ? ? B . n C 1 1 MET 1 1 ? ? ? C . n C 1 2 MET 2 2 ? ? ? C . n C 1 3 THR 3 3 ? ? ? C . n C 1 4 THR 4 4 ? ? ? C . n C 1 5 GLY 5 5 ? ? ? C . n C 1 6 LYS 6 6 ? ? ? C . n C 1 7 SER 7 7 ? ? ? C . n C 1 8 ASP 8 8 ? ? ? C . n C 1 9 ARG 9 9 ? ? ? C . n C 1 10 PRO 10 10 10 PRO PRO C . n C 1 11 ARG 11 11 11 ARG ARG C . n C 1 12 ASN 12 12 12 ASN ASN C . n C 1 13 SER 13 13 13 SER SER C . n C 1 14 VAL 14 14 14 VAL VAL C . n C 1 15 ARG 15 15 15 ARG ARG C . n C 1 16 VAL 16 16 16 VAL VAL C . n C 1 17 GLY 17 17 17 GLY GLY C . n C 1 18 TYR 18 18 18 TYR TYR C . n C 1 19 ARG 19 19 19 ARG ARG C . n C 1 20 GLY 20 20 20 GLY GLY C . n C 1 21 THR 21 21 21 THR THR C . n C 1 22 LYS 22 22 22 LYS LYS C . n C 1 23 PHE 23 23 23 PHE PHE C . n C 1 24 LEU 24 24 24 LEU LEU C . n C 1 25 PHE 25 25 25 PHE PHE C . n C 1 26 VAL 26 26 26 VAL VAL C . n C 1 27 ASP 27 27 27 ASP ASP C . n C 1 28 ILE 28 28 28 ILE ILE C . n C 1 29 THR 29 29 29 THR THR C . n C 1 30 LYS 30 30 30 LYS LYS C . n C 1 31 HIS 31 31 31 HIS HIS C . n C 1 32 LEU 32 32 32 LEU LEU C . n C 1 33 LEU 33 33 33 LEU LEU C . n C 1 34 HIS 34 34 34 HIS HIS C . n C 1 35 ASP 35 35 35 ASP ASP C . n C 1 36 GLY 36 36 36 GLY GLY C . n C 1 37 GLU 37 37 37 GLU GLU C . n C 1 38 LYS 38 38 38 LYS LYS C . n C 1 39 GLU 39 39 39 GLU GLU C . n C 1 40 VAL 40 40 40 VAL VAL C . n C 1 41 TYR 41 41 41 TYR TYR C . n C 1 42 VAL 42 42 42 VAL VAL C . n C 1 43 SER 43 43 43 SER SER C . n C 1 44 ALA 44 44 44 ALA ALA C . n C 1 45 LEU 45 45 45 LEU LEU C . n C 1 46 GLY 46 46 46 GLY GLY C . n C 1 47 GLY 47 47 47 GLY GLY C . n C 1 48 ALA 48 48 48 ALA ALA C . n C 1 49 ILE 49 49 49 ILE ILE C . n C 1 50 ASN 50 50 50 ASN ASN C . n C 1 51 GLU 51 51 51 GLU GLU C . n C 1 52 ALA 52 52 52 ALA ALA C . n C 1 53 VAL 53 53 53 VAL VAL C . n C 1 54 SER 54 54 54 SER SER C . n C 1 55 VAL 55 55 55 VAL VAL C . n C 1 56 VAL 56 56 56 VAL VAL C . n C 1 57 GLU 57 57 57 GLU GLU C . n C 1 58 MET 58 58 58 MET MET C . n C 1 59 LEU 59 59 59 LEU LEU C . n C 1 60 LYS 60 60 60 LYS LYS C . n C 1 61 ASP 61 61 61 ASP ASP C . n C 1 62 GLN 62 62 62 GLN GLN C . n C 1 63 GLN 63 63 63 GLN GLN C . n C 1 64 MET 64 64 64 MET MET C . n C 1 65 VAL 65 65 65 VAL VAL C . n C 1 66 VAL 66 66 66 VAL VAL C . n C 1 67 VAL 67 67 67 VAL VAL C . n C 1 68 LYS 68 68 68 LYS LYS C . n C 1 69 LYS 69 69 69 LYS LYS C . n C 1 70 ILE 70 70 70 ILE ILE C . n C 1 71 THR 71 71 71 THR THR C . n C 1 72 THR 72 72 72 THR THR C . n C 1 73 SER 73 73 73 SER SER C . n C 1 74 ARG 74 74 74 ARG ARG C . n C 1 75 GLN 75 75 75 GLN GLN C . n C 1 76 VAL 76 76 76 VAL VAL C . n C 1 77 SER 77 77 ? ? ? C . n C 1 78 GLU 78 78 ? ? ? C . n C 1 79 GLU 79 79 ? ? ? C . n C 1 80 PRO 80 80 ? ? ? C . n C 1 81 ASP 81 81 ? ? ? C . n C 1 82 ASP 82 82 ? ? ? C . n C 1 83 GLY 83 83 83 GLY GLY C . n C 1 84 PRO 84 84 84 PRO PRO C . n C 1 85 VAL 85 85 85 VAL VAL C . n C 1 86 ASP 86 86 86 ASP ASP C . n C 1 87 LYS 87 87 87 LYS LYS C . n C 1 88 ILE 88 88 88 ILE ILE C . n C 1 89 GLU 89 89 89 GLU GLU C . n C 1 90 ILE 90 90 90 ILE ILE C . n C 1 91 VAL 91 91 91 VAL VAL C . n C 1 92 VAL 92 92 92 VAL VAL C . n C 1 93 THR 93 93 93 THR THR C . n C 1 94 LYS 94 94 94 LYS LYS C . n C 1 95 ALA 95 95 95 ALA ALA C . n C 1 96 ASP 96 96 96 ASP ASP C . n C 1 97 GLY 97 97 97 GLY GLY C . n C 1 98 PHE 98 98 98 PHE PHE C . n C 1 99 ASP 99 99 99 ASP ASP C . n C 1 100 ALA 100 100 100 ALA ALA C . n C 1 101 LYS 101 101 101 LYS LYS C . n C 1 102 TYR 102 102 102 TYR TYR C . n C 1 103 GLU 103 103 103 GLU GLU C . n C 1 104 GLU 104 104 104 GLU GLU C . n C 1 105 GLN 105 105 105 GLN GLN C . n C 1 106 GLN 106 106 106 GLN GLN C . n C 1 107 LYS 107 107 107 LYS LYS C . n C 1 108 ALA 108 108 108 ALA ALA C . n C 1 109 ARG 109 109 109 ARG ARG C . n C 1 110 GLU 110 110 110 GLU GLU C . n C 1 111 ALA 111 111 111 ALA ALA C . n C 1 112 LYS 112 112 112 LYS LYS C . n C 1 113 ARG 113 113 113 ARG ARG C . n C 1 114 LEU 114 114 ? ? ? C . n C 1 115 GLU 115 115 ? ? ? C . n C 1 116 LYS 116 116 ? ? ? C . n C 1 117 GLU 117 117 ? ? ? C . n C 1 118 LYS 118 118 ? ? ? C . n C 1 119 ASN 119 119 ? ? ? C . n C 1 120 GLU 120 120 ? ? ? C . n C 1 121 LYS 121 121 ? ? ? C . n C 1 122 GLU 122 122 ? ? ? C . n C 1 123 LYS 123 123 ? ? ? C . n C 1 124 ALA 124 124 ? ? ? C . n C 1 125 THR 125 125 ? ? ? C . n C 1 126 ALA 126 126 ? ? ? C . n C 1 127 LEU 127 127 ? ? ? C . n C 1 128 GLU 128 128 ? ? ? C . n C 1 129 HIS 129 129 ? ? ? C . n C 1 130 HIS 130 130 ? ? ? C . n C 1 131 HIS 131 131 ? ? ? C . n C 1 132 HIS 132 132 ? ? ? C . n C 1 133 HIS 133 133 ? ? ? C . n C 1 134 HIS 134 134 ? ? ? C . n D 1 1 MET 1 1 ? ? ? D . n D 1 2 MET 2 2 ? ? ? D . n D 1 3 THR 3 3 ? ? ? D . n D 1 4 THR 4 4 ? ? ? D . n D 1 5 GLY 5 5 ? ? ? D . n D 1 6 LYS 6 6 ? ? ? D . n D 1 7 SER 7 7 ? ? ? D . n D 1 8 ASP 8 8 ? ? ? D . n D 1 9 ARG 9 9 ? ? ? D . n D 1 10 PRO 10 10 ? ? ? D . n D 1 11 ARG 11 11 11 ARG ARG D . n D 1 12 ASN 12 12 12 ASN ASN D . n D 1 13 SER 13 13 13 SER SER D . n D 1 14 VAL 14 14 14 VAL VAL D . n D 1 15 ARG 15 15 15 ARG ARG D . n D 1 16 VAL 16 16 16 VAL VAL D . n D 1 17 GLY 17 17 17 GLY GLY D . n D 1 18 TYR 18 18 18 TYR TYR D . n D 1 19 ARG 19 19 19 ARG ARG D . n D 1 20 GLY 20 20 20 GLY GLY D . n D 1 21 THR 21 21 21 THR THR D . n D 1 22 LYS 22 22 22 LYS LYS D . n D 1 23 PHE 23 23 23 PHE PHE D . n D 1 