data_7DLZ # _entry.id 7DLZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DLZ pdb_00007dlz 10.2210/pdb7dlz/pdb WWPDB D_1300019651 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DLZ _pdbx_database_status.recvd_initial_deposition_date 2020-11-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gan, J.H.' 1 ? 'Gao, Y.Q.' 2 ? 'Jiang, H.Y.' 3 ? 'Chen, D.R.' 4 ? 'Murchie, A.I.H.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Catal' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2520-1158 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 872 _citation.page_last 881 _citation.title 'The identification and characterization of a selected SAM-dependent methyltransferase ribozyme that is present in natural sequences' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41929-021-00685-z _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, H.Y.' 1 ? primary 'Gao, Y.Q.' 2 ? primary 'Zhang, L.' 3 ? primary 'Chen, D.R.' 4 ? primary 'Gan, J.H.' 5 ? primary 'Murchie, A.I.H.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 91.710 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7DLZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.784 _cell.length_a_esd ? _cell.length_b 80.176 _cell.length_b_esd ? _cell.length_c 103.296 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DLZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'U1 small nuclear ribonucleoprotein A' 11740.739 4 ? ? ? ? 2 polymer syn 'RNA (45-MER)' 14462.654 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name U1A # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK PMRIQYAKTDSDIIAKMKGTFV ; ;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK PMRIQYAKTDSDIIAKMKGTFV ; A,B,C,D ? 2 polyribonucleotide no no GGACCUACUACGAGCGCCAUUGCACUCCGGCGCCACGGGGGGUCC GGACCUACUACGAGCGCCAUUGCACUCCGGCGCCACGGGGGGUCC X,Y ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 VAL n 1 4 PRO n 1 5 GLU n 1 6 THR n 1 7 ARG n 1 8 PRO n 1 9 ASN n 1 10 HIS n 1 11 THR n 1 12 ILE n 1 13 TYR n 1 14 ILE n 1 15 ASN n 1 16 ASN n 1 17 LEU n 1 18 ASN n 1 19 GLU n 1 20 LYS n 1 21 ILE n 1 22 LYS n 1 23 LYS n 1 24 ASP n 1 25 GLU n 1 26 LEU n 1 27 LYS n 1 28 LYS n 1 29 SER n 1 30 LEU n 1 31 TYR n 1 32 ALA n 1 33 ILE n 1 34 PHE n 1 35 SER n 1 36 GLN n 1 37 PHE n 1 38 GLY n 1 39 GLN n 1 40 ILE n 1 41 LEU n 1 42 ASP n 1 43 ILE n 1 44 LEU n 1 45 VAL n 1 46 SER n 1 47 ARG n 1 48 SER n 1 49 LEU n 1 50 LYS n 1 51 MET n 1 52 ARG n 1 53 GLY n 1 54 GLN n 1 55 ALA n 1 56 PHE n 1 57 VAL n 1 58 ILE n 1 59 PHE n 1 60 LYS n 1 61 GLU n 1 62 VAL n 1 63 SER n 1 64 SER n 1 65 ALA n 1 66 THR n 1 67 ASN n 1 68 ALA n 1 69 LEU n 1 70 ARG n 1 71 SER n 1 72 MET n 1 73 GLN n 1 74 GLY n 1 75 PHE n 1 76 PRO n 1 77 PHE n 1 78 TYR n 1 79 ASP n 1 80 LYS n 1 81 PRO n 1 82 MET n 1 83 ARG n 1 84 ILE n 1 85 GLN n 1 86 TYR n 1 87 ALA n 1 88 LYS n 1 89 THR n 1 90 ASP n 1 91 SER n 1 92 ASP n 1 93 ILE n 1 94 ILE n 1 95 ALA n 1 96 LYS n 1 97 MET n 1 98 LYS n 1 99 GLY n 1 100 THR n 1 101 PHE n 1 102 VAL n 2 1 G n 2 2 G n 2 3 A n 2 4 C n 2 5 C n 2 6 U n 2 7 A n 2 8 C n 2 9 U n 2 10 A n 2 11 C n 2 12 G n 2 13 A n 2 14 G n 2 15 C n 2 16 G n 2 17 C n 2 18 C n 2 19 A n 2 20 U n 2 21 U n 2 22 G n 2 23 C n 2 24 A n 2 25 C n 2 26 U n 2 27 C n 2 28 C n 2 29 G n 2 30 G n 2 31 C n 2 32 G n 2 33 C n 2 34 C n 2 35 A n 2 36 C n 2 37 G n 2 38 G n 2 39 G n 2 40 G n 2 41 G n 2 42 G n 2 43 U n 2 44 C n 2 45 C n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 102 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SNRPA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 45 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SNRPA_HUMAN P09012 ? 1 ;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK PMRIQYAKTDSDIIAKMKGTFV ; 1 2 PDB 7DLZ 7DLZ ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7DLZ A 1 ? 102 ? P09012 1 ? 102 ? 1 102 2 1 7DLZ B 1 ? 102 ? P09012 1 ? 102 ? 1 102 3 1 7DLZ C 1 ? 102 ? P09012 1 ? 102 ? 1 102 4 1 7DLZ D 1 ? 102 ? P09012 1 ? 102 ? 1 102 5 2 7DLZ X 1 ? 45 ? 7DLZ 1 ? 45 ? 1 45 6 2 7DLZ Y 1 ? 45 ? 7DLZ 1 ? 45 ? 1 45 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DLZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'polyethylene glycol 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 51.680 _reflns.entry_id 7DLZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.000 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19768 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.300 _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.946 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.079 _reflns.pdbx_Rpim_I_all 0.034 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 84155 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 3.000 3.110 ? ? ? ? ? ? 1834 89.200 ? ? ? ? 0.343 ? ? ? ? ? ? ? ? 2.600 ? 0.786 ? ? 0.413 0.223 ? 1 1 0.640 ? ? 3.110 3.230 ? ? ? ? ? ? 1823 90.100 ? ? ? ? 0.272 ? ? ? ? ? ? ? ? 2.700 ? 0.789 ? ? 0.327 0.177 ? 2 1 0.912 ? ? 3.230 3.380 ? ? ? ? ? ? 1915 93.900 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 3.200 ? 0.858 ? ? 0.278 0.139 ? 3 1 0.934 ? ? 3.380 3.560 ? ? ? ? ? ? 1932 94.700 ? ? ? ? 0.228 ? ? ? ? ? ? ? ? 3.500 ? 0.926 ? ? 0.263 0.127 ? 4 1 0.952 ? ? 3.560 3.780 ? ? ? ? ? ? 1979 97.200 ? ? ? ? 0.189 ? ? ? ? ? ? ? ? 4.200 ? 1.051 ? ? 0.213 0.095 ? 5 1 0.967 ? ? 3.780 4.070 ? ? ? ? ? ? 2032 98.000 ? ? ? ? 0.120 ? ? ? ? ? ? ? ? 4.400 ? 1.014 ? ? 0.134 0.059 ? 6 1 0.992 ? ? 4.070 4.480 ? ? ? ? ? ? 2026 98.700 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 4.800 ? 1.105 ? ? 0.106 0.046 ? 7 1 0.995 ? ? 4.480 5.120 ? ? ? ? ? ? 2044 99.000 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 4.900 ? 1.033 ? ? 0.080 0.034 ? 8 1 0.996 ? ? 5.120 6.440 ? ? ? ? ? ? 2061 99.500 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 5.800 ? 0.937 ? ? 0.068 0.027 ? 9 1 0.996 ? ? 6.440 30.000 ? ? ? ? ? ? 2122 99.900 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 6.000 ? 0.803 ? ? 0.049 0.019 ? 10 1 0.998 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 160.940 _refine.B_iso_mean 66.7836 _refine.B_iso_min 17.520 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DLZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.0020 _refine.ls_d_res_low 29.7760 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16007 _refine.ls_number_reflns_R_free 757 _refine.ls_number_reflns_R_work 15250 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 77.4900 _refine.ls_percent_reflns_R_free 4.7300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2147 _refine.ls_R_factor_R_free 0.2663 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2121 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.520 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1URN _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.4500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.0020 _refine_hist.d_res_low 29.7760 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 4823 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 468 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2908 _refine_hist.pdbx_number_atoms_nucleic_acid 1915 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 5097 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.937 ? 7325 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.056 ? 907 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 602 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.868 ? 2869 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? X 1072 12.679 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? Y 1072 12.679 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 3 TORSIONAL ? A 1464 12.679 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 4 TORSIONAL ? B 1464 12.679 ? 2 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 5 TORSIONAL ? C 1464 12.679 ? 2 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 6 TORSIONAL ? D 1464 12.679 ? 2 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0023 3.2338 . . 48 1175 30.0000 . . . 0.3618 0.0000 0.2659 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2338 3.5588 . . 130 2522 65.0000 . . . 0.3141 0.0000 0.2440 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5588 4.0727 . . 206 3648 94.0000 . . . 0.2719 0.0000 0.2201 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0727 5.1269 . . 168 3924 99.0000 . . . 0.2536 0.0000 0.1958 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.1269 29.7760 . . 205 3981 100.0000 . . . 0.2458 0.0000 0.2024 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 2 'chain Y' 2 1 ;(chain A and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 2 ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 94)) ; 2 3 ;(chain C and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 50 or (resid 51 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 4 ;(chain D and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 E G 1 . E G 1 . X G 1 X G 1 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 2 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 3 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 4 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 5 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 6 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 7 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 8 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 9 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 10 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 11 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 12 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 13 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 14 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 15 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 16 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 17 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 18 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 19 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 1 20 E G 1 . E C 45 . X G 1 X C 45 ? ;(chain X and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name O2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 2 through 45)) ; 1 2 1 F G 1 . F C 45 . Y G 1 Y C 45 ? 'chain Y' 2 1 1 A PRO 8 . A PRO 8 . A PRO 8 A PRO 8 ? ;(chain A and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 1 2 A ASN 9 . A HIS 10 . A ASN 9 A HIS 10 ? ;(chain A and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 1 3 A GLU 5 . A THR 100 . A GLU 5 A THR 100 ? ;(chain A and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 1 4 A GLU 5 . A THR 100 . A GLU 5 A THR 100 ? ;(chain A and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 1 5 A GLU 5 . A THR 100 . A GLU 5 A THR 100 ? ;(chain A and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 1 6 A GLU 5 . A THR 100 . A GLU 5 A THR 100 ? ;(chain A and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 2 1 B PRO 8 . B ILE 21 . B PRO 8 B ILE 21 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 94)) ; 2 2 2 B LYS 22 . B LYS 23 . B LYS 22 B LYS 23 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 94)) ; 2 2 3 B PRO 8 . B ILE 94 . B PRO 8 B ILE 94 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 94)) ; 2 2 4 B PRO 8 . B ILE 94 . B PRO 8 B ILE 94 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 94)) ; 2 2 5 B PRO 8 . B ILE 94 . B PRO 8 B ILE 94 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 94)) ; 2 2 6 B PRO 8 . B ILE 94 . B PRO 8 B ILE 94 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 94)) ; 2 3 1 C PRO 8 . C PRO 8 . C PRO 8 C PRO 8 ? ;(chain C and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 50 or (resid 51 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 3 2 C ASN 9 . C HIS 10 . C ASN 9 C HIS 10 ? ;(chain C and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 50 or (resid 51 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 3 3 C THR 6 . C VAL 102 . C THR 6 C VAL 102 ? ;(chain C and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 50 or (resid 51 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 3 4 C THR 6 . C VAL 102 . C THR 6 C VAL 102 ? ;(chain C and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 50 or (resid 51 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 3 5 C THR 6 . C VAL 102 . C THR 6 C VAL 102 ? ;(chain C and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 50 or (resid 51 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 3 6 C THR 6 . C VAL 102 . C THR 6 C VAL 102 ? ;(chain C and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 50 or (resid 51 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 4 1 D PRO 8 . D PRO 8 . D PRO 8 D PRO 8 ? ;(chain D and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 4 2 D ASN 9 . D HIS 10 . D ASN 9 D HIS 10 ? ;(chain D and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 4 3 D GLU 5 . D VAL 102 . D GLU 5 D VAL 102 ? ;(chain D and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 4 4 D GLU 5 . D VAL 102 . D GLU 5 D VAL 102 ? ;(chain D and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 4 5 D GLU 5 . D VAL 102 . D GLU 5 D VAL 102 ? ;(chain D and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; 2 4 6 D GLU 5 . D VAL 102 . D GLU 5 D VAL 102 ? ;(chain D and (resid 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 18 or (resid 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 through 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 59 or (resid 60 through 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 94)) ; # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 7DLZ _struct.title 'Crystal Structure of Methyltransferase Ribozyme' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DLZ _struct_keywords.text 'RNA, Methyltransferase, TRANSFERASE-RNA complex' _struct_keywords.pdbx_keywords TRANSFERASE/RNA # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 22 ? SER A 35 ? LYS A 22 SER A 35 1 ? 14 HELX_P HELX_P2 AA2 GLU A 61 ? GLN A 73 ? GLU A 61 GLN A 73 1 ? 13 HELX_P HELX_P3 AA3 ILE A 93 ? MET A 97 ? ILE A 93 MET A 97 5 ? 5 HELX_P HELX_P4 AA4 LYS B 22 ? SER B 35 ? LYS B 22 SER B 35 1 ? 14 HELX_P HELX_P5 AA5 GLN B 36 ? GLY B 38 ? GLN B 36 GLY B 38 5 ? 3 HELX_P HELX_P6 AA6 GLU B 61 ? MET B 72 ? GLU B 61 MET B 72 1 ? 12 HELX_P HELX_P7 AA7 LYS C 22 ? SER C 35 ? LYS C 22 SER C 35 1 ? 14 HELX_P HELX_P8 AA8 GLN C 36 ? GLY C 38 ? GLN C 36 GLY C 38 5 ? 3 HELX_P HELX_P9 AA9 GLU C 61 ? MET C 72 ? GLU C 61 MET C 72 1 ? 12 HELX_P HELX_P10 AB1 ASP C 90 ? MET C 97 ? ASP C 90 MET C 97 1 ? 8 HELX_P HELX_P11 AB2 LYS D 22 ? SER D 35 ? LYS D 22 SER D 35 1 ? 14 HELX_P HELX_P12 AB3 GLU D 61 ? MET D 72 ? GLU D 61 MET D 72 1 ? 12 HELX_P HELX_P13 AB4 ASP D 90 ? LYS D 98 ? ASP D 90 LYS D 98 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role hydrog1 hydrog ? ? E G 1 O6 ? ? ? 1_555 E C 45 N4 ? ? X G 1 X C 45 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? ? hydrog2 hydrog ? ? E G 2 O6 ? ? ? 1_555 E C 44 N4 ? ? X G 2 X C 44 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? ? hydrog3 hydrog ? ? E A 3 N1 ? ? ? 1_555 E U 43 N3 ? ? X A 3 X U 43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? E A 3 N6 ? ? ? 1_555 E U 43 O4 ? ? X A 3 X U 43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? E C 4 N3 ? ? ? 1_555 E G 42 N1 ? ? X C 4 X G 42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? E C 4 N4 ? ? ? 1_555 E G 42 O6 ? ? X C 4 X G 42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? E C 4 O2 ? ? ? 1_555 E G 42 N2 ? ? X C 4 X G 42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? E C 5 N3 ? ? ? 1_555 E G 41 N1 ? ? X C 5 X G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? E C 5 N4 ? ? ? 1_555 E G 41 O6 ? ? X C 5 X G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? E C 5 O2 ? ? ? 1_555 E G 41 N2 ? ? X C 5 X G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? E U 6 N3 ? ? ? 1_555 E G 40 O6 ? ? X U 6 X G 40 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog12 hydrog ? ? E U 6 O2 ? ? ? 1_555 E G 40 N1 ? ? X U 6 X G 40 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog13 hydrog ? ? E C 8 N3 ? ? ? 1_555 E G 39 N1 ? ? X C 8 X G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? E C 8 N4 ? ? ? 1_555 E G 39 O6 ? ? X C 8 X G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? E C 8 O2 ? ? ? 1_555 E G 39 N2 ? ? X C 8 X G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? E U 9 N3 ? ? ? 1_555 E G 38 O6 ? ? X U 9 X G 38 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog17 hydrog ? ? E U 9 O2 ? ? ? 1_555 E G 38 N1 ? ? X U 9 X G 38 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog18 hydrog ? ? E A 10 N7 ? ? ? 1_555 E C 36 N4 ? ? X A 10 X C 36 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? ? hydrog19 hydrog ? ? E C 11 N4 ? ? ? 1_555 E A 35 N7 ? ? X C 11 X A 35 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? ? hydrog20 hydrog ? ? E C 11 N3 ? ? ? 1_555 E G 37 N2 ? ? X C 11 X G 37 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? hydrog21 hydrog ? ? E C 11 O2 ? ? ? 1_555 E G 37 N1 ? ? X C 11 X G 37 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? hydrog22 hydrog ? ? E G 12 O6 ? ? ? 1_555 E C 36 N4 ? ? X G 12 X C 36 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? ? hydrog23 hydrog ? ? E A 13 N6 ? ? ? 1_555 E C 34 O2 ? ? X A 13 X C 34 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? ? hydrog24 hydrog ? ? E G 14 N1 ? ? ? 1_555 E C 33 N3 ? ? X G 14 X C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? E G 14 N2 ? ? ? 1_555 E C 33 O2 ? ? X G 14 X C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? E G 14 O6 ? ? ? 1_555 E C 33 N4 ? ? X G 14 X C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? E C 15 N3 ? ? ? 1_555 E G 32 N1 ? ? X C 15 X G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? E C 15 N4 ? ? ? 1_555 E G 32 O6 ? ? X C 15 X G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? E C 15 O2 ? ? ? 1_555 E G 32 N2 ? ? X C 15 X G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog30 hydrog ? ? E G 16 N1 ? ? ? 1_555 E C 31 N3 ? ? X G 16 X C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog31 hydrog ? ? E G 16 N2 ? ? ? 