24 LEU 24 24 24 LEU ALA D . n D 1 25 PHE 25 25 25 PHE PHE D . n D 1 26 VAL 26 26 26 VAL VAL D . n D 1 27 ASP 27 27 27 ASP ASP D . n D 1 28 ILE 28 28 28 ILE ILE D . n D 1 29 THR 29 29 29 THR THR D . n D 1 30 LYS 30 30 30 LYS LYS D . n D 1 31 HIS 31 31 31 HIS HIS D . n D 1 32 LEU 32 32 32 LEU LEU D . n D 1 33 LEU 33 33 33 LEU LEU D . n D 1 34 HIS 34 34 34 HIS HIS D . n D 1 35 ASP 35 35 35 ASP ASP D . n D 1 36 GLY 36 36 36 GLY GLY D . n D 1 37 GLU 37 37 37 GLU GLU D . n D 1 38 LYS 38 38 38 LYS LYS D . n D 1 39 GLU 39 39 39 GLU GLU D . n D 1 40 VAL 40 40 40 VAL VAL D . n D 1 41 TYR 41 41 41 TYR TYR D . n D 1 42 VAL 42 42 42 VAL VAL D . n D 1 43 SER 43 43 43 SER SER D . n D 1 44 ALA 44 44 44 ALA ALA D . n D 1 45 LEU 45 45 45 LEU LEU D . n D 1 46 GLY 46 46 46 GLY GLY D . n D 1 47 GLY 47 47 47 GLY GLY D . n D 1 48 ALA 48 48 48 ALA ALA D . n D 1 49 ILE 49 49 49 ILE ILE D . n D 1 50 ASN 50 50 50 ASN ASN D . n D 1 51 GLU 51 51 51 GLU GLU D . n D 1 52 ALA 52 52 52 ALA ALA D . n D 1 53 VAL 53 53 53 VAL VAL D . n D 1 54 SER 54 54 54 SER SER D . n D 1 55 VAL 55 55 55 VAL VAL D . n D 1 56 VAL 56 56 56 VAL VAL D . n D 1 57 GLU 57 57 57 GLU GLU D . n D 1 58 MET 58 58 58 MET MET D . n D 1 59 LEU 59 59 59 LEU LEU D . n D 1 60 LYS 60 60 60 LYS LYS D . n D 1 61 ASP 61 61 61 ASP ASP D . n D 1 62 GLN 62 62 62 GLN GLN D . n D 1 63 GLN 63 63 63 GLN GLN D . n D 1 64 MET 64 64 64 MET MET D . n D 1 65 VAL 65 65 65 VAL VAL D . n D 1 66 VAL 66 66 66 VAL VAL D . n D 1 67 VAL 67 67 67 VAL VAL D . n D 1 68 LYS 68 68 68 LYS LYS D . n D 1 69 LYS 69 69 69 LYS LYS D . n D 1 70 ILE 70 70 70 ILE ILE D . n D 1 71 THR 71 71 71 THR THR D . n D 1 72 THR 72 72 72 THR THR D . n D 1 73 SER 73 73 73 SER SER D . n D 1 74 ARG 74 74 74 ARG ARG D . n D 1 75 GLN 75 75 75 GLN GLN D . n D 1 76 VAL 76 76 76 VAL VAL D . n D 1 77 SER 77 77 ? ? ? D . n D 1 78 GLU 78 78 ? ? ? D . n D 1 79 GLU 79 79 ? ? ? D . n D 1 80 PRO 80 80 ? ? ? D . n D 1 81 ASP 81 81 ? ? ? D . n D 1 82 ASP 82 82 ? ? ? D . n D 1 83 GLY 83 83 83 GLY GLY D . n D 1 84 PRO 84 84 84 PRO PRO D . n D 1 85 VAL 85 85 85 VAL VAL D . n D 1 86 ASP 86 86 86 ASP ASP D . n D 1 87 LYS 87 87 87 LYS LYS D . n D 1 88 ILE 88 88 88 ILE ILE D . n D 1 89 GLU 89 89 89 GLU GLU D . n D 1 90 ILE 90 90 90 ILE ILE D . n D 1 91 VAL 91 91 91 VAL VAL D . n D 1 92 VAL 92 92 92 VAL VAL D . n D 1 93 THR 93 93 93 THR THR D . n D 1 94 LYS 94 94 94 LYS LYS D . n D 1 95 ALA 95 95 95 ALA ALA D . n D 1 96 ASP 96 96 96 ASP ASP D . n D 1 97 GLY 97 97 97 GLY GLY D . n D 1 98 PHE 98 98 98 PHE PHE D . n D 1 99 ASP 99 99 99 ASP ASP D . n D 1 100 ALA 100 100 100 ALA ALA D . n D 1 101 LYS 101 101 101 LYS LYS D . n D 1 102 TYR 102 102 102 TYR TYR D . n D 1 103 GLU 103 103 103 GLU GLU D . n D 1 104 GLU 104 104 104 GLU GLU D . n D 1 105 GLN 105 105 105 GLN GLN D . n D 1 106 GLN 106 106 106 GLN GLN D . n D 1 107 LYS 107 107 107 LYS LYS D . n D 1 108 ALA 108 108 108 ALA ALA D . n D 1 109 ARG 109 109 109 ARG ARG D . n D 1 110 GLU 110 110 110 GLU GLU D . n D 1 111 ALA 111 111 111 ALA ALA D . n D 1 112 LYS 112 112 112 LYS LYS D . n D 1 113 ARG 113 113 113 ARG ARG D . n D 1 114 LEU 114 114 114 LEU LEU D . n D 1 115 GLU 115 115 115 GLU GLU D . n D 1 116 LYS 116 116 116 LYS LYS D . n D 1 117 GLU 117 117 117 GLU GLU D . n D 1 118 LYS 118 118 118 LYS LYS D . n D 1 119 ASN 119 119 119 ASN ASN D . n D 1 120 GLU 120 120 120 GLU GLU D . n D 1 121 LYS 121 121 121 LYS LYS D . n D 1 122 GLU 122 122 122 GLU GLU D . n D 1 123 LYS 123 123 123 LYS LYS D . n D 1 124 ALA 124 124 124 ALA ALA D . n D 1 125 THR 125 125 125 THR THR D . n D 1 126 ALA 126 126 ? ? ? D . n D 1 127 LEU 127 127 ? ? ? D . n D 1 128 GLU 128 128 ? ? ? D . n D 1 129 HIS 129 129 ? ? ? D . n D 1 130 HIS 130 130 ? ? ? D . n D 1 131 HIS 131 131 ? ? ? D . n D 1 132 HIS 132 132 ? ? ? D . n D 1 133 HIS 133 133 ? ? ? D . n D 1 134 HIS 134 134 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 201 32 HOH HOH A . E 2 HOH 2 202 1 HOH HOH A . E 2 HOH 3 203 2 HOH HOH A . E 2 HOH 4 204 23 HOH HOH A . E 2 HOH 5 205 5 HOH HOH A . E 2 HOH 6 206 12 HOH HOH A . E 2 HOH 7 207 21 HOH HOH A . E 2 HOH 8 208 15 HOH HOH A . E 2 HOH 9 209 33 HOH HOH A . E 2 HOH 10 210 17 HOH HOH A . E 2 HOH 11 211 13 HOH HOH A . F 2 HOH 1 201 16 HOH HOH B . F 2 HOH 2 202 9 HOH HOH B . F 2 HOH 3 203 20 HOH HOH B . F 2 HOH 4 204 14 HOH HOH B . G 2 HOH 1 201 29 HOH HOH C . G 2 HOH 2 202 19 HOH HOH C . G 2 HOH 3 203 22 HOH HOH C . G 2 HOH 4 204 7 HOH HOH C . G 2 HOH 5 205 4 HOH HOH C . G 2 HOH 6 206 24 HOH HOH C . G 2 HOH 7 207 18 HOH HOH C . G 2 HOH 8 208 8 HOH HOH C . G 2 HOH 9 209 6 HOH HOH C . H 2 HOH 1 201 10 HOH HOH D . H 2 HOH 2 202 25 HOH HOH D . H 2 HOH 3 203 11 HOH HOH D . H 2 HOH 4 204 28 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 38 ? CG ? A LYS 38 CG 2 1 Y 1 A LYS 38 ? CD ? A LYS 38 CD 3 1 Y 1 A LYS 38 ? CE ? A LYS 38 CE 4 1 Y 1 A LYS 38 ? NZ ? A LYS 38 NZ 5 1 Y 1 A GLN 63 ? CG ? A GLN 63 CG 6 1 Y 1 A GLN 63 ? CD ? A GLN 63 CD 7 1 Y 1 A GLN 63 ? OE1 ? A GLN 63 OE1 8 1 Y 1 A GLN 63 ? NE2 ? A GLN 63 NE2 9 1 Y 1 A SER 77 ? OG ? A SER 77 OG 10 1 Y 1 A ASP 96 ? CG ? A ASP 96 CG 11 1 Y 1 A ASP 96 ? OD1 ? A ASP 96 OD1 12 1 Y 1 A ASP 96 ? OD2 ? A ASP 96 OD2 13 1 Y 1 A GLU 103 ? CG ? A GLU 103 CG 14 1 Y 1 A GLU 