1_555 E C 31 O2 ? ? X G 16 X C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? E G 16 O6 ? ? ? 1_555 E C 31 N4 ? ? X G 16 X C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog33 hydrog ? ? E C 17 N3 ? ? ? 1_555 E G 30 N1 ? ? X C 17 X G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog34 hydrog ? ? E C 17 N4 ? ? ? 1_555 E G 30 O6 ? ? X C 17 X G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog35 hydrog ? ? E C 17 O2 ? ? ? 1_555 E G 30 N2 ? ? X C 17 X G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog36 hydrog ? ? E C 18 N3 ? ? ? 1_555 E G 29 N1 ? ? X C 18 X G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog37 hydrog ? ? E C 18 N4 ? ? ? 1_555 E G 29 O6 ? ? X C 18 X G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog38 hydrog ? ? E C 18 O2 ? ? ? 1_555 E G 29 N2 ? ? X C 18 X G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog39 hydrog ? ? F G 1 N1 ? ? ? 1_555 F C 45 N3 ? ? Y G 1 Y C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog40 hydrog ? ? F G 1 N2 ? ? ? 1_555 F C 45 O2 ? ? Y G 1 Y C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog41 hydrog ? ? F G 1 O6 ? ? ? 1_555 F C 45 N4 ? ? Y G 1 Y C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog42 hydrog ? ? F G 2 N1 ? ? ? 1_555 F C 44 N3 ? ? Y G 2 Y C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog43 hydrog ? ? F G 2 N2 ? ? ? 1_555 F C 44 O2 ? ? Y G 2 Y C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog44 hydrog ? ? F G 2 O6 ? ? ? 1_555 F C 44 N4 ? ? Y G 2 Y C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog45 hydrog ? ? F A 3 N1 ? ? ? 1_555 F U 43 N3 ? ? Y A 3 Y U 43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog46 hydrog ? ? F A 3 N6 ? ? ? 1_555 F U 43 O4 ? ? Y A 3 Y U 43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog47 hydrog ? ? F C 4 N3 ? ? ? 1_555 F G 42 N1 ? ? Y C 4 Y G 42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog48 hydrog ? ? F C 4 N4 ? ? ? 1_555 F G 42 O6 ? ? Y C 4 Y G 42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog49 hydrog ? ? F C 4 O2 ? ? ? 1_555 F G 42 N2 ? ? Y C 4 Y G 42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog50 hydrog ? ? F C 5 N3 ? ? ? 1_555 F G 41 N1 ? ? Y C 5 Y G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog51 hydrog ? ? F C 5 N4 ? ? ? 1_555 F G 41 O6 ? ? Y C 5 Y G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog52 hydrog ? ? F C 5 O2 ? ? ? 1_555 F G 41 N2 ? ? Y C 5 Y G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog53 hydrog ? ? F U 6 N3 ? ? ? 1_555 F G 40 O6 ? ? Y U 6 Y G 40 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog54 hydrog ? ? F U 6 O2 ? ? ? 1_555 F G 40 N1 ? ? Y U 6 Y G 40 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog55 hydrog ? ? F C 8 N3 ? ? ? 1_555 F G 39 N1 ? ? Y C 8 Y G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog56 hydrog ? ? F C 8 N4 ? ? ? 1_555 F G 39 O6 ? ? Y C 8 Y G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog57 hydrog ? ? F C 8 O2 ? ? ? 1_555 F G 39 N2 ? ? Y C 8 Y G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog58 hydrog ? ? F U 9 N3 ? ? ? 1_555 F G 38 O6 ? ? Y U 9 Y G 38 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog59 hydrog ? ? F U 9 O2 ? ? ? 1_555 F G 38 N1 ? ? Y U 9 Y G 38 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog60 hydrog ? ? F C 11 N4 ? ? ? 1_555 F A 35 N7 ? ? Y C 11 Y A 35 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? ? hydrog61 hydrog ? ? F C 11 N4 ? ? ? 1_555 F G 37 O6 ? ? Y C 11 Y G 37 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? ? hydrog62 hydrog ? ? F G 12 N1 ? ? ? 1_555 F C 36 O2 ? ? Y G 12 Y C 36 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? hydrog63 hydrog ? ? F G 12 N2 ? ? ? 1_555 F C 36 N3 ? ? Y G 12 Y C 36 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? hydrog64 hydrog ? ? F A 13 N6 ? ? ? 1_555 F C 34 N3 ? ? Y A 13 Y C 34 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? ? hydrog65 hydrog ? ? F G 14 N1 ? ? ? 1_555 F C 33 N3 ? ? Y G 14 Y C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog66 hydrog ? ? F G 14 N2 ? ? ? 1_555 F C 33 O2 ? ? Y G 14 Y C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog67 hydrog ? ? F G 14 O6 ? ? ? 1_555 F C 33 N4 ? ? Y G 14 Y C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog68 hydrog ? ? F C 15 N3 ? ? ? 1_555 F G 32 N1 ? ? Y C 15 Y G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog69 hydrog ? ? F C 15 N4 ? ? ? 1_555 F G 32 O6 ? ? Y C 15 Y G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog70 hydrog ? ? F C 15 O2 ? ? ? 1_555 F G 32 N2 ? ? Y C 15 Y G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog71 hydrog ? ? F G 16 O6 ? ? ? 1_555 F C 31 N4 ? ? Y G 16 Y C 31 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? ? hydrog72 hydrog ? ? F C 17 N3 ? ? ? 1_555 F G 30 N1 ? ? Y C 17 Y G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog73 hydrog ? ? F C 17 N4 ? ? ? 1_555 F G 30 O6 ? ? Y C 17 Y G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog74 hydrog ? ? F C 17 O2 ? ? ? 1_555 F G 30 N2 ? ? Y C 17 Y G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog75 hydrog ? ? F C 18 N3 ? ? ? 1_555 F G 29 N1 ? ? Y C 18 Y G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog76 hydrog ? ? F C 18 N4 ? ? ? 1_555 F G 29 O6 ? ? Y C 18 Y G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog77 hydrog ? ? F C 18 O2 ? ? ? 1_555 F G 29 N2 ? ? Y C 18 Y G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? # _struct_conn_type.id hydrog _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 5 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 40 ? LEU A 44 ? ILE A 40 LEU A 44 AA1 2 ALA A 55 ? PHE A 59 ? ALA A 55 PHE A 59 AA1 3 THR A 11 ? ASN A 15 ? THR A 11 ASN A 15 AA1 4 ARG A 83 ? TYR A 86 ? ARG A 83 TYR A 86 AA2 1 ILE B 40 ? LEU B 44 ? ILE B 40 LEU B 44 AA2 2 ALA B 55 ? PHE B 59 ? ALA B 55 PHE B 59 AA2 3 THR B 11 ? ASN B 15 ? THR B 11 ASN B 15 AA2 4 ARG B 83 ? TYR B 86 ? ARG B 83 TYR B 86 AA3 1 ILE C 40 ? VAL C 45 ? ILE C 40 VAL C 45 AA3 2 GLN C 54 ? PHE C 59 ? GLN C 54 PHE C 59 AA3 3 THR C 11 ? ASN C 15 ? THR C 11 ASN C 15 AA3 4 ARG C 83 ? TYR C 86 ? ARG C 83 TYR C 86 AA4 1 ARG D 83 ? TYR D 86 ? ARG D 83 TYR D 86 AA4 2 THR D 11 ? ASN D 15 ? THR D 11 ASN D 15 AA4 3 ALA D 55 ? PHE D 59 ? ALA D 55 PHE D 59 AA4 4 ILE D 40 ? SER D 46 ? ILE D 40 SER D 46 AA4 5 PHE D 101 ? VAL D 102 ? PHE D 101 VAL D 102 AA5 1 PRO D 76 ? PHE D 77 ? PRO D 76 PHE D 77 AA5 2 LYS D 80 ? PRO D 81 ? LYS D 80 PRO D 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 41 ? N LEU A 41 O ILE A 58 ? O ILE A 58 AA1 2 3 O VAL A 57 ? O VAL A 57 N ILE A 12 ? N ILE A 12 AA1 3 4 N TYR A 13 ? N TYR A 13 O GLN A 85 ? O GLN A 85 AA2 1 2 N LEU B 41 ? N LEU B 41 O ILE B 58 ? O ILE B 58 AA2 2 3 O ALA B 55 ? O ALA B 55 N ILE B 14 ? N ILE B 14 AA2 3 4 N TYR B 13 ? N TYR B 13 O GLN B 85 ? O GLN B 85 AA3 1 2 N LEU C 41 ? N LEU C 41 O ILE C 58 ? O ILE C 58 AA3 2 3 O VAL C 57 ? O VAL C 57 N ILE C 12 ? N ILE C 12 AA3 3 4 N ASN C 15 ? N ASN C 15 O ARG C 83 ? O ARG C 83 AA4 1 2 O GLN D 85 ? O GLN D 85 N TYR D 13 ? N TYR D 13 AA4 2 3 N ILE D 14 ? N ILE D 14 O ALA D 55 ? O ALA D 55 AA4 3 4 O ILE D 58 ? O ILE D 58 N LEU D 41 ? N LEU D 41 AA4 4 5 N VAL D 45 ? N VAL D 45 O VAL D 102 ? O VAL D 102 AA5 1 2 N PHE D 77 ? N PHE D 77 O LYS D 80 ? O LYS D 80 # _atom_sites.entry_id 7DLZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015928 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000475 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012473 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009685 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 PHE 101 101 ? ? ? A . n A 1 102 VAL 102 102 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ALA 2 2 ? ? ? B . n B 1 3 VAL 3 3 ? ? ? B . n B 1 4 PRO 4 4 ? ? ? B . n B 1 5 GLU 5 5 ? ? ? B . n B 1 6 THR 6 6 ? ? ? B . n B 1 7 ARG 7 7 ? ? ? B . n B 1 8 PRO 8 8 8 PRO PRO B . n B 1 9 ASN 9 9 9 ASN ASN B . n B 1 10 HIS 10 10 10 HIS HIS B . n B 1 11 THR 11 11 11 THR THR B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 TYR 13 13 13 TYR TYR B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 ASN 15 15 15 ASN ASN B . n B 1 16 ASN 16 16 16 ASN ASN B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 ASN 18 18 18 ASN ASN B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 ILE 21 21 21 ILE ILE B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 ASP 24 24 24 ASP ASP B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 SER 29 29 29 SER SER B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 TYR 31 31 31 TYR TYR B . n B 1 32 ALA 32 32 32 ALA ALA B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 GLN 36 36 36 GLN GLN B . n B 1 37 PHE 37 37 37 PHE PHE B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 GLN 39 39 39 GLN GLN B . n B 1 40 ILE 40 40 40 ILE ILE B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 ASP 42 42 42 ASP ASP B . n B 1 43 ILE 43 43 43 ILE ILE B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 SER 46 46 46 SER SER B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 SER 48 48 48 SER SER B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 MET 51 51 51 MET MET B . n B 1 52 ARG 52 52 52 ARG ARG B . n B 1 53 GLY 53 53 53 GLY GLY B . n B 1 54 GLN 54 54 54 GLN GLN B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 PHE 56 56 56 PHE PHE B . n B 1 57 VAL 57 57 57 VAL VAL B . n B 1 58 ILE 58 58 58 ILE ILE B . n B 1 59 PHE 59 59 59 PHE PHE B . n B 1 60 LYS 60 60 60 LYS LYS B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 VAL 62 62 62 VAL VAL B . n B 1 63 SER 63 63 63 SER SER B . n B 1 64 SER 64 64 64 SER SER B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 THR 66 66 66 THR THR B . n B 1 67 ASN 67 67 67 ASN ASN B . n B 1 68 ALA 68 68 68 ALA ALA B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 ARG 70 70 70 ARG ARG B . n B 1 71 SER 71 71 71 SER SER B . n B 1 72 MET 72 72 72 MET MET B . n B 1 73 GLN 73 73 73 GLN GLN B . n B 1 74 GLY 74 74 74 GLY GLY B . n B 1 75 PHE 75 75 75 PHE PHE B . n B 1 76 PRO 76 76 76 PRO PRO B . n B 1 77 PHE 77 77 77 PHE PHE B . n B 1 78 TYR 78 78 78 TYR TYR B . n B 1 79 ASP 79 79 79 ASP ASP B . n B 1 80 LYS 80 80 80 LYS LYS B . n B 1 81 PRO 81 81 81 PRO PRO B . n B 1 82 MET 82 82 82 MET MET B . n B 1 83 ARG 83 83 83 ARG ARG B . n B 1 84 ILE 84 84 84 ILE ILE B . n B 1 85 GLN 85 85 85 GLN GLN B . n B 1 86 TYR 86 86 86 TYR TYR B . n B 1 87 ALA 87 87 87 ALA ALA B . n B 1 88 LYS 88 88 88 LYS LYS B . n B 1 89 THR 89 89 89 THR THR B . n B 1 90 ASP 90 90 90 ASP ASP B . n B 1 91 SER 91 91 91 SER SER B . n B 1 92 ASP 92 92 92 ASP ASP B . n B 1 93 ILE 93 93 93 ILE ILE B . n B 1 94 ILE 94 94 94 ILE ILE B . n B 1 95 ALA 95 95 ? ? ? B . n B 1 96 LYS 96 96 ? ? ? B . n B 1 97 MET 97 97 ? ? ? B . n B 1 98 LYS 98 98 ? ? ? B . n B 1 99 GLY 99 99 ? ? ? B . n B 1 100 THR 100 100 ? ? ? B . n B 1 101 PHE 101 101 ? ? ? B . n B 1 102 VAL 102 102 ? ? ? B . n C 1 1 MET 1 1 ? ? ? C . n C 1 2 ALA 2 2 ? ? ? C . n C 1 3 VAL 3 3 ? ? ? C . n C 1 4 PRO 4 4 ? ? ? C . n C 1 5 GLU 5 5 ? ? ? C . n C 1 6 THR 6 6 6 THR THR C . n C 1 7 ARG 7 7 7 ARG ARG C . n C 1 8 PRO 8 8 8 PRO PRO C . n C 1 9 ASN 9 9 9 ASN ASN C . n C 1 10 HIS 10 10 10 HIS HIS C . n C 1 11 THR 11 11 11 THR THR C . n C 1 12 ILE 12 12 12 ILE ILE C . n C 1 13 TYR 13 13 13 TYR TYR C . n C 1 14 ILE 14 14 14 ILE ILE C . n C 1 15 ASN 15 15 15 ASN ASN C . n C 1 16 ASN 16 16 16 ASN ASN C . n C 1 17 LEU 17 17 17 LEU LEU C . n C 1 18 ASN 18 18 18 ASN ASN C . n C 1 19 GLU 19 19 19 GLU GLU C . n C 1 20 LYS 20 20 20 LYS LYS C . n C 1 21 ILE 21 21 21 ILE ILE C . n C 1 22 LYS 22 22 22 LYS LYS C . n C 1 23 LYS 23 23 23 LYS LYS C . n C 1 24 ASP 24 24 24 ASP ASP C . n C 1 25 GLU 25 25 25 GLU GLU C . n C 1 26 LEU 26 26 26 LEU LEU C . n C 1 27 LYS 27 27 27 LYS LYS C . n C 1 28 LYS 28 28 28 LYS LYS C . n C 1 29 SER 29 29 29 SER SER C . n C 1 30 LEU 30 30 30 LEU LEU C . n C 1 31 TYR 31 31 31 TYR TYR C . n C 1 32 ALA 32 32 32 ALA ALA C . n C 1 33 ILE 33 33 33 ILE ILE C . n C 1 34 PHE 34 34 34 PHE PHE C . n C 1 35 SER 35 35 35 SER SER C . n C 1 36 GLN 36 36 36 GLN GLN C . n C 1 37 PHE 37 37 37 PHE PHE C . n C 1 38 GLY 38 38 38 GLY GLY C . n C 1 39 GLN 39 39 39 GLN GLN C . n C 1 40 ILE 40 40 40 ILE ILE C . n C 1 41 LEU 41 41 41 LEU LEU C . n C 1 42 ASP 42 42 42 ASP ASP C . n C 1 43 ILE 43 43 43 ILE ILE C . n C 1 44 LEU 44 44 44 LEU LEU C . n C 1 45 VAL 45 45 45 VAL VAL C . n C 1 46 SER 46 46 46 SER SER C . n C 1 47 ARG 47 47 47 ARG ARG C . n C 1 48 SER 48 48 48 SER SER C . n C 1 49 LEU 49 49 49 LEU LEU C . n C 1 50 LYS 50 50 50 LYS LYS C . n C 1 51 MET 51 51 51 MET MET C . n C 1 52 ARG 52 52 52 ARG ARG C . n C 1 53 GLY 53 53 53 GLY GLY C . n C 1 54 GLN 54 54 54 GLN GLN C . n C 1 55 ALA 55 55 55 ALA ALA C . n C 1 56 PHE 56 56 56 PHE PHE C . n C 1 57 VAL 57 57 57 VAL VAL C . n C 1 58 ILE 58 58 58 ILE ILE C . n C 1 59 PHE 59 59 59 PHE PHE C . n C 1 60 LYS 60 60 60 LYS LYS C . n C 1 61 GLU 61 61 61 GLU GLU C . n C 1 62 VAL 62 62 62 VAL VAL C . n C 1 63 SER 63 63 63 SER SER C . n C 1 64 SER 64 64 64 SER SER C . n C 1 65 ALA 65 65 65 ALA ALA C . n C 1 66 THR 66 66 66 THR THR C . n C 1 67 ASN 67 67 67 ASN ASN C . n C 1 68 ALA 68 68 68 ALA ALA C . n C 1 69 LEU 69 69 69 LEU LEU C . n C 1 70 ARG 70 70 70 ARG ARG C . n C 1 71 SER 71 71 71 SER SER C . n C 1 72 MET 72 72 72 MET MET C . n C 1 73 GLN 73 73 73 GLN GLN C . n C 1 74 GLY 74 74 74 GLY GLY C . n C 1 75 PHE 75 75 75 PHE PHE C . n C 1 76 PRO 76 76 76 PRO PRO C . n C 1 77 PHE 77 77 77 PHE PHE C . n C 1 78 TYR 78 78 78 TYR TYR C . n C 1 79 ASP 79 79 79 ASP ASP C . n C 1 80 LYS 80 80 80 LYS LYS C . n C 1 81 PRO 81 81 81 PRO PRO C . n C 1 82 MET 82 82 82 MET MET C . n C 1 83 ARG 83 83 83 ARG ARG C . n C 1 84 ILE 84 84 84 ILE ILE C . n C 1 85 GLN 85 85 85 GLN GLN C . n C 1 86 TYR 86 86 86 TYR TYR C . n C 1 87 ALA 87 87 87 ALA ALA C . n C 1 88 LYS 88 88 88 LYS LYS C . n C 1 89 THR 89 89 89 THR THR C . n C 1 90 ASP 90 90 90 ASP ASP C . n C 1 91 SER 91 91 91 SER SER C . n C 1 92 ASP 92 92 92 ASP ASP C . n C 1 93 ILE 93 93 93 ILE ILE C . n C 1 94 ILE 94 94 94 ILE ILE C . n C 1 95 ALA 95 95 95 ALA ALA C . n C 1 96 LYS 96 96 96 LYS LYS C . n C 1 97 MET 97 97 97 MET MET C . n C 1 98 LYS 98 98 98 LYS LYS C . n C 1 99 GLY 99 99 99 GLY GLY C . n C 1 100 THR 100 100 100 THR THR C . n C 1 101 PHE 101 101 101 PHE PHE C . n C 1 102 VAL 102 102 102 VAL VAL C . n D 1 1 MET 1 1 ? ? ? D . n D 1 2 ALA 2 2 ? ? ? D . n D 1 3 VAL 3 3 ? ? ? D . n D 1 4 PRO 4 4 ? ? ? D . n D 1 5 GLU 5 5 5 GLU GLU D . n D 1 6 THR 6 6 6 THR THR D . n D 1 7 ARG 7 7 7 ARG ARG D . n D 1 8 PRO 8 8 8 PRO PRO D . n D 1 9 ASN 9 9 9 ASN ASN D . n D 1 10 HIS 10 10 10 HIS HIS D . n D 1 11 THR 11 11 11 THR THR D . n D 1 12 ILE 12 12 12 ILE ILE D . n D 1 13 TYR 13 13 13 TYR TYR D . n D 1 14 ILE 14 14 14 ILE ILE D . n D 1 15 ASN 15 15 15 ASN ASN D . n D 1 16 ASN 16 16 16 ASN ASN D . n D 1 17 LEU 17 17 17 LEU LEU D . n D 1 18 ASN 18 18 18 ASN ASN D . n D 1 19 GLU 19 19 19 GLU GLU D . n D 1 20 LYS 20 20 20 LYS LYS D . n D 1 21 ILE 21 21 21 ILE ILE D . n D 1 22 LYS 22 22 22 LYS LYS D . n D 1 23 LYS 23 23 23 LYS LYS D . n D 1 24 ASP 24 24 24 ASP ASP D . n D 1 25 GLU 25 25 25 GLU GLU D . n D 1 26 LEU 26 26 26 LEU LEU D . n D 1 27 LYS 27 27 27 LYS LYS D . n D 1 28 LYS 28 28 28 LYS LYS D . n D 1 29 SER 29 29 29 SER SER D . n D 1 30 LEU 30 30 30 LEU LEU D . n D 1 31 TYR 31 31 31 TYR TYR D . n D 1 32 ALA 32 32 32 ALA ALA D . n D 1 33 ILE 33 33 33 ILE ILE D . n D 1 34 PHE 34 34 34 PHE PHE D . n D 1 35 SER 35 35 35 SER SER D . n D 1 36 GLN 36 36 36 GLN GLN D . n D 1 37 PHE 37 37 37 PHE PHE D . n D 1 38 GLY 38 38 38 GLY GLY D . n D 1 39 GLN 39 39 39 GLN GLN D . n D 1 40 ILE 40 40 40 ILE ILE D . n D 1 41 LEU 41 41 41 LEU LEU D . n D 1 42 ASP 42 42 42 ASP ASP D . n D 1 43 ILE 43 43 43 ILE ILE D . n D 1 44 LEU 44 44 44 LEU LEU D . n D 1 45 VAL 45 45 45 VAL VAL D . n D 1 46 SER 46 46 46 SER SER D . n D 1 47 ARG 47 47 47 ARG ARG D . n D 1 48 SER 48 48 48 SER SER D . n D 1 49 LEU 49 49 49 LEU LEU D . n D 1 50 LYS 50 50 50 LYS LYS D . n D 1 51 MET 51 51 51 MET MET D . n D 1 52 ARG 52 52 52 ARG ARG D . n D 1 53 GLY 53 53 53 GLY GLY D . n D 1 54 GLN 54 54 54 GLN GLN D . n D 1 55 ALA 55 55 55 ALA ALA D . n D 1 56 PHE 56 56 56 PHE PHE D . n D 1 57 VAL 57 57 57 VAL VAL D . n D 1 58 ILE 58 58 58 ILE ILE D . n D 1 59 PHE 59 59 59 PHE PHE D . n D 1 60 LYS 60 60 60 LYS LYS D . n D 1 61 GLU 61 61 61 GLU GLU D . n D 1 62 VAL 62 62 62 VAL VAL D . n D 1 63 SER 63 63 63 SER SER D . n D 1 64 SER 64 64 64 SER SER D . n D 1 65 ALA 65 65 65 ALA ALA D . n D 1 66 THR 66 66 66 THR THR D . n D 1 67 ASN 67 67 67 ASN ASN D . n D 1 68 ALA 68 68 68 ALA ALA D . n D 1 69 LEU 69 69 69 LEU LEU D . n D 1 70 ARG 70 70 70 ARG ARG D . n D 1 71 SER 71 71 71 SER SER D . n D 1 72 MET 72 72 72 MET MET D . n D 1 73 GLN 73 73 73 GLN GLN D . n D 1 74 GLY 74 74 74 GLY GLY D . n D 1 75 PHE 75 75 75 PHE PHE D . n D 1 76 PRO 76 76 76 PRO PRO D . n D 1 77 PHE 77 77 77 PHE PHE D . n D 1 78 TYR 78 78 78 TYR TYR D . n D 1 79 ASP 79 79 79 ASP ASP D . n D 1 80 LYS 80 80 80 LYS LYS D . n D 1 81 PRO 81 81 81 PRO PRO D . n D 1 82 MET 82 82 82 MET MET D . n D 1 83 ARG 83 83 83 ARG ARG D . n D 1 84 ILE 84 84 84 ILE ILE D . n D 1 85 GLN 85 85 85 GLN GLN D . n D 1 86 TYR 86 86 86 TYR TYR D . n D 1 87 ALA 87 87 87 ALA ALA D . n D 1 88 LYS 88 88 88 LYS LYS D . n D 1 89 THR 89 89 89 THR THR D . n D 1 90 ASP 90 90 90 ASP ASP D . n D 1 91 SER 91 91 91 SER SER D . n D 1 92 ASP 92 92 92 ASP ASP D . n D 1 93 ILE 93 93 93 ILE ILE D . n D 1 94 ILE 94 94 94 ILE ILE D . n D 1 95 ALA 95 95 95 ALA ALA D . n D 1 96 LYS 96 96 96 LYS LYS D . n D 1 97 MET 97 97 97 MET MET D . n D 1 98 LYS 98 98 98 LYS LYS D . n D 1 99 GLY 99 99 99 GLY GLY D . n D 1 100 THR 100 100 100 THR THR D . n D 1 101 PHE 101 101 101 PHE PHE D . n D 1 102 VAL 102 102 102 VAL VAL D . n E 2 1 G 1 1 1 G G X . n E 2 2 G 2 2 2 G G X . n E 2 3 A 3 3 3 A A X . n E 2 4 C 4 4 4 C C X . n E 2 5 C 5 5 5 C C X . n E 2 6 U 6 6 6 U U X . n E 2 7 A 7 7 7 A A X . n E 2 8 C 8 8 8 C C X . n E 2 9 U 9 9 9 U U X . n E 2 10 A 10 10 10 A A X . n E 2 11 C 11 11 11 C C X . n E 2 12 G 12 