103 ? CD ? A GLU 103 CD 15 1 Y 1 A GLU 103 ? OE1 ? A GLU 103 OE1 16 1 Y 1 A GLU 103 ? OE2 ? A GLU 103 OE2 17 1 Y 1 A GLU 104 ? CG ? A GLU 104 CG 18 1 Y 1 A GLU 104 ? CD ? A GLU 104 CD 19 1 Y 1 A GLU 104 ? OE1 ? A GLU 104 OE1 20 1 Y 1 A GLU 104 ? OE2 ? A GLU 104 OE2 21 1 Y 1 A GLU 115 ? CG ? A GLU 115 CG 22 1 Y 1 A GLU 115 ? CD ? A GLU 115 CD 23 1 Y 1 A GLU 115 ? OE1 ? A GLU 115 OE1 24 1 Y 1 A GLU 115 ? OE2 ? A GLU 115 OE2 25 1 Y 1 A LYS 118 ? CG ? A LYS 118 CG 26 1 Y 1 A LYS 118 ? CD ? A LYS 118 CD 27 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 28 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 29 1 Y 1 A ASN 119 ? CG ? A ASN 119 CG 30 1 Y 1 A ASN 119 ? OD1 ? A ASN 119 OD1 31 1 Y 1 A ASN 119 ? ND2 ? A ASN 119 ND2 32 1 Y 1 A LYS 123 ? CG ? A LYS 123 CG 33 1 Y 1 A LYS 123 ? CD ? A LYS 123 CD 34 1 Y 1 A LYS 123 ? CE ? A LYS 123 CE 35 1 Y 1 A LYS 123 ? NZ ? A LYS 123 NZ 36 1 Y 1 B ARG 9 ? CG ? B ARG 9 CG 37 1 Y 1 B ARG 9 ? CD ? B ARG 9 CD 38 1 Y 1 B ARG 9 ? NE ? B ARG 9 NE 39 1 Y 1 B ARG 9 ? CZ ? B ARG 9 CZ 40 1 Y 1 B ARG 9 ? NH1 ? B ARG 9 NH1 41 1 Y 1 B ARG 9 ? NH2 ? B ARG 9 NH2 42 1 Y 1 B LYS 38 ? CG ? B LYS 38 CG 43 1 Y 1 B LYS 38 ? CD ? B LYS 38 CD 44 1 Y 1 B LYS 38 ? CE ? B LYS 38 CE 45 1 Y 1 B LYS 38 ? NZ ? B LYS 38 NZ 46 1 Y 1 B LYS 68 ? CG ? B LYS 68 CG 47 1 Y 1 B LYS 68 ? CD ? B LYS 68 CD 48 1 Y 1 B LYS 68 ? CE ? B LYS 68 CE 49 1 Y 1 B LYS 68 ? NZ ? B LYS 68 NZ 50 1 Y 1 B ASP 96 ? CG ? B ASP 96 CG 51 1 Y 1 B ASP 96 ? OD1 ? B ASP 96 OD1 52 1 Y 1 B ASP 96 ? OD2 ? B ASP 96 OD2 53 1 Y 1 B LYS 112 ? CG ? B LYS 112 CG 54 1 Y 1 B LYS 112 ? CD ? B LYS 112 CD 55 1 Y 1 B LYS 112 ? CE ? B LYS 112 CE 56 1 Y 1 B LYS 112 ? NZ ? B LYS 112 NZ 57 1 Y 1 B GLU 115 ? CG ? B GLU 115 CG 58 1 Y 1 B GLU 115 ? CD ? B GLU 115 CD 59 1 Y 1 B GLU 115 ? OE1 ? B GLU 115 OE1 60 1 Y 1 B GLU 115 ? OE2 ? B GLU 115 OE2 61 1 Y 1 B LYS 116 ? CG ? B LYS 116 CG 62 1 Y 1 B LYS 116 ? CD ? B LYS 116 CD 63 1 Y 1 B LYS 116 ? CE ? B LYS 116 CE 64 1 Y 1 B LYS 116 ? NZ ? B LYS 116 NZ 65 1 Y 1 B LYS 118 ? CG ? B LYS 118 CG 66 1 Y 1 B LYS 118 ? CD ? B LYS 118 CD 67 1 Y 1 B LYS 118 ? CE ? B LYS 118 CE 68 1 Y 1 B LYS 118 ? NZ ? B LYS 118 NZ 69 1 Y 1 B GLU 120 ? CG ? B GLU 120 CG 70 1 Y 1 B GLU 120 ? CD ? B GLU 120 CD 71 1 Y 1 B GLU 120 ? OE1 ? B GLU 120 OE1 72 1 Y 1 B GLU 120 ? OE2 ? B GLU 120 OE2 73 1 Y 1 B LYS 123 ? CG ? B LYS 123 CG 74 1 Y 1 B LYS 123 ? CD ? B LYS 123 CD 75 1 Y 1 B LYS 123 ? CE ? B LYS 123 CE 76 1 Y 1 B LYS 123 ? NZ ? B LYS 123 NZ 77 1 Y 1 C ARG 11 ? CG ? C ARG 11 CG 78 1 Y 1 C ARG 11 ? CD ? C ARG 11 CD 79 1 Y 1 C ARG 11 ? NE ? C ARG 11 NE 80 1 Y 1 C ARG 11 ? CZ ? C ARG 11 CZ 81 1 Y 1 C ARG 11 ? NH1 ? C ARG 11 NH1 82 1 Y 1 C ARG 11 ? NH2 ? C ARG 11 NH2 83 1 Y 1 C ARG 19 ? CG ? C ARG 19 CG 84 1 Y 1 C ARG 19 ? CD ? C ARG 19 CD 85 1 Y 1 C ARG 19 ? NE ? C ARG 19 NE 86 1 Y 1 C ARG 19 ? CZ ? C ARG 19 CZ 87 1 Y 1 C ARG 19 ? NH1 ? C ARG 19 NH1 88 1 Y 1 C ARG 19 ? NH2 ? C ARG 19 NH2 89 1 Y 1 C LYS 38 ? CG ? C LYS 38 CG 90 1 Y 1 C LYS 38 ? CD ? C LYS 38 CD 91 1 Y 1 C LYS 38 ? CE ? C LYS 38 CE 92 1 Y 1 C LYS 38 ? NZ ? C LYS 38 NZ 93 1 Y 1 C LYS 68 ? CG ? C LYS 68 CG 94 1 Y 1 C LYS 68 ? CD ? C LYS 68 CD 95 1 Y 1 C LYS 68 ? CE ? C LYS 68 CE 96 1 Y 1 C LYS 68 ? NZ ? C LYS 68 NZ 97 1 Y 1 C LYS 69 ? CG ? C LYS 69 CG 98 1 Y 1 C LYS 69 ? CD ? C LYS 69 CD 99 1 Y 1 C LYS 69 ? CE ? C LYS 69 CE 100 1 Y 1 C LYS 69 ? NZ ? C LYS 69 NZ 101 1 Y 1 C GLN 75 ? CG ? C GLN 75 CG 102 1 Y 1 C GLN 75 ? CD ? C GLN 75 CD 103 1 Y 1 C GLN 75 ? OE1 ? C GLN 75 OE1 104 1 Y 1 C GLN 75 ? NE2 ? C GLN 75 NE2 105 1 Y 1 C VAL 76 ? CG1 ? C VAL 76 CG1 106 1 Y 1 C VAL 76 ? CG2 ? C VAL 76 CG2 107 1 Y 1 C GLU 103 ? CG ? C GLU 103 CG 108 1 Y 1 C GLU 103 ? CD ? C GLU 103 CD 109 1 Y 1 C GLU 103 ? OE1 ? C GLU 103 OE1 110 1 Y 1 C GLU 103 ? OE2 ? C GLU 103 OE2 111 1 Y 1 C GLU 104 ? CG ? C GLU 104 CG 112 1 Y 1 C GLU 104 ? CD ? C GLU 104 CD 113 1 Y 1 C GLU 104 ? OE1 ? C GLU 104 OE1 114 1 Y 1 C GLU 104 ? OE2 ? C GLU 104 OE2 115 1 Y 1 C GLN 106 ? CG ? C GLN 106 CG 116 1 Y 1 C GLN 106 ? CD ? C GLN 106 CD 117 1 Y 1 C GLN 106 ? OE1 ? C GLN 106 OE1 118 1 Y 1 C GLN 106 ? NE2 ? C GLN 106 NE2 119 1 Y 1 C LYS 107 ? CG ? C LYS 107 CG 120 1 Y 1 C LYS 107 ? CD ? C LYS 107 CD 121 1 Y 1 C LYS 107 ? CE ? C LYS 107 CE 122 1 Y 1 C LYS 107 ? NZ ? C LYS 107 NZ 123 1 Y 1 C ARG 109 ? CG ? C ARG 109 CG 124 1 Y 1 C ARG 109 ? CD ? C ARG 109 CD 125 1 Y 1 C ARG 109 ? NE ? C ARG 109 NE 126 1 Y 1 C ARG 109 ? CZ ? C ARG 109 CZ 127 1 Y 1 C ARG 109 ? NH1 ? C ARG 109 NH1 128 1 Y 1 C ARG 109 ? NH2 ? C ARG 109 NH2 129 1 Y 1 C GLU 110 ? CG ? C GLU 110 CG 130 1 Y 1 C GLU 110 ? CD ? C GLU 110 CD 131 1 Y 1 C GLU 110 ? OE1 ? C GLU 110 OE1 132 1 Y 1 C GLU 110 ? OE2 ? C GLU 110 OE2 133 1 Y 1 C LYS 112 ? CG ? C LYS 112 CG 134 1 Y 1 C LYS 112 ? CD ? C LYS 112 CD 135 1 Y 1 C LYS 112 ? CE ? C LYS 112 CE 136 1 Y 1 C LYS 112 ? NZ ? C LYS 112 NZ 137 1 Y 1 C ARG 113 ? CG ? C ARG 113 CG 138 1 Y 1 C ARG 113 ? CD ? C ARG 113 CD 139 1 Y 1 C ARG 113 ? NE ? C ARG 113 NE 140 1 Y 1 C ARG 113 ? CZ ? C ARG 113 CZ 141 1 Y 1 C ARG 113 ? NH1 ? C ARG 113 NH1 142 1 Y 1 C ARG 113 ? NH2 ? C ARG 113 NH2 143 1 Y 1 D ARG 11 ? CG ? D ARG 11 CG 144 1 Y 1 D ARG 11 ? CD ? D ARG 11 CD 145 1 Y 1 D ARG 11 ? NE ? D ARG 11 NE 146 1 Y 1 D