12 12 G G X . n E 2 13 A 13 13 13 A A X . n E 2 14 G 14 14 14 G G X . n E 2 15 C 15 15 15 C C X . n E 2 16 G 16 16 16 G G X . n E 2 17 C 17 17 17 C C X . n E 2 18 C 18 18 18 C C X . n E 2 19 A 19 19 19 A A X . n E 2 20 U 20 20 20 U U X . n E 2 21 U 21 21 21 U U X . n E 2 22 G 22 22 22 G G X . n E 2 23 C 23 23 23 C C X . n E 2 24 A 24 24 24 A A X . n E 2 25 C 25 25 25 C C X . n E 2 26 U 26 26 26 U U X . n E 2 27 C 27 27 27 C C X . n E 2 28 C 28 28 28 C C X . n E 2 29 G 29 29 29 G G X . n E 2 30 G 30 30 30 G G X . n E 2 31 C 31 31 31 C C X . n E 2 32 G 32 32 32 G G X . n E 2 33 C 33 33 33 C C X . n E 2 34 C 34 34 34 C C X . n E 2 35 A 35 35 35 A A X . n E 2 36 C 36 36 36 C C X . n E 2 37 G 37 37 37 G G X . n E 2 38 G 38 38 38 G G X . n E 2 39 G 39 39 39 G G X . n E 2 40 G 40 40 40 G G X . n E 2 41 G 41 41 41 G G X . n E 2 42 G 42 42 42 G G X . n E 2 43 U 43 43 43 U U X . n E 2 44 C 44 44 44 C C X . n E 2 45 C 45 45 45 C C X . n F 2 1 G 1 1 1 G G Y . n F 2 2 G 2 2 2 G G Y . n F 2 3 A 3 3 3 A A Y . n F 2 4 C 4 4 4 C C Y . n F 2 5 C 5 5 5 C C Y . n F 2 6 U 6 6 6 U U Y . n F 2 7 A 7 7 7 A A Y . n F 2 8 C 8 8 8 C C Y . n F 2 9 U 9 9 9 U U Y . n F 2 10 A 10 10 10 A A Y . n F 2 11 C 11 11 11 C C Y . n F 2 12 G 12 12 12 G G Y . n F 2 13 A 13 13 13 A A Y . n F 2 14 G 14 14 14 G G Y . n F 2 15 C 15 15 15 C C Y . n F 2 16 G 16 16 16 G G Y . n F 2 17 C 17 17 17 C C Y . n F 2 18 C 18 18 18 C C Y . n F 2 19 A 19 19 19 A A Y . n F 2 20 U 20 20 20 U U Y . n F 2 21 U 21 21 21 U U Y . n F 2 22 G 22 22 22 G G Y . n F 2 23 C 23 23 23 C C Y . n F 2 24 A 24 24 24 A A Y . n F 2 25 C 25 25 25 C C Y . n F 2 26 U 26 26 26 U U Y . n F 2 27 C 27 27 27 C C Y . n F 2 28 C 28 28 28 C C Y . n F 2 29 G 29 29 29 G G Y . n F 2 30 G 30 30 30 G G Y . n F 2 31 C 31 31 31 C C Y . n F 2 32 G 32 32 32 G G Y . n F 2 33 C 33 33 33 C C Y . n F 2 34 C 34 34 34 C C Y . n F 2 35 A 35 35 35 A A Y . n F 2 36 C 36 36 36 C C Y . n F 2 37 G 37 37 37 G G Y . n F 2 38 G 38 38 38 G G Y . n F 2 39 G 39 39 39 G G Y . n F 2 40 G 40 40 40 G G Y . n F 2 41 G 41 41 41 G G Y . n F 2 42 G 42 42 42 G G Y . n F 2 43 U 43 43 43 U U Y . n F 2 44 C 44 44 44 C C Y . n F 2 45 C 45 45 45 C C Y . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-27 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 7.0398 _pdbx_refine_tls.origin_y -21.7038 _pdbx_refine_tls.origin_z 23.8363 _pdbx_refine_tls.T[1][1] 0.3277 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0847 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0073 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1964 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0988 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2942 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.2608 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.0858 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.7366 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.7211 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.1084 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.0775 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1060 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.1091 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1465 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.3190 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0516 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1077 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1325 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.2953 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0489 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 5 ? ? ? A 100 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 8 ? ? ? B 94 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? C 6 ? ? ? C 102 ? ? all 4 'X-RAY DIFFRACTION' 1 ? ? D 5 ? ? ? D 102 ? ? all 5 'X-RAY DIFFRACTION' 1 ? ? X 1 ? ? ? X 45 ? ? all 6 'X-RAY DIFFRACTION' 1 ? ? Y 1 ? ? ? Y 45 ? ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 "O3'" X C 25 ? ? P X U 26 ? ? 1.534 1.607 -0.073 0.012 Y 2 1 "O3'" X U 26 ? ? P X C 27 ? ? 1.533 1.607 -0.074 0.012 Y 3 1 "O3'" X C 27 ? ? P X C 28 ? ? 1.511 1.607 -0.096 0.012 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 79 ? ? 56.21 18.03 2 1 PRO B 76 ? ? -67.97 99.37 3 1 ASP B 79 ? ? 57.60 12.98 4 1 ASP C 79 ? ? 56.98 15.35 5 1 THR C 89 ? ? 57.51 -119.12 6 1 MET D 51 ? ? -37.43 141.82 7 1 PRO D 76 ? ? -65.74 98.76 8 1 ASP D 79 ? ? 58.46 11.45 9 1 ASP D 90 ? ? 52.19 13.93 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 7 ? NE ? A ARG 7 NE 2 1 Y 1 A ARG 7 ? CZ ? A ARG 7 CZ 3 1 Y 1 A ARG 7 ? NH1 ? A ARG 7 NH1 4 1 Y 1 A ARG 7 ? NH2 ? A ARG 7 NH2 5 1 Y 1 A LYS 20 ? CD ? A LYS 20 CD 6 1 Y 1 A LYS 20 ? CE ? A LYS 20 CE 7 1 Y 1 A LYS 20 ? NZ ? A LYS 20 NZ 8 1 Y 1 A GLU 61 ? CG ? A GLU 61 CG 9 1 Y 1 A GLU 61 ? CD ? A GLU 61 CD 10 1 Y 1 A GLU 61 ? OE1 ? A GLU 61 OE1 11 1 Y 1 A GLU 61 ? OE2 ? A GLU 61 OE2 12 1 Y 1 A LYS 96 ? CG ? A LYS 96 CG 13 1 Y 1 A LYS 96 ? CD ? A LYS 96 CD 14 1 Y 1 A LYS 96 ? CE ? A LYS 96 CE 15 1 Y 1 A LYS 96 ? NZ ? A LYS 96 NZ 16 1 Y 1 A LYS 98 ? CG ? A LYS 98 CG 17 1 Y 1 A LYS 98 ? CD ? A LYS 98 CD 18 1 Y 1 A LYS 98 ? CE ? A LYS 98 CE 19 1 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 20 1 Y 1 A THR 100 ? OG1 ? A THR 100 OG1 21 1 Y 1 A THR 100 ? CG2 ? A THR 100 CG2 22 1 Y 1 B ASN 9 ? CG ? B ASN 9 CG 23 1 Y 1 B ASN 9 ? OD1 ? B ASN 9 OD1 24 1 Y 1 B ASN 9 ? ND2 ? B ASN 9 ND2 25 1 Y 1 B HIS 10 ? CG ? B HIS 10 CG 26 1 Y 1 B HIS 10 ? ND1 ? B HIS 10 ND1 27 1 Y 1 B HIS 10 ? CD2 ? B HIS 10 CD2 28 1 Y 1 B HIS 10 ? CE1 ? B HIS 10 CE1 29 1 Y 1 B HIS 10 ? NE2 ? B HIS 10 NE2 30 1 Y 1 B GLU 19 ? CG ? B GLU 19 CG 31 1 Y 1 B GLU 19 ? CD ? B GLU 19 CD 32 1 Y 1 B GLU 19 ? OE1 ? B GLU 19 OE1 33 1 Y 1 B GLU 19 ? OE2 ? B GLU 19 OE2 34 1 Y 1 B LYS 20 ? CD ? B LYS 20 CD 35 1 Y 1 B LYS 20 ? CE ? B LYS 20 CE 36 1 Y 1 B LYS 20 ? NZ ? B LYS 20 NZ 37 1 Y 1 B LYS 28 ? CG ? B LYS 28 CG 38 1 Y 1 B LYS 28 ? CD ? B LYS 28 CD 39 1 Y 1 B LYS 28 ? CE ? B LYS 28 CE 40 1 Y 1 B LYS 28 ? NZ ? B LYS 28 NZ 41 1 Y 1 B TYR 31 ? CG ? B TYR 31 CG 42 1 Y 1 B TYR 31 ? CD1 ? B TYR 31 CD1 43 1 Y 1 B TYR 31 ? CD2 ? B TYR 31 CD2 44 1 Y 1 B TYR 31 ? CE1 ? B TYR 31 CE1 45 1 Y 1 B TYR 31 ? CE2 ? B TYR 31 CE2 46 1 Y 1 B TYR 31 ? CZ ? B TYR 31 CZ 47 1 Y 1 B TYR 31 ? OH ? B TYR 31 OH 48 1 Y 1 B LEU 41 ? CG ? B LEU 41 CG 49 1 Y 1 B LEU 41 ? CD1 ? B LEU 41 CD1 50 1 Y 1 B LEU 41 ? CD2 ? B LEU 41 CD2 51 1 Y 1 B LYS 50 ? CG ? B LYS 50 CG 52 1 Y 1 B LYS 50 ? CD ? B LYS 50 CD 53 1 Y 1 B LYS 50 ? CE ? B LYS 50 CE 54 1 Y 1 B LYS 50 ? NZ ? B LYS 50 NZ 55 1 Y 1 B MET 51 ? CG ? B MET 51 CG 56 1 Y 1 B MET 51 ? SD ? B MET 51 SD 57 1 Y 1 B MET 51 ? CE ? B MET 51 CE 58 1 Y 1 B GLN 54 ? CG ? B GLN 54 CG 59 1 Y 1 B GLN 54 ? CD ? B GLN 54 CD 60 1 Y 1 B GLN 54 ? OE1 ? B GLN 54 OE1 61 1 Y 1 B GLN 54 ? NE2 ? B GLN 54 NE2 62 1 Y 1 B LYS 60 ? CG ? B LYS 60 CG 63 1 Y 1 B LYS 60 ? CD ? B LYS 60 CD 64 1 Y 1 B LYS 60 ? CE ? B LYS 60 CE 65 1 Y 1 B LYS 60 ? NZ ? B LYS 60 NZ 66 1 Y 1 B LYS 80 ? CG ? B LYS 80 CG 67 1 Y 1 B LYS 80 ? CD ? B LYS 80 CD 68 1 Y 1 B LYS 80 ? CE ? B LYS 80 CE 69 1 Y 1 B LYS 80 ? NZ ? B LYS 80 NZ 70 1 Y 1 B ASP 92 ? CG ? B ASP 92 CG 71 1 Y 1 B ASP 92 ? OD1 ? B ASP 92 OD1 72 1 Y 1 B ASP 92 ? OD2 ? B ASP 92 OD2 73 1 Y 1 C ARG 7 ? CG ? C ARG 7 CG 74 1 Y 1 C ARG 7 ? CD ? C ARG 7 CD 75 1 Y 1 C ARG 7 ? NE ? C ARG 7 NE 76 1 Y 1 C ARG 7 ? CZ ? C ARG 7 CZ 77 1 Y 1 C ARG 7 ? NH1 ? C ARG 7 NH1 78 1 Y 1 C ARG 7 ? NH2 ? C ARG 7 NH2 79 1 Y 1 C LYS 20 ? CD ? C LYS 20 CD 80 1 Y 1 C LYS 20 ? CE ? C LYS 20 CE 81 1 Y 1 C LYS 20 ? NZ ? C LYS 20 NZ 82 1 Y 1 C LYS 23 ? CG ? C LYS 23 CG 83 1 Y 1 C LYS 23 ? CD ? C LYS 23 CD 84 1 Y 1 C LYS 23 ? CE ? C LYS 23 CE 85 1 Y 1 C LYS 23 ? NZ ? C LYS 23 NZ 86 1 Y 1 C ARG 47 ? CG ? C ARG 47 CG 87 1 Y 1 C ARG 47 ? CD ? C ARG 47 CD 88 1 Y 1 C ARG 47 ? NE ? C ARG 47 NE 89 1 Y 1 C ARG 47 ? CZ ? C ARG 47 CZ 90 1 Y 1 C ARG 47 ? NH1 ? C ARG 47 NH1 91 1 Y 1 C ARG 47 ? NH2 ? C ARG 47 NH2 92 1 Y 1 C LEU 49 ? CG ? C LEU 49 CG 93 1 Y 1 C LEU 49 ? CD1 ? C LEU 49 CD1 94 1 Y 1 C LEU 49 ? CD2 ? C LEU 49 CD2 95 1 Y 1 C LYS 50 ? CG ? C LYS 50 CG 96 1 Y 1 C LYS 50 ? CD ? C LYS 50 CD 97 1 Y 1 C LYS 50 ? CE ? C LYS 50 CE 98 1 Y 1 C LYS 50 ? NZ ? C LYS 50 NZ 99 1 Y 1 C LYS 88 ? CG ? C LYS 88 CG 100 1 Y 1 C LYS 88 ? CD ? C LYS 88 CD 101 1 Y 1 C LYS 88 ? CE ? C LYS 88 CE 102 1 Y 1 C LYS 88 ? NZ ? C LYS 88 NZ 103 1 Y 1 C MET 97 ? CG ? C MET 97 CG 104 1 Y 1 C MET 97 ? SD ? C MET 97 SD 105 1 Y 1 C MET 97 ? CE ? C MET 97 CE 106 1 Y 1 C LYS 98 ? CG ? C LYS 98 CG 107 1 Y 1 C LYS 98 ? CD ? C LYS 98 CD 108 1 Y 1 C LYS 98 ? CE ? C LYS 98 CE 109 1 Y 1 C LYS 98 ? NZ ? C LYS 98 NZ 110 1 Y 1 C VAL 102 ? CG1 ? C VAL 102 CG1 111 1 Y 1 C VAL 102 ? CG2 ? C VAL 102 CG2 112 1 Y 1 D GLU 5 ? CG ? D GLU 5 CG 113 1 Y 1 D GLU 5 ? CD ? D GLU 5 CD 114 1 Y 1 D GLU 5 ? OE1 ? D GLU 5 OE1 115 1 Y 1 D GLU 5 ? OE2 ? D GLU 5 OE2 116 1 Y 1 D ARG 7 ? NE ? D ARG 7 NE 117 1 Y 1 D ARG 7 ? CZ ? D ARG 7 CZ 118 1 Y 1 D ARG 7 ? NH1 ? D ARG 7 NH1 119 1 Y 1 D ARG 7 ? NH2 ? D ARG 7 NH2 120 1 Y 1 D LYS 20 ? CD ? D LYS 20 CD 121 1 Y 1 D LYS 20 ? CE ? D LYS 20 CE 122 1 Y 1 D LYS 20 ? NZ ? D LYS 20 NZ 123 1 Y 1 D LYS 22 ? CG ? D LYS 22 CG 124 1 Y 1 D LYS 22 ? CD ? D LYS 22 CD 125 1 Y 1 D LYS 22 ? CE ? D LYS 22 CE 126 1 Y 1 D LYS 22 ? NZ ? D LYS 22 NZ 127 1 Y 1 D LYS 27 ? CG ? D LYS 27 CG 128 1 Y 1 D LYS 27 ? CD ? D LYS 27 CD 129 1 Y 1 D LYS 27 ? CE ? D LYS 27 CE 130 1 Y 1 D LYS 27 ? NZ ? D LYS 27 NZ 131 1 Y 1 D ARG 47 ? CG ? D ARG 47 CG 132 1 Y 1 D ARG 47 ? CD ? D ARG 47 CD 133 1 Y 1 D ARG 47 ? NE ? D ARG 47 NE 134 1 Y 1 D ARG 47 ? CZ ? D ARG 47 CZ 135 1 Y 1 D ARG 47 ? NH1 ? D ARG 47 NH1 136 1 Y 1 D ARG 47 ? NH2 ? D ARG 47 NH2 137 1 Y 1 D LEU 49 ? CG ? D LEU 49 CG 138 1 Y 1 D LEU 49 ? CD1 ? D LEU 49 CD1 139 1 Y 1 D LEU 49 ? CD2 ? D LEU 49 CD2 140 1 Y 1 D LYS 50 ? CG ? D LYS 50 CG 141 1 Y 1 D LYS 50 ? CD ? D LYS 50 CD 142 1 Y 1 D LYS 50 ? CE ? D LYS 50 CE 143 1 Y 1 D LYS 50 ? NZ ? D LYS 50 NZ 144 1 Y 1 D MET 51 ? CG ? D MET 51 CG 145 1 Y 1 D MET 51 ? SD ? D MET 51 SD 146 1 Y 1 D MET 51 ? CE ? D MET 51 CE 147 1 Y 1 D ARG 52 ? CG ? D ARG 52 CG 148 1 Y 1 D ARG 52 ? CD ? D ARG 52 CD 149 1 Y 1 D ARG 52 ? NE ? D ARG 52 NE 150 1 Y 1 D ARG 52 ? CZ ? D ARG 52 CZ 151 1 Y 1 D ARG 52 ? NH1 ? D ARG 52 NH1 152 1 Y 1 D ARG 52 ? NH2 ? D ARG 52 NH2 153 1 Y 1 D LYS 80 ? CG ? D LYS 80 CG 154 1 Y 1 D LYS 80 ? CD ? D LYS 80 CD 155 1 Y 1 D LYS 80 ? CE ? D LYS 80 CE 156 1 Y 1 D LYS 80 ? NZ ? D LYS 80 NZ 157 1 Y 1 D LYS 88 ? CG ? D LYS 88 CG 158 1 Y 1 D LYS 88 ? CD ? D LYS 88 CD 159 1 Y 1 D LYS 88 ? CE ? D LYS 88 CE 160 1 Y 1 D LYS 88 ? NZ ? D LYS 88 NZ 161 1 Y 1 D LYS 98 ? CG ? D LYS 98 CG 162 1 Y 1 D LYS 98 ? CD ? D LYS 98 CD 163 1 Y 1 D LYS 98 ? CE ? D LYS 98 CE 164 1 Y 1 D LYS 98 ? NZ ? D LYS 98 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A PHE 101 ? A PHE 101 6 1 Y 1 A VAL 102 ? A VAL 102 7 1 Y 1 B MET 1 ? B MET 1 8 1 Y 1 B ALA 2 ? B ALA 2 9 1 Y 1 B VAL 3 ? B VAL 3 10 1 Y 1 B PRO 4 ? B PRO 4 11 1 Y 1 B GLU 5 ? B GLU 5 12 1 Y 1 B THR 6 ? B THR 6 13 1 Y 1 B ARG 7 ? B ARG 7 14 1 Y 1 B ALA 95 ? B ALA 95 15 1 Y 1 B LYS 96 ? B LYS 96 16 1 Y 1 B MET 97 ? B MET 97 17 1 Y 1 B LYS 98 ? B LYS 98 18 1 Y 1 B GLY 99 ? B GLY 99 19 1 Y 1 B THR 100 ? B THR 100 20 1 Y 1 B PHE 101 ? B PHE 101 21 1 Y 1 B VAL 102 ? B VAL 102 22 1 Y 1 C MET 1 ? C MET 1 23 1 Y 1 C ALA 2 ? C ALA 2 24 1 Y 1 C VAL 3 ? C VAL 3 25 1 Y 1 C PRO 4 ? C PRO 4 26 1 Y 1 C GLU 5 ? C GLU 5 27 1 Y 1 D MET 1 ? D MET 1 28 1 Y 1 D ALA 2 ? D ALA 2 29 1 Y 1 D VAL 3 ? D VAL 3 30 1 Y 1 D PRO 4 ? D PRO 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 C OP3 O N N 111 C P P N N 112 C OP1 O N N 113 C OP2 O N N 114 C "O5'" O N N 115 C "C5'" C N N 116 C "C4'" C N R 117 C "O4'" O N N 118 C "C3'" C N S 119 C "O3'" O N N 120 C "C2'" C N R 121 C "O2'" O N N 122 C "C1'" C N R 123 C N1 N N N 124 C C2 C N N 125 C O2 O N N 126 C N3 N N N 127 C C4 C N N 128 C N4 N N N 129 C C5 C N N 130 C C6 C N N 131 C HOP3 H N N 132 C HOP2 H N N 133 C "H5'" H N N 134 C "H5''" H N N 135 C "H4'" H N N 136 C "H3'" H N N 137 C "HO3'" H N N 138 C "H2'" H N N 139 C "HO2'" H N N 140 C "H1'" H N N 141 C H41 H N N 142 C H42 H N N 143 C H5 H N N 144 C H6 H N N 145 G OP3 O N N 146 G P P N N 147 G OP1 O N N 148 G OP2 O N N 149 G "O5'" O N N 150 G "C5'" C N N 151 G "C4'" C N R 152 G "O4'" O N N 153 G "C3'" C N S 154 G "O3'" O N N 155 G "C2'" C N R 156 G "O2'" O N N 157 G "C1'" C N R 158 G N9 N Y N 159 G C8 C Y N 160 G N7 N Y N 161 G C5 C Y N 162 G C6 C N N 163 G O6 O N N 164 G N1 N N N 165 G C2 C N N 166 G N2 N N N 167 G N3 N N N 168 G C4 C Y N 169 G HOP3 H N N 170 G HOP2 H N N 171 G "H5'" H N N 172 G "H5''" H N N 173 G "H4'" H N N 174 G "H3'" H N N 175 G "HO3'" H N N 176 G "H2'" H N N 177 G "HO2'" H N N 178 G "H1'" H N N 179 G H8 H N N 180 G H1 H N N 181 G H21 H N N 182 G H22 H N N 183 GLN N N N N 184 GLN CA C N S 185 GLN C C N N 186 GLN O O N N 187 GLN CB C N N 188 GLN CG C N N 189 GLN CD C N N 190 GLN OE1 O N N 191 GLN NE2 N N N 192 GLN OXT O N N 193 GLN H H N N 194 GLN H2 H N N 195 GLN HA H N N 196 GLN HB2 H N N 197 GLN HB3 H N N 198 GLN HG2 H N N 199 GLN HG3 H N N 200 GLN HE21 H N N 201 GLN HE22 H N N 202 GLN HXT H N N 203 GLU N N N N 204 GLU CA C N S 205 GLU C C N N 206 GLU O O N N 207 GLU CB C N N 208 GLU CG C N N 209 GLU CD C N N 210 GLU OE1 O N N 211 GLU OE2 O N N 212 GLU OXT O N N 213 GLU H H N N 214 GLU H2 H N N 215 GLU HA H N N 216 GLU HB2 H N N 217 GLU HB3 H N N 218 GLU HG2 H N N 219 GLU HG3 H N N 220 GLU HE2 H N N 221 GLU HXT H N N 222 GLY N N N N 223 GLY CA C N N 224 GLY C C N N 225 GLY O O N N 226 GLY OXT O N N 227 GLY H H N N 228 GLY H2 H N N 229 GLY HA2 H N N 230 GLY HA3 H N N 231 GLY HXT H N N 232 HIS N N N N 233 HIS CA C N S 234 HIS C C N N 235 HIS O O N N 236 HIS CB C N N 237 HIS CG C Y N 238 HIS ND1 N Y N 239 HIS CD2 C Y N 240 HIS CE1 C Y N 241 HIS NE2 N Y N 242 HIS OXT O N N 243 HIS H H N N 244 HIS H2 H N N 245 HIS HA H N N 246 HIS HB2 H N N 247 HIS HB3 H N N 248 HIS HD1 H N N 249 HIS HD2 H N N 250 HIS HE1 H N N 251 HIS HE2 H N N 252 HIS HXT H N N 253 ILE N N N N 254 ILE CA C N S 255 ILE C C N N 256 ILE O O N N 257 ILE CB C N S 258 ILE CG1 C N N 259 ILE CG2 C N N 260 ILE CD1 C N N 261 ILE OXT O N N 262 ILE H H N N 263 ILE H2 H N N 264 ILE HA H N N 265 ILE HB H N N 266 ILE HG12 H N N 267 ILE HG13 H N N 268 ILE HG21 H N N 269 ILE HG22 H N N 270 ILE HG23 H N N 271 ILE HD11 H N N 272 ILE HD12 H N N 273 ILE HD13 H N N 274 ILE HXT H N N 275 LEU N N N N 276 LEU CA C N S 277 LEU C C N N 278 LEU O O N N 279 LEU CB C N N 280 LEU CG C N N 281 LEU CD1 C N N 282 LEU CD2 C N N 283 LEU OXT O N N 284 LEU H H N N 285 LEU H2 H N N 286 LEU HA H N N 287 LEU HB2 H N N 288 LEU HB3 H N N 289 LEU HG H N N 290 LEU HD11 H N N 291 LEU HD12 H N N 292 LEU HD13 H N N 293 LEU HD21 H N N 294 LEU HD22 H N N 295 LEU HD23 H N N 296 LEU HXT H N N 297 LYS N N N N 298 LYS CA C N S 299 LYS C C N N 300 LYS O O N N 301 LYS CB C N N 302 LYS CG C N N 303 LYS CD C N N 304 LYS CE C N N 305 LYS NZ N N N 306 LYS OXT O N N 307 LYS H H N N 308 LYS H2 H N N 309 LYS HA H N N 310 LYS HB2 H N N 311 LYS HB3 H N N 312 LYS HG2 H N N 313 LYS HG3 H N N 314 LYS HD2 H N N 315 LYS HD3 H N N 316 LYS HE2 H N N 317 LYS HE3 H N N 318 LYS HZ1 H N N 319 LYS HZ2 H N N 320 LYS HZ3 H N N 321 LYS HXT H N N 322 MET N N N N 323 MET CA C N S 324 MET C C N N 325 MET O O N N 326 MET CB C N N 327 MET CG C N N 328 MET SD S N N 329 MET CE C N N 330 MET OXT O N N 331 MET H H N N 332 MET H2 H N N 333 MET HA H N N 334 MET HB2 H N N 335 MET HB3 H N N 336 MET HG2 H N N 337 MET HG3 H N N 338 MET HE1 H N N 339 MET HE2 H N N 340 MET HE3 H N N 341 MET HXT H N N 342 PHE N N N N 343 PHE CA C N S 344 PHE C C N N 345 PHE O O N N 346 PHE CB C N N 347 PHE CG C Y N 348 PHE CD1 C Y N 349 PHE CD2 C Y N 350 PHE CE1 C Y N 351 PHE CE2 C Y N 352 PHE CZ C Y N 353 PHE OXT O N N 354 PHE H H N N 355 PHE H2 H N N 356 PHE HA H N N 357 PHE HB2 H N N 358 PHE HB3 H N N 359 PHE HD1 H N N 360 PHE HD2 H N N 361 PHE HE1 H N N 362 PHE HE2 H N N 363 PHE HZ H N N 364 PHE HXT H N N 365 PRO N N N N 366 PRO CA C N S 367 PRO C C N N 368 PRO O O N N 369 PRO CB C N N 370 PRO CG C N N 371 PRO CD C N N 372 PRO OXT O N N 373 PRO H H N N 374 PRO HA H N N 375 PRO HB2 H N N 376 PRO HB3 H N N 377 PRO HG2 H N N 378 PRO HG3 H N N 379 PRO HD2 H N N 380 PRO HD3 H N N 381 PRO HXT H N N 382 SER N N N N 383 SER CA C N S 384 SER C C N N 385 SER O O N N 386 SER CB C N N 387 SER OG O N N 388 SER OXT O N N 389 SER H H N N 390 SER H2 H N N 391 SER HA H N N 392 SER HB2 H N N 393 SER HB3 H N N 394 SER HG H N N 395 SER HXT H N N 396 THR N N N N 397 THR CA C N S 398 THR C C N N 399 THR O O N N 400 THR CB C N R 401 THR OG1 O N N 402 THR CG2 C N N 403 THR OXT O N N 404 THR H H N N 405 THR H2 H N N 406 THR HA H N N 407 THR HB H N N 408 THR HG1 H N N 409 THR HG21 H N N 410 THR HG22 H N N 411 THR HG23 H N N 412 THR HXT H N N 413 TYR N N N N 414 TYR CA C N S 415 TYR C C N N 416 TYR O O N N 417 TYR CB C N N 418 TYR CG C Y N 419 TYR CD1 C Y N 420 TYR CD2 C Y N 421 TYR CE1 C Y N 422 TYR CE2 C Y N 423 TYR CZ C Y N 424 TYR OH O N N 425 TYR OXT O N N 426 TYR H H N N 427 TYR H2 H N N 428 TYR HA H N N 429 TYR HB2 H N N 430 TYR HB3 H N N 431 TYR HD1 H N N 432 TYR HD2 H N N 433 TYR HE1 H N N 434 TYR HE2 H N N 435 TYR HH H N N 436 TYR HXT H N N 437 U OP3 O N N 438 U P P N N 439 U OP1 O N N 440 U OP2 O N N 441 U "O5'" O N N 442 U "C5'" C N N 443 U "C4'" C N R 444 U "O4'" O N N 445 U "C3'" C N S 446 U "O3'" O N N 447 U "C2'" C N R 448 U "O2'" O N N 449 U "C1'" C N R 450 U N1 N N N 451 U C2 C N N 452 U O2 O N N 453 U N3 N N N 454 U C4 C N N 455 U O4 O N N 456 U C5 C N N 457 U C6 C N N 458 U HOP3 H N N 459 U HOP2 H N N 460 U "H5'" H N N 461 U "H5''" H N N 462 U "H4'" H N N 463 U "H3'" H N N 464 U "HO3'" H N N 465 U "H2'" H N N 466 U "HO2'" H N N 467 U "H1'" H N N 468 U H3 H N N 469 U H5 H N N 470 U H6 H N N 471 VAL N N N N 472 VAL CA C N S 473 VAL C C N N 474 VAL O O N N 475 VAL CB C N N 476 VAL CG1 C N N 477 VAL CG2 C N N 478 VAL OXT O N N 479 VAL H H N N 480 VAL H2 H N N 481 VAL HA H N N 482 VAL HB H N N 483 VAL HG11 H N N 484 VAL HG12 H N N 485 VAL HG13 H N N 486 VAL HG21 H N N 487 VAL