ARG 11 ? CZ ? D ARG 11 CZ 147 1 Y 1 D ARG 11 ? NH1 ? D ARG 11 NH1 148 1 Y 1 D ARG 11 ? NH2 ? D ARG 11 NH2 149 1 Y 1 D LEU 24 ? CG ? D LEU 24 CG 150 1 Y 1 D LEU 24 ? CD1 ? D LEU 24 CD1 151 1 Y 1 D LEU 24 ? CD2 ? D LEU 24 CD2 152 1 Y 1 D LYS 38 ? CG ? D LYS 38 CG 153 1 Y 1 D LYS 38 ? CD ? D LYS 38 CD 154 1 Y 1 D LYS 38 ? CE ? D LYS 38 CE 155 1 Y 1 D LYS 38 ? NZ ? D LYS 38 NZ 156 1 Y 1 D GLN 63 ? CG ? D GLN 63 CG 157 1 Y 1 D GLN 63 ? CD ? D GLN 63 CD 158 1 Y 1 D GLN 63 ? OE1 ? D GLN 63 OE1 159 1 Y 1 D GLN 63 ? NE2 ? D GLN 63 NE2 160 1 Y 1 D LYS 68 ? CG ? D LYS 68 CG 161 1 Y 1 D LYS 68 ? CD ? D LYS 68 CD 162 1 Y 1 D LYS 68 ? CE ? D LYS 68 CE 163 1 Y 1 D LYS 68 ? NZ ? D LYS 68 NZ 164 1 Y 1 D LYS 69 ? CG ? D LYS 69 CG 165 1 Y 1 D LYS 69 ? CD ? D LYS 69 CD 166 1 Y 1 D LYS 69 ? CE ? D LYS 69 CE 167 1 Y 1 D LYS 69 ? NZ ? D LYS 69 NZ 168 1 Y 1 D VAL 76 ? CG1 ? D VAL 76 CG1 169 1 Y 1 D VAL 76 ? CG2 ? D VAL 76 CG2 170 1 Y 1 D LYS 101 ? CG ? D LYS 101 CG 171 1 Y 1 D LYS 101 ? CD ? D LYS 101 CD 172 1 Y 1 D LYS 101 ? CE ? D LYS 101 CE 173 1 Y 1 D LYS 101 ? NZ ? D LYS 101 NZ 174 1 Y 1 D GLU 103 ? CG ? D GLU 103 CG 175 1 Y 1 D GLU 103 ? CD ? D GLU 103 CD 176 1 Y 1 D GLU 103 ? OE1 ? D GLU 103 OE1 177 1 Y 1 D GLU 103 ? OE2 ? D GLU 103 OE2 178 1 Y 1 D GLU 104 ? CG ? D GLU 104 CG 179 1 Y 1 D GLU 104 ? CD ? D GLU 104 CD 180 1 Y 1 D GLU 104 ? OE1 ? D GLU 104 OE1 181 1 Y 1 D GLU 104 ? OE2 ? D GLU 104 OE2 182 1 Y 1 D GLN 106 ? CG ? D GLN 106 CG 183 1 Y 1 D GLN 106 ? CD ? D GLN 106 CD 184 1 Y 1 D GLN 106 ? OE1 ? D GLN 106 OE1 185 1 Y 1 D GLN 106 ? NE2 ? D GLN 106 NE2 186 1 Y 1 D LYS 107 ? CG ? D LYS 107 CG 187 1 Y 1 D LYS 107 ? CD ? D LYS 107 CD 188 1 Y 1 D LYS 107 ? CE ? D LYS 107 CE 189 1 Y 1 D LYS 107 ? NZ ? D LYS 107 NZ 190 1 Y 1 D ARG 109 ? CG ? D ARG 109 CG 191 1 Y 1 D ARG 109 ? CD ? D ARG 109 CD 192 1 Y 1 D ARG 109 ? NE ? D ARG 109 NE 193 1 Y 1 D ARG 109 ? CZ ? D ARG 109 CZ 194 1 Y 1 D ARG 109 ? NH1 ? D ARG 109 NH1 195 1 Y 1 D ARG 109 ? NH2 ? D ARG 109 NH2 196 1 Y 1 D LYS 112 ? CG ? D LYS 112 CG 197 1 Y 1 D LYS 112 ? CD ? D LYS 112 CD 198 1 Y 1 D LYS 112 ? CE ? D LYS 112 CE 199 1 Y 1 D LYS 112 ? NZ ? D LYS 112 NZ 200 1 Y 1 D LYS 116 ? CG ? D LYS 116 CG 201 1 Y 1 D LYS 116 ? CD ? D LYS 116 CD 202 1 Y 1 D LYS 116 ? CE ? D LYS 116 CE 203 1 Y 1 D LYS 116 ? NZ ? D LYS 116 NZ 204 1 Y 1 D GLU 117 ? CG ? D GLU 117 CG 205 1 Y 1 D GLU 117 ? CD ? D GLU 117 CD 206 1 Y 1 D GLU 117 ? OE1 ? D GLU 117 OE1 207 1 Y 1 D GLU 117 ? OE2 ? D GLU 117 OE2 208 1 Y 1 D LYS 118 ? CG ? D LYS 118 CG 209 1 Y 1 D LYS 118 ? CD ? D LYS 118 CD 210 1 Y 1 D LYS 118 ? CE ? D LYS 118 CE 211 1 Y 1 D LYS 118 ? NZ ? D LYS 118 NZ 212 1 Y 1 D GLU 120 ? CG ? D GLU 120 CG 213 1 Y 1 D GLU 120 ? CD ? D GLU 120 CD 214 1 Y 1 D GLU 120 ? OE1 ? D GLU 120 OE1 215 1 Y 1 D GLU 120 ? OE2 ? D GLU 120 OE2 216 1 Y 1 D LYS 121 ? CG ? D LYS 121 CG 217 1 Y 1 D LYS 121 ? CD ? D LYS 121 CD 218 1 Y 1 D LYS 121 ? CE ? D LYS 121 CE 219 1 Y 1 D LYS 121 ? NZ ? D LYS 121 NZ 220 1 Y 1 D LYS 123 ? CG ? D LYS 123 CG 221 1 Y 1 D LYS 123 ? CD ? D LYS 123 CD 222 1 Y 1 D LYS 123 ? CE ? D LYS 123 CE 223 1 Y 1 D LYS 123 ? NZ ? D LYS 123 NZ 224 1 Y 1 D THR 125 ? OG1 ? D THR 125 OG1 225 1 Y 1 D THR 125 ? CG2 ? D THR 125 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7DL8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.028 _cell.length_a_esd ? _cell.length_b 86.236 _cell.length_b_esd ? _cell.length_c 211.259 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 32 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DL8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DL8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Potassium sodium tartrate tetrahydrate, 0.1M Sodium citrate tribasic dihydrate pH 5.6, 2.0M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9778 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9778 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7DL8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.459 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23706 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.2 _reflns.pdbx_Rmerge_I_obs 0.093 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.46 _reflns_shell.d_res_low 2.55 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2342 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.830 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.953 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 123.540 _refine.B_iso_mean 60.0264 _refine.B_iso_min 33.290 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DL8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4590 _refine.ls_d_res_low 43.1180 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23686 _refine.ls_number_reflns_R_free 1890 _refine.ls_number_reflns_R_work 41115 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8600 _refine.ls_percent_reflns_R_free 8.4200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2399 _refine.ls_R_factor_R_free 0.2613 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2379 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'rosetta model' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.6300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4590 _refine_hist.d_res_low 43.1180 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 3221 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 431 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 57.24 _refine_hist.pdbx_number_atoms_protein 3193 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1112 9.758 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1112 9.758 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 1112 9.758 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 1112 9.758 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.46 2.4900 . . 141 1526 100.0000 . . . 0.3895 0.0000 0.3363 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4900 2.5228 . . 144 1553 100.0000 . . . 0.2957 0.0000 0.3173 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5228 2.5573 . . 135 1452 100.0000 . . . 0.3421 0.0000 0.2945 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5573 2.5938 . . 141 1540 100.0000 . . . 0.3814 0.0000 0.3068 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5938 2.6325 . . 142 1552 100.0000 . . . 0.3450 0.0000 0.2955 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6325 2.6737 . . 131 1499 100.0000 . . . 0.3630 0.0000 0.3002 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6737 2.7175 . . 143 1521 100.0000 . . . 0.3108 0.0000 0.2908 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7175 2.7644 . . 145 1565 100.0000 . . . 0.2821 0.0000 0.2909 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7644 2.8146 . . 134 1504 100.0000 . . . 0.2612 0.0000 0.2885 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8146 2.8687 . . 137 1497 100.0000 . . . 0.3509 0.0000 0.2999 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8687 2.9273 . . 147 1575 100.0000 . . . 0.3478 0.0000 0.2749 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9273 2.9909 . . 139 1490 100.0000 . . . 0.3473 0.0000 0.2827 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9909 3.0605 . . 141 1546 100.0000 . . . 0.2912 0.0000 0.2697 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0605 3.1370 . . 134 1490 100.0000 . . . 0.3213 0.0000 0.2738 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1370 3.2218 . . 143 1519 100.0000 . . . 0.2842 0.0000 0.2555 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2218 3.3166 . . 142 1549 100.0000 . . . 0.2733 0.0000 0.2494 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3166 3.4236 . . 142 1520 100.0000 . . . 0.3155 0.0000 0.2466 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4236 3.5459 . . 135 1510 100.0000 . . . 0.2641 0.0000 0.2465 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5459 3.6878 . . 145 1540 100.0000 . . . 0.2412 0.0000 0.2309 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6878 3.8555 . . 133 1503 100.0000 . . . 0.2763 0.0000 0.2098 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8555 4.0586 . . 139 1536 100.0000 . . . 0.2640 0.0000 0.2297 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0586 4.3127 . . 148 1536 100.0000 . . . 0.2066 0.0000 0.1984 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3127 4.6453 . . 141 1523 100.0000 . . . 0.1971 0.0000 0.1926 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6453 5.1121 . . 147 1495 100.0000 . . . 0.2108 0.0000 0.1889 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.1121 5.8503 . . 137 1527 100.0000 . . . 0.2901 0.0000 0.2537 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.8503 7.3648 . . 136 1510 100.0000 . . . 0.2679 0.0000 0.2519 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.3648 43.118 . . 137 1537 99.0000 . . . 0.1858 0.0000 0.2018 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 67 or (resid 68 through 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 2 ;(chain B and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 or (resid 103 through 104 and (name N or name CA or name C or name O or name CB )) or resid 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 3 ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 4 ;(chain D and (resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 109 or (resid 110 through 113 and (name N or name CA or name C or name O or name CB )))) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A ARG 11 . A ARG 11 . A ARG 11 A ARG 11 ? ;(chain A and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 67 or (resid 68 through 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 1 2 A ASP 8 . A ALA 126 . A ASP 8 A ALA 126 ? ;(chain A and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 67 or (resid 68 through 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 1 3 A ASP 8 . A ALA 126 . A ASP 8 A ALA 126 ? ;(chain A and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 67 or (resid 68 through 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 1 4 A ASP 8 . A ALA 126 . A ASP 8 A ALA 126 ? ;(chain A and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 67 or (resid 68 through 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 1 5 A ASP 8 . A ALA 126 . A ASP 8 A ALA 126 ? ;(chain A and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 67 or (resid 68 through 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 2 1 B ARG 11 . B ARG 11 . B ARG 11 B ARG 11 ? ;(chain B and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 or (resid 103 through 104 and (name N or name CA or name C or name O or name CB )) or resid 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 2 2 B ARG 9 . B THR 125 . B ARG 9 B THR 125 ? ;(chain B and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 or (resid 103 through 104 and (name N or name CA or name C or name O or name CB )) or resid 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 2 3 B ARG 9 . B THR 125 . B ARG 9 B THR 125 ? ;(chain B and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 or (resid 103 through 104 and (name N or name CA or name C or name O or name CB )) or resid 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 2 4 B ARG 9 . B THR 125 . B ARG 9 B THR 125 ? ;(chain B and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 or (resid 103 through 104 and (name N or name CA or name C or name O or name CB )) or resid 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 2 5 B ARG 9 . B THR 125 . B ARG 9 B THR 125 ? ;(chain B and ((resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 or (resid 103 through 104 and (name N or name CA or name C or name O or name CB )) or resid 105 or (resid 106 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 3 1 C ARG 11 . C PHE 23 . C ARG 11 C PHE 23 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 2 C PHE 25 . C GLN 62 . C PHE 25 C GLN 62 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 3 C GLN 63 . C GLN 63 . C GLN 63 C GLN 63 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 4 C PRO 10 . C ARG 113 . C PRO 10 C ARG 113 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 5 C PRO 10 . C ARG 113 . C PRO 10 C ARG 113 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 6 C PRO 10 . C ARG 113 . C PRO 10 C ARG 113 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 7 C PRO 10 . C ARG 113 . C PRO 10 C ARG 113 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 8 C PRO 84 . C PRO 84 . C PRO 84 C PRO 84 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 9 C PRO 10 . C ARG 113 . C PRO 10 C ARG 113 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 10 C PRO 10 . C ARG 113 . C PRO 10 C ARG 113 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 11 C PRO 10 . C ARG 113 . C PRO 10 C ARG 113 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 3 12 C PRO 10 . C ARG 113 . C PRO 10 C ARG 113 ? ;(chain C and (resid 11 through 23 or resid 25 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 76 or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 113)) ; 1 4 1 D ARG 11 . D TYR 18 . D ARG 11 D TYR 18 ? ;(chain D and (resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 109 or (resid 110 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 4 2 D ARG 19 . D ARG 19 . D ARG 19 D ARG 19 ? ;(chain D and (resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 109 or (resid 110 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 4 3 D ARG 11 . D THR 125 . D ARG 11 D THR 125 ? ;(chain D and (resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 109 or (resid 110 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 4 4 D ARG 11 . D THR 125 . D ARG 11 D THR 125 ? ;(chain D and (resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 109 or (resid 110 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 4 5 D ARG 11 . D THR 125 . D ARG 11 D THR 125 ? ;(chain D and (resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 109 or (resid 110 through 113 and (name N or name CA or name C or name O or name CB )))) ; 1 4 6 D ARG 11 . D THR 125 . D ARG 11 D THR 125 ? ;(chain D and (resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 23 or resid 25 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 84 through 95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resid 97 through 109 or (resid 110 through 113 and (name N or name CA or name C or name O or name CB )))) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7DL8 _struct.title 'Crystal structure of ALBA1 from Trypanosoma brucei' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DL8 _struct_keywords.text 'ALBA domain, RNA binding, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A3L6KSX9_9TRYP _struct_ref.pdbx_db_accession A0A3L6KSX9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTGKSDRPRNSVRVGYRGTKFLFVDITKHLLHDGEKEVYVSALGGAINEAVSVVEMLKDQQMVVVKKITTSRQVSEEPD DGPVDKIEIVVTKADGFDAKYEEQQKAREAKRLEKEKNEKEKATA ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7DL8 A 2 ? 126 ? A0A3L6KSX9 1 ? 125 ? 2 126 2 1 7DL8 B 2 ? 126 ? A0A3L6KSX9 1 ? 125 ? 2 126 3 1 7DL8 C 2 ? 126 ? A0A3L6KSX9 1 ? 125 ? 2 126 4 1 7DL8 D 2 ? 126 ? A0A3L6KSX9 1 ? 125 ? 2 126 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7DL8 MET A 1 ? UNP A0A3L6KSX9 ? ? 'expression tag' 1 1 1 7DL8 LEU A 127 ? UNP A0A3L6KSX9 ? ? 'expression tag' 127 2 1 7DL8 GLU A 128 ? UNP A0A3L6KSX9 ? ? 'expression tag' 128 3 1 7DL8 HIS A 129 ? UNP A0A3L6KSX9 ? ? 'expression tag' 129 4 1 7DL8 HIS A 130 ? UNP A0A3L6KSX9 ? ? 'expression tag' 130 5 1 7DL8 HIS A 131 ? UNP A0A3L6KSX9 ? ? 'expression tag' 131 6 1 7DL8 HIS A 132 ? UNP A0A3L6KSX9 ? ? 'expression tag' 132 7 1 7DL8 HIS A 133 ? UNP A0A3L6KSX9 ? ? 'expression tag' 133 8 1 7DL8 HIS A 134 ? UNP A0A3L6KSX9 ? ? 'expression tag' 134 9 2 7DL8 MET B 1 ? UNP A0A3L6KSX9 ? ? 'expression tag' 1 10 2 7DL8 LEU B 127 ? UNP A0A3L6KSX9 ? ? 'expression tag' 127 11 2 7DL8 GLU B 128 ? UNP A0A3L6KSX9 ? ? 'expression tag' 128 12 2 7DL8 HIS B 129 ? UNP A0A3L6KSX9 ? ? 'expression tag' 129 13 2 7DL8 HIS B 130 ? UNP A0A3L6KSX9 ? ? 'expression tag' 130 14 2 7DL8 HIS B 131 ? UNP A0A3L6KSX9 ? ? 'expression tag' 131 15 2 7DL8 HIS B 132 ? UNP A0A3L6KSX9 ? ? 'expression tag' 132 16 2 7DL8 HIS B 133 ? UNP A0A3L6KSX9 ? ? 'expression tag' 133 17 2 7DL8 HIS B 134 ? UNP A0A3L6KSX9 ? ? 'expression tag' 134 18 3 7DL8 MET C 1 ? UNP A0A3L6KSX9 ? ? 'expression tag' 1 19 3 7DL8 LEU C 127 ? UNP A0A3L6KSX9 ? ? 'expression tag' 127 20 3 7DL8 GLU C 128 ? UNP A0A3L6KSX9 ? ? 'expression tag' 128 21 3 7DL8 HIS C 129 ? UNP A0A3L6KSX9 ? ? 'expression tag' 129 22 3 7DL8 HIS C 130 ? UNP A0A3L6KSX9 ? ? 'expression tag' 130 23 3 7DL8 HIS C 131 ? UNP A0A3L6KSX9 ? ? 'expression tag' 131 24 3 7DL8 HIS C 132 ? UNP A0A3L6KSX9 ? ? 'expression tag' 132 25 3 7DL8 HIS C 133 ? UNP A0A3L6KSX9 ? ? 'expression tag' 133 26 3 7DL8 HIS C 134 ? UNP A0A3L6KSX9 ? ? 'expression tag' 134 27 4 7DL8 MET D 1 ? UNP A0A3L6KSX9 ? ? 'expression tag' 1 28 4 7DL8 LEU D 127 ? UNP A0A3L6KSX9 ? ? 'expression tag' 127 29 4 7DL8 GLU D 128 ? UNP A0A3L6KSX9 ? ? 'expression tag' 128 30 4 7DL8 HIS D 129 ? UNP A0A3L6KSX9 ? ? 'expression tag' 129 31 4 7DL8 HIS D 130 ? UNP A0A3L6KSX9 ? ? 'expression tag' 130 32 4 7DL8 HIS D 131 ? UNP A0A3L6KSX9 ? ? 'expression tag' 131 33 4 7DL8 HIS D 132 ? UNP A0A3L6KSX9 ? ? 'expression tag' 132 34 4 7DL8 HIS D 133 ? UNP A0A3L6KSX9 ? ? 'expression tag' 133 35 4 7DL8 HIS D 134 ? UNP A0A3L6KSX9 ? ? 'expression tag' 134 36 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5780 ? 1 MORE -23 ? 1 'SSA (A^2)' 22810 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 21 ? ASP A 35 ? THR A 21 ASP A 35 1 ? 15 HELX_P HELX_P2 AA2 ALA A 48 ? GLN A 62 ? ALA A 48 GLN A 62 1 ? 15 HELX_P HELX_P3 AA3 GLY A 97 ? ALA A 124 ? GLY A 97 ALA A 124 1 ? 28 HELX_P HELX_P4 AA4 THR B 21 ? ASP B 35 ? THR B 21 ASP B 35 1 ? 15 HELX_P HELX_P5 AA5 ALA B 48 ? GLN B 62 ? ALA B 48 GLN B 62 1 ? 15 HELX_P HELX_P6 AA6 GLY B 97 ? THR B 125 ? GLY B 97 THR B 125 1 ? 29 HELX_P HELX_P7 AA7 TYR C 18 ? ASP C 35 ? TYR C 18 ASP C 35 1 ? 18 HELX_P HELX_P8 AA8 ALA C 48 ? GLN C 62 ? ALA C 48 GLN C 62 1 ? 15 HELX_P HELX_P9 AA9 GLY C 97 ? ARG C 113 ? GLY C 97 ARG C 113 1 ? 17 HELX_P HELX_P10 AB1 GLY D 20 ? ASP D 35 ? GLY D 20 ASP D 35 1 ? 16 HELX_P HELX_P11 AB2 ALA D 48 ? GLN D 62 ? ALA D 48 GLN D 62 1 ? 15 HELX_P HELX_P12 AB3 GLY D 97 ? LYS D 123 ? GLY D 97 LYS D 123 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 13 ? ARG A 15 ? SER A 13 ARG A 15 AA1 2 GLU A 39 ? LEU A 45 ? GLU A 39 LEU A 45 AA1 3 VAL A 85 ? LYS A 94 ? VAL A 85 LYS A 94 AA1 4 VAL A 65 ? GLN A 75 ? VAL A 65 GLN A 75 AA2 1 SER B 13 ? ARG B 15 ? SER B 13 ARG B 15 AA2 2 GLU B 39 ? LEU B 45 ? GLU B 39 LEU B 45 AA2 3 VAL B 85 ? LYS B 94 ? VAL B 85 LYS B 94 AA2 4 VAL B 65 ? GLN B 75 ? VAL B 65 GLN B 75 AA3 1 SER C 13 ? ARG C 15 ? SER C 13 ARG C 15 AA3 2 GLU D 39 ? LEU D 45 ? GLU D 39 LEU D 45 AA3 3 VAL D 85 ? LYS D 94 ? VAL D 85 LYS D 94 AA3 4 VAL D 65 ? GLN D 75 ? VAL D 65 GLN D 75 AA4 1 VAL C 65 ? GLN C 75 ? VAL C 65 GLN C 75 AA4 2 VAL C 85 ? LYS C 94 ? VAL C 85 LYS C 94 AA4 3 GLU C 39 ? LEU C 45 ? GLU C 39 LEU C 45 AA4 4 SER D 13 ? VAL D 16 ? SER D 13 VAL D 16 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 14 ? N VAL A 14 O TYR A 41 ? O TYR A 41 AA1 2 3 N VAL A 42 ? N VAL A 42 O ILE A 90 ? O ILE A 90 AA1 3 4 O VAL A 85 ? O VAL A 85 N GLN A 75 ? N GLN A 75 AA2 1 2 N VAL B 14 ? N VAL B 14 O TYR B 41 ? O TYR B 41 AA2 2 3 N VAL B 42 ? N VAL B 42 O ILE B 90 ? O ILE B 90 AA2 3 4 O VAL B 91 ? O VAL B 91 N LYS B 68 ? N LYS B 68 AA3 1 2 N VAL C 14 ? N VAL C 14 O TYR D 41 ? O TYR D 41 AA3 2 3 N VAL D 42 ? N VAL D 42 O ILE D 90 ? O ILE D 90 AA3 3 4 O VAL D 91 ? O VAL D 91 N LYS D 68 ? N LYS D 68 AA4 1 2 N LYS C 68 ? N LYS C 68 O VAL C 91 ? O VAL C 91 AA4 2 3 O ILE C 90 ? O ILE C 90 N VAL C 42 ? N VAL C 42 AA4 3 4 N SER C 43 ? N SER C 43 O VAL D 16 ? O VAL D 16 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH C TYR 18 ? ? OE2 D GLU 51 ? ? 2.16 2 1 OE1 C GLU 51 ? ? OH D TYR 18 ? ? 2.17 3 1 NZ A LYS 87 ? ? O A HOH 201 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OH _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 TYR _pdbx_validate_symm_contact.auth_seq_id_1 102 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 110 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_555 _pdbx_validate_symm_contact.dist 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 35 ? ? -96.43 41.04 2 1 ARG B 19 ? ? -75.65 20.70 3 1 ASP B 35 ? ? -97.87 42.37 4 1 ASP C 35 ? ? -96.09 40.06 5 1 ASN D 12 ? ? -91.81 30.36 6 1 ASP D 35 ? ? -94.86 41.18 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 211 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 1.0051 _pdbx_refine_tls.origin_y 17.2199 _pdbx_refine_tls.origin_z -23.4792 _pdbx_refine_tls.T[1][1] 0.4414 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0550 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0032 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.3759 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0235 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3758 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.3242 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.1910 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.3481 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.5577 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.2853 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.7140 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0389 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0510 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0147 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0231 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0463 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0275 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0669 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0522 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0000 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 8 ? ? ? A 126 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 9 ? ? ? B 125 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? C 10 ? ? ? C 113 ? ? all 4 'X-RAY DIFFRACTION' 1 ? ? D 11 ? ? ? D 125 ? ? all 5 'X-RAY DIFFRACTION' 1 ? ? S 1 ? ? ? S 33 ? ? all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A MET 2 ? A MET 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A GLU 78 ? A GLU 78 9 1 Y 1 A GLU 79 ? A GLU 79 10 1 Y 1 A PRO 80 ? A PRO 80 11 1 Y 1 A ASP 81 ? A ASP 81 12 1 Y 1 A ASP 82 ? A ASP 82 13 1 Y 1 A LEU 127 ? A LEU 127 14 1 Y 1 A GLU 128 ? A GLU 128 15 1 Y 1 A HIS 129 ? A HIS 129 16 1 Y 1 A HIS 130 ? A HIS 130 17 1 Y 1 A HIS 131 ? A HIS 131 18 1 Y 1 A HIS 132 ? A HIS 132 19 1 Y 1 A HIS 133 ? A HIS 133 20 1 Y 1 A HIS 134 ? A HIS 134 21 1 Y 1 B MET 1 ? B MET 1 22 1 Y 1 B MET 2 ? B MET 2 23 1 Y 1 B THR 3 ? B THR 3 24 1 Y 1 B THR 4 ? B THR 4 25 1 Y 1 B GLY 5 ? B GLY 5 26 1 Y 1 B LYS 6 ? B LYS 6 27 1 Y 1 B SER 7 ? B SER 7 28 1 Y 1 B ASP 8 ? B ASP 8 29 1 Y 1 B SER 77 ? B SER 77 30 1 Y 1 B GLU 78 ? B GLU 78 31 1 Y 1 B GLU 79 ? B GLU 79 32 1 Y 1 B PRO 80 ? B PRO 80 33 1 Y 1 B ASP 81 ? B ASP 81 34 1 Y 1 B ASP 82 ? B ASP 82 35 1 Y 1 B GLY 83 ? B GLY 83 36 1 Y 1 B ALA 126 ? B ALA 126 37 1 Y 1 B LEU 127 ? B LEU 127 38 1 Y 1 B GLU 128 ? B GLU 128 39 1 Y 1 B HIS 129 ? B HIS 129 40 1 Y 1 B HIS 130 ? B HIS 130 41 1 Y 1 B HIS 131 ? B HIS 131 42 1 Y 1 B HIS 132 ? B HIS 132 43 1 Y 1 B HIS 133 ? B HIS 133 44 1 Y 1 B HIS 134 ? B HIS 134 45 1 Y 1 C MET 1 ? C MET 1 46 1 Y 1 C MET 2 ? C MET 2 47 1 Y 1 C THR 3 ? C THR 3 48 1 Y 1 C THR 4 ? C THR 4 49 1 Y 1 C GLY 5 ? C GLY 5 50 1 Y 1 C LYS 6 ? C LYS 6 51 1 Y 1 C SER 7 ? C SER 7 52 1 Y 1 C ASP 8 ? C ASP 8 53 1 Y 1 C ARG 9 ? C ARG 9 54 1 Y 1 C SER 77 ? C SER 77 55 1 Y 1 C GLU 78 ? C GLU 78 56 1 Y 1 C GLU 79 ? C GLU 79 57 1 Y 1 C PRO 80 ? C PRO 80 58 1 Y 1 C ASP 81 ? C ASP 81 59 1 Y 1 C ASP 82 ? C ASP 82 60 1 Y 1 C LEU 114 ? C LEU 114 61 1 Y 1 C GLU 115 ? C GLU 115 62 1 Y 1 C LYS 116 ? C LYS 116 63 1 Y 1 C GLU 117 ? C GLU 117 64 1 Y 1 C LYS 118 ? C LYS 118 65 1 Y 1 C ASN 119 ? C ASN 119 66 1 Y 1 C GLU 120 ? C GLU 120 67 1 Y 1 C LYS 121 ? C LYS 121 68 1 Y 1 C GLU 122 ? C GLU 122 69 1 Y 1 C LYS 123 ? C LYS 123 70 1 Y 1 C ALA 124 ? C ALA 124 71 1 Y 1 C THR 125 ? C THR 125 72 1 Y 1 C ALA 126 ? C ALA 126 73 1 Y 1 C LEU 127 ? C LEU 127 74 1 Y 1 C GLU 128 ? C GLU 128 75 1 Y 1 C HIS 129 ? C HIS 129 76 1 Y 1 C HIS 130 ? C HIS 130 77 1 Y 1 C HIS 131 ? C HIS 131 78 1 Y 1 C HIS 132 ? C HIS 132 79 1 Y 1 C HIS 133 ? C HIS 133 80 1 Y 1 C HIS 134 ? C HIS 134 81 1 Y 1 D MET 1 ? D MET 1 82 1 Y 1 D MET 2 ? D MET 2 83 1 Y 1 D THR 3 ? D THR 3 84 1 Y 1 D THR 4 ? D THR 4 85 1 Y 1 D GLY 5 ? D GLY 5 86 1 Y 1 D LYS 6 ? D LYS 6 87 1 Y 1 D SER 7 ? D SER 7 88 1 Y 1 D ASP 8 ? D ASP 8 89 1 Y 1 D ARG 9 ? D ARG 9 90 1 Y 1 D PRO 10 ? D PRO 10 91 1 Y 1 D SER 77 ? D SER 77 92 1 Y 1 D GLU 78 ? D GLU 78 93 1 Y 1 D GLU 79 ? D GLU 79 94 1 Y 1 D PRO 80 ? D PRO 80 95 1 Y 1 D ASP 81 ? D ASP 81 96 1 Y 1 D ASP 82 ? D ASP 82 97 1 Y 1 D ALA 126 ? D ALA 126 98 1 Y 1 D LEU 127 ? D LEU 127 99 1 Y 1 D GLU 128 ? D GLU 128 100 1 Y 1 D HIS 129 ? D HIS 129 101 1 Y 1 D HIS 130 ? D HIS 130 102 1 Y 1 D HIS 131 ? D HIS 131 103 1 Y 1 D HIS 132 ? D HIS 132 104 1 Y 1 D HIS 133 ? D HIS 133 105 1 Y 1 D HIS 134 ? D HIS 134 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TYR N N N N 307 TYR CA C N S 308 TYR C C N N 309 TYR O O N N 310 TYR CB C N N 311 TYR CG C Y N 312 TYR CD1 C Y N 313 TYR CD2 C Y N 314 TYR CE1 C Y N 315 TYR CE2 C Y N 316 TYR CZ C Y N 317 TYR OH O N N 318 TYR OXT O N N 319 TYR H H N N 320 TYR H2 H N N 321 TYR HA H N N 322 TYR HB2 H N N 323 TYR HB3 H N N 324 TYR HD1 H N N 325 TYR HD2 H N N 326 TYR HE1 H N N 327 TYR HE2 H N N 328 TYR HH H N N 329 TYR HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31500601 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'rosetta model' # _atom_sites.entry_id 7DL8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014280 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011596 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004734 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_