HG22 H N N 488 VAL HG23 H N N 489 VAL HXT H N N 490 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 C OP3 P sing N N 109 C OP3 HOP3 sing N N 110 C P OP1 doub N N 111 C P OP2 sing N N 112 C P "O5'" sing N N 113 C OP2 HOP2 sing N N 114 C "O5'" "C5'" sing N N 115 C "C5'" "C4'" sing N N 116 C "C5'" "H5'" sing N N 117 C "C5'" "H5''" sing N N 118 C "C4'" "O4'" sing N N 119 C "C4'" "C3'" sing N N 120 C "C4'" "H4'" sing N N 121 C "O4'" "C1'" sing N N 122 C "C3'" "O3'" sing N N 123 C "C3'" "C2'" sing N N 124 C "C3'" "H3'" sing N N 125 C "O3'" "HO3'" sing N N 126 C "C2'" "O2'" sing N N 127 C "C2'" "C1'" sing N N 128 C "C2'" "H2'" sing N N 129 C "O2'" "HO2'" sing N N 130 C "C1'" N1 sing N N 131 C "C1'" "H1'" sing N N 132 C N1 C2 sing N N 133 C N1 C6 sing N N 134 C C2 O2 doub N N 135 C C2 N3 sing N N 136 C N3 C4 doub N N 137 C C4 N4 sing N N 138 C C4 C5 sing N N 139 C N4 H41 sing N N 140 C N4 H42 sing N N 141 C C5 C6 doub N N 142 C C5 H5 sing N N 143 C C6 H6 sing N N 144 G OP3 P sing N N 145 G OP3 HOP3 sing N N 146 G P OP1 doub N N 147 G P OP2 sing N N 148 G P "O5'" sing N N 149 G OP2 HOP2 sing N N 150 G "O5'" "C5'" sing N N 151 G "C5'" "C4'" sing N N 152 G "C5'" "H5'" sing N N 153 G "C5'" "H5''" sing N N 154 G "C4'" "O4'" sing N N 155 G "C4'" "C3'" sing N N 156 G "C4'" "H4'" sing N N 157 G "O4'" "C1'" sing N N 158 G "C3'" "O3'" sing N N 159 G "C3'" "C2'" sing N N 160 G "C3'" "H3'" sing N N 161 G "O3'" "HO3'" sing N N 162 G "C2'" "O2'" sing N N 163 G "C2'" "C1'" sing N N 164 G "C2'" "H2'" sing N N 165 G "O2'" "HO2'" sing N N 166 G "C1'" N9 sing N N 167 G "C1'" "H1'" sing N N 168 G N9 C8 sing Y N 169 G N9 C4 sing Y N 170 G C8 N7 doub Y N 171 G C8 H8 sing N N 172 G N7 C5 sing Y N 173 G C5 C6 sing N N 174 G C5 C4 doub Y N 175 G C6 O6 doub N N 176 G C6 N1 sing N N 177 G N1 C2 sing N N 178 G N1 H1 sing N N 179 G C2 N2 sing N N 180 G C2 N3 doub N N 181 G N2 H21 sing N N 182 G N2 H22 sing N N 183 G N3 C4 sing N N 184 GLN N CA sing N N 185 GLN N H sing N N 186 GLN N H2 sing N N 187 GLN CA C sing N N 188 GLN CA CB sing N N 189 GLN CA HA sing N N 190 GLN C O doub N N 191 GLN C OXT sing N N 192 GLN CB CG sing N N 193 GLN CB HB2 sing N N 194 GLN CB HB3 sing N N 195 GLN CG CD sing N N 196 GLN CG HG2 sing N N 197 GLN CG HG3 sing N N 198 GLN CD OE1 doub N N 199 GLN CD NE2 sing N N 200 GLN NE2 HE21 sing N N 201 GLN NE2 HE22 sing N N 202 GLN OXT HXT sing N N 203 GLU N CA sing N N 204 GLU N H sing N N 205 GLU N H2 sing N N 206 GLU CA C sing N N 207 GLU CA CB sing N N 208 GLU CA HA sing N N 209 GLU C O doub N N 210 GLU C OXT sing N N 211 GLU CB CG sing N N 212 GLU CB HB2 sing N N 213 GLU CB HB3 sing N N 214 GLU CG CD sing N N 215 GLU CG HG2 sing N N 216 GLU CG HG3 sing N N 217 GLU CD OE1 doub N N 218 GLU CD OE2 sing N N 219 GLU OE2 HE2 sing N N 220 GLU OXT HXT sing N N 221 GLY N CA sing N N 222 GLY N H sing N N 223 GLY N H2 sing N N 224 GLY CA C sing N N 225 GLY CA HA2 sing N N 226 GLY CA HA3 sing N N 227 GLY C O doub N N 228 GLY C OXT sing N N 229 GLY OXT HXT sing N N 230 HIS N CA sing N N 231 HIS N H sing N N 232 HIS N H2 sing N N 233 HIS CA C sing N N 234 HIS CA CB sing N N 235 HIS CA HA sing N N 236 HIS C O doub N N 237 HIS C OXT sing N N 238 HIS CB CG sing N N 239 HIS CB HB2 sing N N 240 HIS CB HB3 sing N N 241 HIS CG ND1 sing Y N 242 HIS CG CD2 doub Y N 243 HIS ND1 CE1 doub Y N 244 HIS ND1 HD1 sing N N 245 HIS CD2 NE2 sing Y N 246 HIS CD2 HD2 sing N N 247 HIS CE1 NE2 sing Y N 248 HIS CE1 HE1 sing N N 249 HIS NE2 HE2 sing N N 250 HIS OXT HXT sing N N 251 ILE N CA sing N N 252 ILE N H sing N N 253 ILE N H2 sing N N 254 ILE CA C sing N N 255 ILE CA CB sing N N 256 ILE CA HA sing N N 257 ILE C O doub N N 258 ILE C OXT sing N N 259 ILE CB CG1 sing N N 260 ILE CB CG2 sing N N 261 ILE CB HB sing N N 262 ILE CG1 CD1 sing N N 263 ILE CG1 HG12 sing N N 264 ILE CG1 HG13 sing N N 265 ILE CG2 HG21 sing N N 266 ILE CG2 HG22 sing N N 267 ILE CG2 HG23 sing N N 268 ILE CD1 HD11 sing N N 269 ILE CD1 HD12 sing N N 270 ILE CD1 HD13 sing N N 271 ILE OXT HXT sing N N 272 LEU N CA sing N N 273 LEU N H sing N N 274 LEU N H2 sing N N 275 LEU CA C sing N N 276 LEU CA CB sing N N 277 LEU CA HA sing N N 278 LEU C O doub N N 279 LEU C OXT sing N N 280 LEU CB CG sing N N 281 LEU CB HB2 sing N N 282 LEU CB HB3 sing N N 283 LEU CG CD1 sing N N 284 LEU CG CD2 sing N N 285 LEU CG HG sing N N 286 LEU CD1 HD11 sing N N 287 LEU CD1 HD12 sing N N 288 LEU CD1 HD13 sing N N 289 LEU CD2 HD21 sing N N 290 LEU CD2 HD22 sing N N 291 LEU CD2 HD23 sing N N 292 LEU OXT HXT sing N N 293 LYS N CA sing N N 294 LYS N H sing N N 295 LYS N H2 sing N N 296 LYS CA C sing N N 297 LYS CA CB sing N N 298 LYS CA HA sing N N 299 LYS C O doub N N 300 LYS C OXT sing N N 301 LYS CB CG sing N N 302 LYS CB HB2 sing N N 303 LYS CB HB3 sing N N 304 LYS CG CD sing N N 305 LYS CG HG2 sing N N 306 LYS CG HG3 sing N N 307 LYS CD CE sing N N 308 LYS CD HD2 sing N N 309 LYS CD HD3 sing N N 310 LYS CE NZ sing N N 311 LYS CE HE2 sing N N 312 LYS CE HE3 sing N N 313 LYS NZ HZ1 sing N N 314 LYS NZ HZ2 sing N N 315 LYS NZ HZ3 sing N N 316 LYS OXT HXT sing N N 317 MET N CA sing N N 318 MET N H sing N N 319 MET N H2 sing N N 320 MET CA C sing N N 321 MET CA CB sing N N 322 MET CA HA sing N N 323 MET C O doub N N 324 MET C OXT sing N N 325 MET CB CG sing N N 326 MET CB HB2 sing N N 327 MET CB HB3 sing N N 328 MET CG SD sing N N 329 MET CG HG2 sing N N 330 MET CG HG3 sing N N 331 MET SD CE sing N N 332 MET CE HE1 sing N N 333 MET CE HE2 sing N N 334 MET CE HE3 sing N N 335 MET OXT HXT sing N N 336 PHE N CA sing N N 337 PHE N H sing N N 338 PHE N H2 sing N N 339 PHE CA C sing N N 340 PHE CA CB sing N N 341 PHE CA HA sing N N 342 PHE C O doub N N 343 PHE C OXT sing N N 344 PHE CB CG sing N N 345 PHE CB HB2 sing N N 346 PHE CB HB3 sing N N 347 PHE CG CD1 doub Y N 348 PHE CG CD2 sing Y N 349 PHE CD1 CE1 sing Y N 350 PHE CD1 HD1 sing N N 351 PHE CD2 CE2 doub Y N 352 PHE CD2 HD2 sing N N 353 PHE CE1 CZ doub Y N 354 PHE CE1 HE1 sing N N 355 PHE CE2 CZ sing Y N 356 PHE CE2 HE2 sing N N 357 PHE CZ HZ sing N N 358 PHE OXT HXT sing N N 359 PRO N CA sing N N 360 PRO N CD sing N N 361 PRO N H sing N N 362 PRO CA C sing N N 363 PRO CA CB sing N N 364 PRO CA HA sing N N 365 PRO C O doub N N 366 PRO C OXT sing N N 367 PRO CB CG sing N N 368 PRO CB HB2 sing N N 369 PRO CB HB3 sing N N 370 PRO CG CD sing N N 371 PRO CG HG2 sing N N 372 PRO CG HG3 sing N N 373 PRO CD HD2 sing N N 374 PRO CD HD3 sing N N 375 PRO OXT HXT sing N N 376 SER N CA sing N N 377 SER N H sing N N 378 SER N H2 sing N N 379 SER CA C sing N N 380 SER CA CB sing N N 381 SER CA HA sing N N 382 SER C O doub N N 383 SER C OXT sing N N 384 SER CB OG sing N N 385 SER CB HB2 sing N N 386 SER CB HB3 sing N N 387 SER OG HG sing N N 388 SER OXT HXT sing N N 389 THR N CA sing N N 390 THR N H sing N N 391 THR N H2 sing N N 392 THR CA C sing N N 393 THR CA CB sing N N 394 THR CA HA sing N N 395 THR C O doub N N 396 THR C OXT sing N N 397 THR CB OG1 sing N N 398 THR CB CG2 sing N N 399 THR CB HB sing N N 400 THR OG1 HG1 sing N N 401 THR CG2 HG21 sing N N 402 THR CG2 HG22 sing N N 403 THR CG2 HG23 sing N N 404 THR OXT HXT sing N N 405 TYR N CA sing N N 406 TYR N H sing N N 407 TYR N H2 sing N N 408 TYR CA C sing N N 409 TYR CA CB sing N N 410 TYR CA HA sing N N 411 TYR C O doub N N 412 TYR C OXT sing N N 413 TYR CB CG sing N N 414 TYR CB HB2 sing N N 415 TYR CB HB3 sing N N 416 TYR CG CD1 doub Y N 417 TYR CG CD2 sing Y N 418 TYR CD1 CE1 sing Y N 419 TYR CD1 HD1 sing N N 420 TYR CD2 CE2 doub Y N 421 TYR CD2 HD2 sing N N 422 TYR CE1 CZ doub Y N 423 TYR CE1 HE1 sing N N 424 TYR CE2 CZ sing Y N 425 TYR CE2 HE2 sing N N 426 TYR CZ OH sing N N 427 TYR OH HH sing N N 428 TYR OXT HXT sing N N 429 U OP3 P sing N N 430 U OP3 HOP3 sing N N 431 U P OP1 doub N N 432 U P OP2 sing N N 433 U P "O5'" sing N N 434 U OP2 HOP2 sing N N 435 U "O5'" "C5'" sing N N 436 U "C5'" "C4'" sing N N 437 U "C5'" "H5'" sing N N 438 U "C5'" "H5''" sing N N 439 U "C4'" "O4'" sing N N 440 U "C4'" "C3'" sing N N 441 U "C4'" "H4'" sing N N 442 U "O4'" "C1'" sing N N 443 U "C3'" "O3'" sing N N 444 U "C3'" "C2'" sing N N 445 U "C3'" "H3'" sing N N 446 U "O3'" "HO3'" sing N N 447 U "C2'" "O2'" sing N N 448 U "C2'" "C1'" sing N N 449 U "C2'" "H2'" sing N N 450 U "O2'" "HO2'" sing N N 451 U "C1'" N1 sing N N 452 U "C1'" "H1'" sing N N 453 U N1 C2 sing N N 454 U N1 C6 sing N N 455 U C2 O2 doub N N 456 U C2 N3 sing N N 457 U N3 C4 sing N N 458 U N3 H3 sing N N 459 U C4 O4 doub N N 460 U C4 C5 sing N N 461 U C5 C6 doub N N 462 U C5 H5 sing N N 463 U C6 H6 sing N N 464 VAL N CA sing N N 465 VAL N H sing N N 466 VAL N H2 sing N N 467 VAL CA C sing N N 468 VAL CA CB sing N N 469 VAL CA HA sing N N 470 VAL C O doub N N 471 VAL C OXT sing N N 472 VAL CB CG1 sing N N 473 VAL CB CG2 sing N N 474 VAL CB HB sing N N 475 VAL CG1 HG11 sing N N 476 VAL CG1 HG12 sing N N 477 VAL CG1 HG13 sing N N 478 VAL CG2 HG21 sing N N 479 VAL CG2 HG22 sing N N 480 VAL CG2 HG23 sing N N 481 VAL OXT HXT sing N N 482 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 7DLZ 'double helix' 7DLZ 'a-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 E G 1 1_555 E C 45 1_555 -0.880 0.612 0.055 -6.418 9.942 -18.041 1 X_G1:C45_X X 1 ? X 45 ? ? ? 1 E G 2 1_555 E C 44 1_555 0.909 0.012 -1.392 -4.594 -34.435 -24.795 2 X_G2:C44_X X 2 ? X 44 ? ? 1 1 E A 3 1_555 E U 43 1_555 0.842 0.598 -0.211 11.387 -9.424 0.215 3 X_A3:U43_X X 3 ? X 43 ? 20 1 1 E C 4 1_555 E G 42 1_555 -1.004 0.179 -1.130 27.918 -21.072 -1.272 4 X_C4:G42_X X 4 ? X 42 ? 19 1 1 E C 5 1_555 E G 41 1_555 -1.242 -0.409 -0.977 7.366 -11.988 -13.745 5 X_C5:G41_X X 5 ? X 41 ? 19 1 1 E U 6 1_555 E G 40 1_555 2.194 -0.346 0.439 -4.877 -5.156 -6.122 6 X_U6:G40_X X 6 ? X 40 ? 28 1 1 E C 8 1_555 E G 39 1_555 0.046 -0.415 -0.435 4.169 -11.096 5.274 7 X_C8:G39_X X 8 ? X 39 ? 19 1 1 E U 9 1_555 E G 38 1_555 2.398 -0.882 0.214 -6.770 -1.853 -4.806 8 X_U9:G38_X X 9 ? X 38 ? 28 1 1 E C 11 1_555 E G 37 1_555 0.283 -0.684 0.001 7.770 -8.988 -11.029 9 X_C11:G37_X X 11 ? X 37 ? 22 1 1 E G 12 1_555 E C 36 1_555 -0.812 -0.260 -0.229 -5.201 -13.573 -26.963 10 X_G12:C36_X X 12 ? X 36 ? ? 1 1 E A 13 1_555 E C 34 1_555 -5.133 -1.263 0.328 9.638 -8.296 -26.855 11 X_A13:C34_X X 13 ? X 34 ? ? ? 1 E G 14 1_555 E C 33 1_555 -0.264 0.097 0.044 6.527 -16.706 -9.973 12 X_G14:C33_X X 14 ? X 33 ? 19 1 1 E C 15 1_555 E G 32 1_555 -0.132 -0.157 0.348 5.755 -17.030 -7.412 13 X_C15:G32_X X 15 ? X 32 ? 19 1 1 E G 16 1_555 E C 31 1_555 0.731 -0.125 -0.100 -0.610 -15.581 -22.693 14 X_G16:C31_X X 16 ? X 31 ? 19 1 1 E C 17 1_555 E G 30 1_555 -0.279 -0.176 0.494 3.394 -10.717 -1.246 15 X_C17:G30_X X 17 ? X 30 ? 19 1 1 E C 18 1_555 E G 29 1_555 -0.441 -0.252 -0.073 1.848 -3.768 -3.112 16 X_C18:G29_X X 18 ? X 29 ? 19 1 1 F G 1 1_555 F C 45 1_555 -0.301 -0.035 -0.426 -9.980 3.999 -12.332 17 Y_G1:C45_Y Y 1 ? Y 45 ? 19 1 1 F G 2 1_555 F C 44 1_555 0.805 -0.370 -0.999 -9.424 -23.431 -15.515 18 Y_G2:C44_Y Y 2 ? Y 44 ? 19 1 1 F A 3 1_555 F U 43 1_555 0.636 0.303 -0.012 6.752 -6.462 0.110 19 Y_A3:U43_Y Y 3 ? Y 43 ? 20 1 1 F C 4 1_555 F G 42 1_555 0.372 -0.524 -0.321 17.250 -19.533 -3.073 20 Y_C4:G42_Y Y 4 ? Y 42 ? 19 1 1 F C 5 1_555 F G 41 1_555 -0.524 -0.376 0.118 1.546 -25.386 -8.240 21 Y_C5:G41_Y Y 5 ? Y 41 ? 19 1 1 F U 6 1_555 F G 40 1_555 2.146 -0.929 0.304 -4.680 -16.404 -13.179 22 Y_U6:G40_Y Y 6 ? Y 40 ? 28 1 1 F C 8 1_555 F G 39 1_555 -0.598 -0.288 -0.022 6.342 -13.468 -0.664 23 Y_C8:G39_Y Y 8 ? Y 39 ? 19 1 1 F U 9 1_555 F G 38 1_555 1.660 -0.438 0.451 -7.838 4.434 -6.541 24 Y_U9:G38_Y Y 9 ? Y 38 ? 28 1 1 F C 11 1_555 F G 37 1_555 1.126 -0.390 -0.721 11.373 -20.365 -20.766 25 Y_C11:G37_Y Y 11 ? Y 37 ? ? 1 1 F G 12 1_555 F C 36 1_555 0.186 -0.799 1.007 0.941 -15.903 -23.627 26 Y_G12:C36_Y Y 12 ? Y 36 ? 22 1 1 F A 13 1_555 F C 34 1_555 -3.234 -0.623 0.458 10.595 -4.102 -2.645 27 Y_A13:C34_Y Y 13 ? Y 34 ? ? 1 1 F G 14 1_555 F C 33 1_555 -0.506 0.425 -0.169 1.813 -12.964 8.192 28 Y_G14:C33_Y Y 14 ? Y 33 ? 19 1 1 F C 15 1_555 F G 32 1_555 -0.073 -0.150 -0.456 3.670 -11.289 -8.658 29 Y_C15:G32_Y Y 15 ? Y 32 ? 19 1 1 F G 16 1_555 F C 31 1_555 1.508 0.332 -0.613 -10.279 -8.526 -30.441 30 Y_G16:C31_Y Y 16 ? Y 31 ? ? 1 1 F C 17 1_555 F G 30 1_555 -0.575 -0.223 0.423 0.644 -4.750 -10.623 31 Y_C17:G30_Y Y 17 ? Y 30 ? 19 1 1 F C 18 1_555 F G 29 1_555 -0.085 -0.333 0.019 2.069 -0.811 -7.737 32 Y_C18:G29_Y Y 18 ? Y 29 ? 19 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 E G 1 1_555 E C 45 1_555 E G 2 1_555 E C 44 1_555 -0.170 -1.930 3.617 5.014 15.092 39.324 -4.224 0.750 2.692 21.395 -7.108 42.300 1 XX_G1G2:C44C45_XX X 1 ? X 45 ? X 2 ? X 44 ? 1 E G 2 1_555 E C 44 1_555 E A 3 1_555 E U 43 1_555 -0.131 -1.713 2.952 -10.351 7.094 26.973 -4.606 -1.589 2.330 14.269 20.821 29.699 2 XX_G2A3:U43C44_XX X 2 ? X 44 ? X 3 ? X 43 ? 1 E A 3 1_555 E U 43 1_555 E C 4 1_555 E G 42 1_555 0.535 -1.508 2.757 6.847 4.083 25.233 -4.196 0.339 2.540 9.063 -15.197 26.443 3 XX_A3C4:G42U43_XX X 3 ? X 43 ? X 4 ? X 42 ? 1 E C 4 1_555 E G 42 1_555 E C 5 1_555 E G 41 1_555 -0.451 -2.145 4.013 -2.835 14.295 26.709 -7.192 0.246 2.589 28.415 5.634 30.363 4 XX_C4C5:G41G42_XX X 4 ? X 42 ? X 5 ? X 41 ? 1 E C 5 1_555 E G 41 1_555 E U 6 1_555 E G 40 1_555 0.485 -1.821 3.865 -5.439 13.094 48.381 -3.183 -1.002 3.232 15.591 6.476 50.296 5 XX_C5U6:G40G41_XX X 5 ? X 41 ? X 6 ? X 40 ? 1 E U 6 1_555 E G 40 1_555 E C 8 1_555 E G 39 1_555 -1.542 -1.759 2.769 7.613 4.943 39.551 -2.965 2.882 2.221 7.191 -11.074 40.538 6 XX_U6C8:G39G40_XX X 6 ? X 40 ? X 8 ? X 39 ? 1 E C 8 1_555 E G 39 1_555 E U 9 1_555 E G 38 1_555 -0.789 -1.769 3.572 -0.961 7.116 43.873 -3.034 0.950 3.276 9.449 1.276 44.428 7 XX_C8U9:G38G39_XX X 8 ? X 39 ? X 9 ? X 38 ? 1 E U 9 1_555 E G 38 1_555 E C 11 1_555 E G 37 1_555 -3.570 -1.417 3.070 7.504 -1.315 41.983 -1.836 5.554 2.466 -1.817 -10.371 42.638 8 XX_U9C11:G37G38_XX X 9 ? X 38 ? X 11 ? X 37 ? 1 E C 11 1_555 E G 37 1_555 E G 12 1_555 E C 36 1_555 -0.708 -2.601 3.722 0.378 2.199 29.267 -5.657 1.488 3.512 4.345 -0.748 29.350 9 XX_C11G12:C36G37_XX X 11 ? X 37 ? X 12 ? X 36 ? 1 E G 12 1_555 E C 36 1_555 E A 13 1_555 E C 34 1_555 2.635 -1.397 2.912 -6.615 -1.914 34.994 -2.052 -5.100 2.460 -3.145 10.870 35.645 10 XX_G12A13:C34C36_XX X 12 ? X 36 ? X 13 ? X 34 ? 1 E A 13 1_555 E C 34 1_555 E G 14 1_555 E C 33 1_555 0.884 -1.512 3.449 -2.188 6.490 52.798 -2.111 -1.129 3.220 7.264 2.448 53.209 11 XX_A13G14:C33C34_XX X 13 ? X 34 ? X 14 ? X 33 ? 1 E G 14 1_555 E C 33 1_555 E C 15 1_555 E G 32 1_555 0.382 -2.253 3.172 -2.205 2.972 35.176 -4.120 -0.934 2.949 4.900 3.636 35.364 12 XX_G14C15:G32C33_XX X 14 ? X 33 ? X 15 ? X 32 ? 1 E C 15 1_555 E G 32 1_555 E G 16 1_555 E C 31 1_555 -0.585 -1.796 3.332 3.580 13.618 34.077 -4.534 1.372 2.393 22.104 -5.811 36.791 13 XX_C15G16:C31G32_XX X 15 ? X 32 ? X 16 ? X 31 ? 1 E G 16 1_555 E C 31 1_555 E C 17 1_555 E G 30 1_555 0.372 -2.330 3.038 -5.172 3.331 27.466 -5.477 -1.829 2.630 6.907 10.723 28.133 14 XX_G16C17:G30C31_XX X 16 ? X 31 ? X 17 ? X 30 ? 1 E C 17 1_555 E G 30 1_555 E C 18 1_555 E G 29 1_555 0.131 -2.117 3.318 3.993 -2.491 28.355 -3.681 0.674 3.472 -5.041 -8.080 28.735 15 XX_C17C18:G29G30_XX X 17 ? X 30 ? X 18 ? X 29 ? 1 F G 1 1_555 F C 45 1_555 F G 2 1_555 F C 44 1_555 -0.189 -1.585 3.449 2.628 12.224 40.484 -3.432 0.527 2.857 17.177 -3.693 42.293 16 YY_G1G2:C44C45_YY Y 1 ? Y 45 ? Y 2 ? Y 44 ? 1 F G 2 1_555 F C 44 1_555 F A 3 1_555 F U 43 1_555 -0.228 -1.739 2.957 -8.106 3.523 27.353 -4.205 -1.149 2.672 7.215 16.601 28.719 17 YY_G2A3:U43C44_YY Y 2 ? Y 44 ? Y 3 ? Y 43 ? 1 F A 3 1_555 F U 43 1_555 F C 4 1_555 F G 42 1_555 0.084 -1.060 2.951 4.402 0.369 35.005 -1.799 0.450 2.928 0.610 -7.283 35.274 18 YY_A3C4:G42U43_YY Y 3 ? Y 43 ? Y 4 ? Y 42 ? 1 F C 4 1_555 F G 42 1_555 F C 5 1_555 F G 41 1_555 -0.081 -3.135 3.879 -0.911 8.764 15.475 -14.978 -0.242 1.847 29.619 3.080 17.794 19 YY_C4C5:G41G42_YY Y 4 ? Y 42 ? Y 5 ? Y 41 ? 1 F C 5 1_555 F G 41 1_555 F U 6 1_555 F G 40 1_555 -0.129 -1.453 3.526 -1.169 8.574 49.607 -2.350 0.065 3.251 10.130 1.381 50.309 20 YY_C5U6:G40G41_YY Y 5 ? Y 41 ? Y 6 ? Y 40 ? 1 F U 6 1_555 F G 40 1_555 F C 8 1_555 F G 39 1_555 -1.379 -2.106 2.780 5.435 4.263 35.274 -3.891 2.844 2.288 6.953 -8.864 35.923 21 YY_U6C8:G39G40_YY Y 6 ? Y 40 ? Y 8 ? Y 39 ? 1 F C 8 1_555 F G 39 1_555 F U 9 1_555 F G 38 1_555 -0.384 -2.025 3.724 -0.316 7.468 42.615 -3.543 0.488 3.342 10.182 0.431 43.236 22 YY_C8U9:G38G39_YY Y 8 ? Y 39 ? Y 9 ? Y 38 ? 1 F U 9 1_555 F G 38 1_555 F C 11 1_555 F G 37 1_555 -3.425 -1.975 2.860 11.207 -9.361 41.016 -1.935 5.507 2.270 -12.878 -15.418 43.432 23 YY_U9C11:G37G38_YY Y 9 ? Y 38 ? Y 11 ? Y 37 ? 1 F C 11 1_555 F G 37 1_555 F G 12 1_555 F C 36 1_555 -0.224 -2.681 3.546 -7.179 5.956 27.576 -6.659 -1.144 2.882 12.065 14.543 29.082 24 YY_C11G12:C36G37_YY Y 11 ? Y 37 ? Y 12 ? Y 36 ? 1 F G 12 1_555 F C 36 1_555 F A 13 1_555 F C 34 1_555 4.005 -1.753 3.200 0.507 -1.491 37.616 -2.524 -6.140 3.316 -2.311 -0.785 37.648 25 YY_G12A13:C34C36_YY Y 12 ? Y 36 ? Y 13 ? Y 34 ? 1 F A 13 1_555 F C 34 1_555 F G 14 1_555 F C 33 1_555 0.351 -1.491 3.586 -0.223 10.207 41.183 -3.150 -0.510 3.144 14.248 0.312 42.376 26 YY_A13G14:C33C34_YY Y 13 ? Y 34 ? Y 14 ? Y 33 ? 1 F G 14 1_555 F C 33 1_555 F C 15 1_555 F G 32 1_555 -0.654 -2.239 3.178 0.570 3.144 35.430 -4.095 1.149 2.964 5.154 -0.935 35.570 27 YY_G14C15:G32C33_YY Y 14 ? Y 33 ? Y 15 ? Y 32 ? 1 F C 15 1_555 F G 32 1_555 F G 16 1_555 F C 31 1_555 -1.333 -1.708 3.844 2.780 13.167 36.231 -4.336 2.388 2.963 20.331 -4.293 38.571 28 YY_C15G16:C31G32_YY Y 15 ? Y 32 ? Y 16 ? Y 31 ? 1 F G 16 1_555 F C 31 1_555 F C 17 1_555 F G 30 1_555 0.425 -2.488 3.133 -7.770 1.112 21.974 -6.505 -3.495 2.698 2.804 19.598 23.317 29 YY_G16C17:G30C31_YY Y 16 ? Y 31 ? Y 17 ? Y 30 ? 1 F C 17 1_555 F G 30 1_555 F C 18 1_555 F G 29 1_555 0.482 -2.199 3.187 3.904 1.183 29.544 -4.513 -0.146 3.135 2.306 -7.609 29.818 30 YY_C17C18:G29G30_YY Y 17 ? Y 30 ? Y 18 ? Y 29 ? # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 2016YFA0500604 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1URN _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #