data_7DOC # _entry.id 7DOC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DOC pdb_00007doc 10.2210/pdb7doc/pdb WWPDB D_1300019838 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DOC _pdbx_database_status.recvd_initial_deposition_date 2020-12-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Quek, J.P.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-3827-8580 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 732 _citation.page_last 737 _citation.title '2-Cyanoisonicotinamide Conjugation: A Facile Approach to Generate Potent Peptide Inhibitors of the Zika Virus Protease.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.0c00657 _citation.pdbx_database_id_PubMed 34055219 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Patil, N.A.' 1 ? primary 'Quek, J.P.' 2 ? primary 'Schroeder, B.' 3 ? primary 'Morewood, R.' 4 ? primary 'Rademann, J.' 5 ? primary 'Luo, D.' 6 ? primary 'Nitsche, C.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7DOC _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.154 _cell.length_a_esd ? _cell.length_b 59.614 _cell.length_b_esd ? _cell.length_c 215.073 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DOC _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Core protein' 4347.659 2 3.4.21.91,3.6.1.15,3.6.4.13 ? ? ? 2 polymer man 'Core protein' 16342.598 1 3.4.21.91,3.6.1.15,3.6.4.13 ? ? ? 3 polymer man 'Genome polyprotein' 4218.545 1 3.4.21.91,3.6.1.15,3.6.4.13,2.1.1.56,2.1.1.57,2.7.7.48 ? ? ? 4 polymer man 'Core protein' 16213.484 1 3.4.21.91,3.6.1.15,3.6.4.13 ? ? ? 5 polymer man 'Serine protease subunit NS2B' 4361.686 1 ? ? ? ? 6 polymer man 'Core protein' 16944.318 1 3.4.21.91,3.6.1.15,3.6.4.13 ? ? ? 7 polymer man 'Genome polyprotein' 16370.678 1 ? ? ? ? 8 polymer syn '3-PYRIDIN-4-YL-2,4-DIHYDRO-INDENO[1,2-.C.]PYRAZOLE' 793.960 1 ? ? ? ? 9 water nat water 18.015 371 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;Envelope protein E,Flavivirin protease NS2B regulatory subunit,Flavivirin protease NS3 catalytic subunit,Genome polyprotein,Matrix protein,Non-structural protein 1,Non-structural protein 2A,Non-structural protein 2B,Non-structural protein 3,Non-structural protein 4A,Non-structural protein 4B,Peptide 2k,Peptide pr,Protein prM,RNA-directed RNA polymerase NS5,Serine protease NS3,Serine protease subunit NS2B,Small envelope protein M ; 2 ;Envelope protein E,Flavivirin protease NS2B regulatory subunit,Flavivirin protease NS3 catalytic subunit,Genome polyprotein,Matrix protein,Non-structural protein 1,Non-structural protein 2A,Non-structural protein 2B,Non-structural protein 3,Non-structural protein 4A,Non-structural protein 4B,Peptide 2k,Peptide pr,Protein prM,RNA-directed RNA polymerase NS5,Serine protease NS3,Serine protease subunit NS2B,Small envelope protein M ; 4 ;Envelope protein E,Flavivirin protease NS2B regulatory subunit,Flavivirin protease NS3 catalytic subunit,Genome polyprotein,Matrix protein,Non-structural protein 1,Non-structural protein 2A,Non-structural protein 2B,Non-structural protein 3,Non-structural protein 4A,Non-structural protein 4B,Peptide 2k,Peptide pr,Protein prM,RNA-directed RNA polymerase NS5,Serine protease NS3,Serine protease subunit NS2B,Small envelope protein M ; 5 'Flavivirin protease NS2B regulatory subunit,Non-structural protein 2B' 6 ;Envelope protein E,Flavivirin protease NS2B regulatory subunit,Flavivirin protease NS3 catalytic subunit,Genome polyprotein,Matrix protein,Non-structural protein 1,Non-structural protein 2A,Non-structural protein 2B,Non-structural protein 3,Non-structural protein 4A,Non-structural protein 4B,Peptide 2k,Peptide pr,Protein prM,RNA-directed RNA polymerase NS5,Serine protease NS3,Serine protease subunit NS2B,Small envelope protein M ; 7 'NS3 Protease' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVE DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVE A,G ? 2 'polypeptide(L)' no no ;ETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQ LLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGK ; ;ETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQ LLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGK ; B ? 3 'polypeptide(L)' no no DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV C ? 4 'polypeptide(L)' no no ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGK ; ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGK ; D ? 5 'polypeptide(L)' no no MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE E ? 6 'polypeptide(L)' no no ;KKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLS EVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKRE ; ;KKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLS EVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKRE ; F ? 7 'polypeptide(L)' no no ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; H ? 8 'polypeptide(L)' no yes '(HHC)GKRK' XGKRK I ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 MET n 1 3 TYR n 1 4 ILE n 1 5 GLU n 1 6 ARG n 1 7 ALA n 1 8 GLY n 1 9 ASP n 1 10 ILE n 1 11 THR n 1 12 TRP n 1 13 GLU n 1 14 LYS n 1 15 ASP n 1 16 ALA n 1 17 GLU n 1 18 VAL n 1 19 THR n 1 20 GLY n 1 21 ASN n 1 22 SER n 1 23 PRO n 1 24 ARG n 1 25 LEU n 1 26 ASP n 1 27 VAL n 1 28 ALA n 1 29 LEU n 1 30 ASP n 1 31 GLU n 1 32 SER n 1 33 GLY n 1 34 ASP n 1 35 PHE n 1 36 SER n 1 37 LEU n 1 38 VAL n 1 39 GLU n 2 1 GLU n 2 2 THR n 2 3 THR n 2 4 ASP n 2 5 GLY n 2 6 VAL n 2 7 TYR n 2 8 ARG n 2 9 VAL n 2 10 MET n 2 11 THR n 2 12 ARG n 2 13 ARG n 2 14 LEU n 2 15 LEU n 2 16 GLY n 2 17 SER n 2 18 THR n 2 19 GLN n 2 20 VAL n 2 21 GLY n 2 22 VAL n 2 23 GLY n 2 24 VAL n 2 25 MET n 2 26 GLN n 2 27 GLU n 2 28 GLY n 2 29 VAL n 2 30 PHE n 2 31 HIS n 2 32 THR n 2 33 MET n 2 34 TRP n 2 35 HIS n 2 36 VAL n 2 37 THR n 2 38 LYS n 2 39 GLY n 2 40 ALA n 2 41 ALA n 2 42 LEU n 2 43 ARG n 2 44 SER n 2 45 GLY n 2 46 GLU n 2 47 GLY n 2 48 ARG n 2 49 LEU n 2 50 ASP n 2 51 PRO n 2 52 TYR n 2 53 TRP n 2 54 GLY n 2 55 ASP n 2 56 VAL n 2 57 LYS n 2 58 GLN n 2 59 ASP n 2 60 LEU n 2 61 VAL n 2 62 SER n 2 63 TYR n 2 64 CYS n 2 65 GLY n 2 66 PRO n 2 67 TRP n 2 68 LYS n 2 69 LEU n 2 70 ASP n 2 71 ALA n 2 72 ALA n 2 73 TRP n 2 74 ASP n 2 75 GLY n 2 76 LEU n 2 77 SER n 2 78 GLU n 2 79 VAL n 2 80 GLN n 2 81 LEU n 2 82 LEU n 2 83 ALA n 2 84 VAL n 2 85 PRO n 2 86 PRO n 2 87 GLY n 2 88 GLU n 2 89 ARG n 2 90 ALA n 2 91 LYS n 2 92 ASN n 2 93 ILE n 2 94 GLN n 2 95 THR n 2 96 LEU n 2 97 PRO n 2 98 GLY n 2 99 ILE n 2 100 PHE n 2 101 LYS n 2 102 THR n 2 103 LYS n 2 104 ASP n 2 105 GLY n 2 106 ASP n 2 107 ILE n 2 108 GLY n 2 109 ALA n 2 110 VAL n 2 111 ALA n 2 112 LEU n 2 113 ASP n 2 114 TYR n 2 115 PRO n 2 116 ALA n 2 117 GLY n 2 118 THR n 2 119 SER n 2 120 GLY n 2 121 SER n 2 122 PRO n 2 123 ILE n 2 124 LEU n 2 125 ASP n 2 126 LYS n 2 127 CYS n 2 128 GLY n 2 129 ARG n 2 130 VAL n 2 131 ILE n 2 132 GLY n 2 133 LEU n 2 134 TYR n 2 135 GLY n 2 136 ASN n 2 137 GLY n 2 138 VAL n 2 139 VAL n 2 140 ILE n 2 141 LYS n 2 142 ASN n 2 143 GLY n 2 144 SER n 2 145 TYR n 2 146 VAL n 2 147 SER n 2 148 ALA n 2 149 ILE n 2 150 THR n 2 151 GLN n 2 152 GLY n 2 153 LYS n 3 1 ASP n 3 2 MET n 3 3 TYR n 3 4 ILE n 3 5 GLU n 3 6 ARG n 3 7 ALA n 3 8 GLY n 3 9 ASP n 3 10 ILE n 3 11 THR n 3 12 TRP n 3 13 GLU n 3 14 LYS n 3 15 ASP n 3 16 ALA n 3 17 GLU n 3 18 VAL n 3 19 THR n 3 20 GLY n 3 21 ASN n 3 22 SER n 3 23 PRO n 3 24 ARG n 3 25 LEU n 3 26 ASP n 3 27 VAL n 3 28 ALA n 3 29 LEU n 3 30 ASP n 3 31 GLU n 3 32 SER n 3 33 GLY n 3 34 ASP n 3 35 PHE n 3 36 SER n 3 37 LEU n 3 38 VAL n 4 1 THR n 4 2 THR n 4 3 ASP n 4 4 GLY n 4 5 VAL n 4 6 TYR n 4 7 ARG n 4 8 VAL n 4 9 MET n 4 10 THR n 4 11 ARG n 4 12 ARG n 4 13 LEU n 4 14 LEU n 4 15 GLY n 4 16 SER n 4 17 THR n 4 18 GLN n 4 19 VAL n 4 20 GLY n 4 21 VAL n 4 22 GLY n 4 23 VAL n 4 24 MET n 4 25 GLN n 4 26 GLU n 4 27 GLY n 4 28 VAL n 4 29 PHE n 4 30 HIS n 4 31 THR n 4 32 MET n 4 33 TRP n 4 34 HIS n 4 35 VAL n 4 36 THR n 4 37 LYS n 4 38 GLY n 4 39 ALA n 4 40 ALA n 4 41 LEU n 4 42 ARG n 4 43 SER n 4 44 GLY n 4 45 GLU n 4 46 GLY n 4 47 ARG n 4 48 LEU n 4 49 ASP n 4 50 PRO n 4 51 TYR n 4 52 TRP n 4 53 GLY n 4 54 ASP n 4 55 VAL n 4 56 LYS n 4 57 GLN n 4 58 ASP n 4 59 LEU n 4 60 VAL n 4 61 SER n 4 62 TYR n 4 63 CYS n 4 64 GLY n 4 65 PRO n 4 66 TRP n 4 67 LYS n 4 68 LEU n 4 69 ASP n 4 70 ALA n 4 71 ALA n 4 72 TRP n 4 73 ASP n 4 74 GLY n 4 75 LEU n 4 76 SER n 4 77 GLU n 4 78 VAL n 4 79 GLN n 4 80 LEU n 4 81 LEU n 4 82 ALA n 4 83 VAL n 4 84 PRO n 4 85 PRO n 4 86 GLY n 4 87 GLU n 4 88 ARG n 4 89 ALA n 4 90 LYS n 4 91 ASN n 4 92 ILE n 4 93 GLN n 4 94 THR n 4 95 LEU n 4 96 PRO n 4 97 GLY n 4 98 ILE n 4 99 PHE n 4 100 LYS n 4 101 THR n 4 102 LYS n 4 103 ASP n 4 104 GLY n 4 105 ASP n 4 106 ILE n 4 107 GLY n 4 108 ALA n 4 109 VAL n 4 110 ALA n 4 111 LEU n 4 112 ASP n 4 113 TYR n 4 114 PRO n 4 115 ALA n 4 116 GLY n 4 117 THR n 4 118 SER n 4 119 GLY n 4 120 SER n 4 121 PRO n 4 122 ILE n 4 123 LEU n 4 124 ASP n 4 125 LYS n 4 126 CYS n 4 127 GLY n 4 128 ARG n 4 129 VAL n 4 130 ILE n 4 131 GLY n 4 132 LEU n 4 133 TYR n 4 134 GLY n 4 135 ASN n 4 136 GLY n 4 137 VAL n 4 138 VAL n 4 139 ILE n 4 140 LYS n 4 141 ASN n 4 142 GLY n 4 143 SER n 4 144 TYR n 4 145 VAL n 4 146 SER n 4 147 ALA n 4 148 ILE n 4 149 THR n 4 150 GLN n 4 151 GLY n 4 152 LYS n 5 1 MET n 5 2 TYR n 5 3 ILE n 5 4 GLU n 5 5 ARG n 5 6 ALA n 5 7 GLY n 5 8 ASP n 5 9 ILE n 5 10 THR n 5 11 TRP n 5 12 GLU n 5 13 LYS n 5 14 ASP n 5 15 ALA n 5 16 GLU n 5 17 VAL n 5 18 THR n 5 19 GLY n 5 20 ASN n 5 21 SER n 5 22 PRO n 5 23 ARG n 5 24 LEU n 5 25 ASP n 5 26 VAL n 5 27 ALA n 5 28 LEU n 5 29 ASP n 5 30 GLU n 5 31 SER n 5 32 GLY n 5 33 ASP n 5 34 PHE n 5 35 SER n 5 36 LEU n 5 37 VAL n 5 38 GLU n 5 39 GLU n 6 1 LYS n 6 2 LYS n 6 3 GLY n 6 4 GLU n 6 5 THR n 6 6 THR n 6 7 ASP n 6 8 GLY n 6 9 VAL n 6 10 TYR n 6 11 ARG n 6 12 VAL n 6 13 MET n 6 14 THR n 6 15 ARG n 6 16 ARG n 6 17 LEU n 6 18 LEU n 6 19 GLY n 6 20 SER n 6 21 THR n 6 22 GLN n 6 23 VAL n 6 24 GLY n 6 25 VAL n 6 26 GLY n 6 27 VAL n 6 28 MET n 6 29 GLN n 6 30 GLU n 6 31 GLY n 6 32 VAL n 6 33 PHE n 6 34 HIS n 6 35 THR n 6 36 MET n 6 37 TRP n 6 38 HIS n 6 39 VAL n 6 40 THR n 6 41 LYS n 6 42 GLY n 6 43 ALA n 6 44 ALA n 6 45 LEU n 6 46 ARG n 6 47 SER n 6 48 GLY n 6 49 GLU n 6 50 GLY n 6 51 ARG n 6 52 LEU n 6 53 ASP n 6 54 PRO n 6 55 TYR n 6 56 TRP n 6 57 GLY n 6 58 ASP n 6 59 VAL n 6 60 LYS n 6 61 GLN n 6 62 ASP n 6 63 LEU n 6 64 VAL n 6 65 SER n 6 66 TYR n 6 67 CYS n 6 68 GLY n 6 69 PRO n 6 70 TRP n 6 71 LYS n 6 72 LEU n 6 73 ASP n 6 74 ALA n 6 75 ALA n 6 76 TRP n 6 77 ASP n 6 78 GLY n 6 79 LEU n 6 80 SER n 6 81 GLU n 6 82 VAL n 6 83 GLN n 6 84 LEU n 6 85 LEU n 6 86 ALA n 6 87 VAL n 6 88 PRO n 6 89 PRO n 6 90 GLY n 6 91 GLU n 6 92 ARG n 6 93 ALA n 6 94 LYS n 6 95 ASN n 6 96 ILE n 6 97 GLN n 6 98 THR n 6 99 LEU n 6 100 PRO n 6 101 GLY n 6 102 ILE n 6 103 PHE n 6 104 LYS n 6 105 THR n 6 106 LYS n 6 107 ASP n 6 108 GLY n 6 109 ASP n 6 110 ILE n 6 111 GLY n 6 112 ALA n 6 113 VAL n 6 114 ALA n 6 115 LEU n 6 116 ASP n 6 117 TYR n 6 118 PRO n 6 119 ALA n 6 120 GLY n 6 121 THR n 6 122 SER n 6 123 GLY n 6 124 SER n 6 125 PRO n 6 126 ILE n 6 127 LEU n 6 128 ASP n 6 129 LYS n 6 130 CYS n 6 131 GLY n 6 132 ARG n 6 133 VAL n 6 134 ILE n 6 135 GLY n 6 136 LEU n 6 137 TYR n 6 138 GLY n 6 139 ASN n 6 140 GLY n 6 141 VAL n 6 142 VAL n 6 143 ILE n 6 144 LYS n 6 145 ASN n 6 146 GLY n 6 147 SER n 6 148 TYR n 6 149 VAL n 6 150 SER n 6 151 ALA n 6 152 ILE n 6 153 THR n 6 154 GLN n 6 155 GLY n 6 156 LYS n 6 157 ARG n 6 158 GLU n 7 1 THR n 7 2 THR n 7 3 ASP n 7 4 GLY n 7 5 VAL n 7 6 TYR n 7 7 ARG n 7 8 VAL n 7 9 MET n 7 10 THR n 7 11 ARG n 7 12 ARG n 7 13 LEU n 7 14 LEU n 7 15 GLY n 7 16 SER n 7 17 THR n 7 18 GLN n 7 19 VAL n 7 20 GLY n 7 21 VAL n 7 22 GLY n 7 23 VAL n 7 24 MET n 7 25 GLN n 7 26 GLU n 7 27 GLY n 7 28 VAL n 7 29 PHE n 7 30 HIS n 7 31 THR n 7 32 MET n 7 33 TRP n 7 34 HIS n 7 35 VAL n 7 36 THR n 7 37 LYS n 7 38 GLY n 7 39 ALA n 7 40 ALA n 7 41 LEU n 7 42 ARG n 7 43 SER n 7 44 GLY n 7 45 GLU n 7 46 GLY n 7 47 ARG n 7 48 LEU n 7 49 ASP n 7 50 PRO n 7 51 TYR n 7 52 TRP n 7 53 GLY n 7 54 ASP n 7 55 VAL n 7 56 LYS n 7 57 GLN n 7 58 ASP n 7 59 LEU n 7 60 VAL n 7 61 SER n 7 62 TYR n 7 63 CYS n 7 64 GLY n 7 65 PRO n 7 66 TRP n 7 67 LYS n 7 68 LEU n 7 69 ASP n 7 70 ALA n 7 71 ALA n 7 72 TRP n 7 73 ASP n 7 74 GLY n 7 75 LEU n 7 76 SER n 7 77 GLU n 7 78 VAL n 7 79 GLN n 7 80 LEU n 7 81 LEU n 7 82 ALA n 7 83 VAL n 7 84 PRO n 7 85 PRO n 7 86 GLY n 7 87 GLU n 7 88 ARG n 7 89 ALA n 7 90 LYS n 7 91 ASN n 7 92 ILE n 7 93 GLN n 7 94 THR n 7 95 LEU n 7 96 PRO n 7 97 GLY n 7 98 ILE n 7 99 PHE n 7 100 LYS n 7 101 THR n 7 102 LYS n 7 103 ASP n 7 104 GLY n 7 105 ASP n 7 106 ILE n 7 107 GLY n 7 108 ALA n 7 109 VAL n 7 110 ALA n 7 111 LEU n 7 112 ASP n 7 113 TYR n 7 114 PRO n 7 115 ALA n 7 116 GLY n 7 117 THR n 7 118 SER n 7 119 GLY n 7 120 SER n 7 121 PRO n 7 122 ILE n 7 123 LEU n 7 124 ASP n 7 125 LYS n 7 126 CYS n 7 127 GLY n 7 128 ARG n 7 129 VAL n 7 130 ILE n 7 131 GLY n 7 132 LEU n 7 133 TYR n 7 134 GLY n 7 135 ASN n 7 136 GLY n 7 137 VAL n 7 138 VAL n 7 139 ILE n 7 140 LYS n 7 141 ASN n 7 142 GLY n 7 143 SER n 7 144 TYR n 7 145 VAL n 7 146 SER n 7 147 ALA n 7 148 ILE n 7 149 THR n 7 150 GLN n 7 151 GLY n 7 152 LYS n 7 153 ARG n 8 1 HHC n 8 2 GLY n 8 3 LYS n 8 4 ARG n 8 5 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 39 ZIKV ? 'GP1, A2G93_72127gpGP1' ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 153 ZIKV ? 'GP1, A2G93_63394gpGP1' ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 sample 'Biological sequence' 1 38 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 sample 'Biological sequence' 1 152 ZIKV ? 'GP1, A2G93_63394gpGP1' ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 sample 'Biological sequence' 1 39 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 sample 'Biological sequence' 1 158 ZIKV ? 'GP1, A2G93_63394gpGP1' ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 sample 'Biological sequence' 1 153 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # _pdbx_entity_src_syn.entity_id 8 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 5 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A2R4LVW1_ZIKV A0A2R4LVW1 ? 1 DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVE 1418 2 UNP A0A142IX72_ZIKV A0A142IX72 ? 2 ;ETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQ LLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGK ; 1513 3 UNP POLG_ZIKV Q32ZE1 ? 3 DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV 1418 4 UNP A0A142IX72_ZIKV A0A142IX72 ? 4 ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGK ; 1514 5 UNP POLG_ZIKV Q32ZE1 ? 5 MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE 1419 6 UNP A0A142IX72_ZIKV A0A142IX72 ? 6 ;KKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLS EVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKRE ; 1510 7 UNP H8XX12_ZIKV H8XX12 ? 7 ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; 1514 8 PDB 7DOC 7DOC ? 8 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7DOC A 1 ? 39 ? A0A2R4LVW1 1418 ? 1456 ? 50 88 2 2 7DOC B 1 ? 153 ? A0A142IX72 1513 ? 1665 ? 17 169 3 3 7DOC C 1 ? 38 ? Q32ZE1 1418 ? 1455 ? 50 87 4 4 7DOC D 1 ? 152 ? A0A142IX72 1514 ? 1665 ? 18 169 5 5 7DOC E 1 ? 39 ? Q32ZE1 1419 ? 1457 ? 51 89 6 6 7DOC F 1 ? 158 ? A0A142IX72 1510 ? 1667 ? 14 171 7 1 7DOC G 1 ? 39 ? A0A2R4LVW1 1418 ? 1456 ? 50 88 8 7 7DOC H 1 ? 153 ? H8XX12 1514 ? 1666 ? 18 170 9 8 7DOC I 1 ? 5 ? 7DOC 1 ? 5 ? 1 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HHC non-polymer . '~{N}-[(2~{R})-2,3-bis(azanyl)-3-oxidanylidene-propyl]-2-[(4~{R})-4-methanoyl-4,5-dihydro-1,3-thiazol-2-yl]pyridine-4-carboxamide' ? 'C13 H15 N5 O3 S' 321.355 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DOC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.55 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Ammonium Sulfate, 0.1M Sodium Acetate Trihydrate pH 4.6, 30% Peg 2000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-03-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95373 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95373 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7DOC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.904 _reflns.d_resolution_low 45.63 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 60261 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.39 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.2 _reflns.pdbx_Rmerge_I_obs 0.1312 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1365 _reflns.pdbx_Rpim_I_all 0.03716 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.904 _reflns_shell.d_res_low 1.972 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5640 _reflns_shell.percent_possible_all 94.08 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.8121 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.8459 _reflns_shell.pdbx_Rpim_I_all 0.2344 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.925 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 145.190 _refine.B_iso_mean 45.9095 _refine.B_iso_min 23.600 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DOC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9040 _refine.ls_d_res_low 45.63 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 60243 _refine.ls_number_reflns_R_free 2981 _refine.ls_number_reflns_R_work 57210 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4000 _refine.ls_percent_reflns_R_free 4.9700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2286 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2092 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5GPI _refine.pdbx_stereochemistry_target_values TWIN_LSQ_F _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9040 _refine_hist.d_res_low 45.63 _refine_hist.number_atoms_solvent 371 _refine_hist.number_atoms_total 5976 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 765 _refine_hist.pdbx_B_iso_mean_ligand 73.40 _refine_hist.pdbx_B_iso_mean_solvent 50.76 _refine_hist.pdbx_number_atoms_protein 5501 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 104 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 436 3.480 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? C 436 3.480 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? E 436 3.480 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? G 436 3.480 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 5 TORSIONAL ? B 1720 3.480 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 6 TORSIONAL ? D 1720 3.480 ? 2 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 7 TORSIONAL ? F 1720 3.480 ? 2 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 8 TORSIONAL ? H 1720 3.480 ? 2 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.904 _refine_ls_shell.d_res_low 1.972 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 281 _refine_ls_shell.number_reflns_R_work 5630 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2750 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2947 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; 1 2 '(chain C and (resid 51 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87))' 1 3 ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; 1 4 ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; 2 1 ;(chain B and (resid 18 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; 2 2 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; 2 3 ;(chain F and (resid 18 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; 2 4 ;(chain H and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 or (resid 119 through 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? A 51 A 61 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 2 ? A 62 A 66 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 3 ? A 50 A 88 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 4 ? A 50 A 88 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 5 ? A 50 A 88 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 6 ? A 50 A 88 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 7 ? A 73 A 73 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 8 ? A 50 A 88 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 9 ? A 50 A 88 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 10 ? A 50 A 88 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 1 11 ? A 50 A 88 ;(chain A and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 72 or (resid 73 and (name N or name CA or name C or name O or name CB )) or resid 74 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 2 1 ? C 51 C 65 '(chain C and (resid 51 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87))' ? ? ? ? ? ? ? ? ? ? 1 2 2 ? C 66 C 66 '(chain C and (resid 51 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87))' ? ? ? ? ? ? ? ? ? ? 1 2 3 ? C 50 C 87 '(chain C and (resid 51 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87))' ? ? ? ? ? ? ? ? ? ? 1 2 4 ? C 50 C 87 '(chain C and (resid 51 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87))' ? ? ? ? ? ? ? ? ? ? 1 2 5 ? C 50 C 87 '(chain C and (resid 51 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87))' ? ? ? ? ? ? ? ? ? ? 1 2 6 ? C 50 C 87 '(chain C and (resid 51 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87))' ? ? ? ? ? ? ? ? ? ? 1 3 1 ? E 51 E 61 ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 3 2 ? E 62 E 66 ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 3 3 ? E 51 E 89 ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 3 4 ? E 51 E 89 ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 3 5 ? E 51 E 89 ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 3 6 ? E 51 E 89 ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 4 1 ? G 51 G 61 ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 4 2 ? G 62 G 66 ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 4 3 ? G 50 G 88 ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 4 4 ? G 50 G 88 ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 4 5 ? G 50 G 88 ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 1 4 6 ? G 50 G 88 ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 87)) ; ? ? ? ? ? ? ? ? ? ? 2 1 1 ? B 18 B 29 ;(chain B and (resid 18 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 1 2 ? B 30 B 30 ;(chain B and (resid 18 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 1 3 ? B 17 B 169 ;(chain B and (resid 18 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 1 4 ? B 17 B 169 ;(chain B and (resid 18 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 1 5 ? B 17 B 169 ;(chain B and (resid 18 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 1 6 ? B 17 B 169 ;(chain B and (resid 18 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 1 ? D 18 D 30 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 2 ? D 34 D 53 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 3 ? D 54 D 54 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 4 ? D 18 D 169 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 5 ? D 0 D 0 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 6 ? D 64 D 65 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 7 ? D 18 D 169 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 8 ? D 18 D 169 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 9 ? D 18 D 169 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 2 10 ? D 18 D 169 ;(chain D and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 3 1 ? F 18 F 60 ;(chain F and (resid 18 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 3 2 ? F 64 F 65 ;(chain F and (resid 18 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 3 3 ? F 14 F 171 ;(chain F and (resid 18 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 3 4 ? F 14 F 171 ;(chain F and (resid 18 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 3 5 ? F 14 F 171 ;(chain F and (resid 18 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 3 6 ? F 14 F 171 ;(chain F and (resid 18 through 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 4 1 ? H 18 H 30 ;(chain H and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 or (resid 119 through 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 4 2 ? H 34 H 53 ;(chain H and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 or (resid 119 through 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 4 3 ? H 54 H 54 ;(chain H and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 or (resid 119 through 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 4 4 ? H 18 H 170 ;(chain H and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 or (resid 119 through 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 4 5 ? H 18 H 170 ;(chain H and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 or (resid 119 through 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 4 6 ? H 18 H 170 ;(chain H and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 or (resid 119 through 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? 2 4 7 ? H 18 H 170 ;(chain H and (resid 18 through 30 or resid 34 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 or (resid 64 through 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 93 or (resid 94 and (name N or name CA or name C or name O or name CB )) or resid 95 through 106 or (resid 107 and (name N or name CA or name C or name O or name CB )) or resid 108 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 or (resid 119 through 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB )) or resid 146 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 169)) ; ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 7DOC _struct.title 'Crystal structure of Zika NS2B-NS3 protease with compound 5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DOC _struct_keywords.text 'Viral protease, Protease inhibitor complex, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 1 ? H N N 7 ? I N N 8 ? J N N 9 ? K N N 9 ? L N N 9 ? M N N 9 ? N N N 9 ? O N N 9 ? P N N 9 ? Q N N 9 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET B 33 ? LYS B 38 ? MET B 49 LYS B 54 1 ? 6 HELX_P HELX_P2 AA2 PRO B 115 ? SER B 119 ? PRO B 131 SER B 135 5 ? 5 HELX_P HELX_P3 AA3 MET D 32 ? LYS D 37 ? MET D 49 LYS D 54 1 ? 6 HELX_P HELX_P4 AA4 PRO D 114 ? SER D 118 ? PRO D 131 SER D 135 5 ? 5 HELX_P HELX_P5 AA5 MET F 36 ? LYS F 41 ? MET F 49 LYS F 54 1 ? 6 HELX_P HELX_P6 AA6 PRO F 118 ? SER F 122 ? PRO F 131 SER F 135 5 ? 5 HELX_P HELX_P7 AA7 MET H 32 ? LYS H 37 ? MET H 49 LYS H 54 1 ? 6 HELX_P HELX_P8 AA8 PRO H 114 ? SER H 118 ? PRO H 131 SER H 135 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id I _struct_conn.ptnr1_label_comp_id HHC _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id I _struct_conn.ptnr2_label_comp_id GLY _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id I _struct_conn.ptnr1_auth_comp_id HHC _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id I _struct_conn.ptnr2_auth_comp_id GLY _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.443 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 14 ? AA2 ? 5 ? AA3 ? 7 ? AA4 ? 8 ? AA5 ? 5 ? AA6 ? 6 ? AA7 ? 5 ? AA8 ? 6 ? AA9 ? 8 ? AB1 ? 5 ? AB2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel AA1 13 14 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel AA4 7 8 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA6 5 6 ? anti-parallel AA7 1 2 ? parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA7 4 5 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? parallel AA8 3 4 ? anti-parallel AA8 4 5 ? anti-parallel AA8 5 6 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? parallel AA9 3 4 ? anti-parallel AA9 4 5 ? anti-parallel AA9 5 6 ? anti-parallel AA9 6 7 ? anti-parallel AA9 7 8 ? anti-parallel AB1 1 2 ? parallel AB1 2 3 ? anti-parallel AB1 3 4 ? anti-parallel AB1 4 5 ? anti-parallel AB2 1 2 ? anti-parallel AB2 2 3 ? parallel AB2 3 4 ? anti-parallel AB2 4 5 ? anti-parallel AB2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY B 47 ? LEU B 49 ? GLY B 63 LEU B 65 AA1 2 LEU B 42 ? SER B 44 ? LEU B 58 SER B 60 AA1 3 MET A 2 ? GLY A 8 ? MET A 51 GLY A 57 AA1 4 GLY B 5 ? THR B 11 ? GLY B 21 THR B 27 AA1 5 THR B 18 ? GLN B 26 ? THR B 34 GLN B 42 AA1 6 VAL B 29 ? THR B 32 ? VAL B 45 THR B 48 AA1 7 LEU B 60 ? TYR B 63 ? LEU B 76 TYR B 79 AA1 8 PRO B 51 ? ASP B 55 ? PRO B 67 ASP B 71 AA1 9 PRO F 54 ? ASP F 58 ? PRO F 67 ASP F 71 AA1 10 LEU F 63 ? TYR F 66 ? LEU F 76 TYR F 79 AA1 11 VAL F 32 ? THR F 35 ? VAL F 45 THR F 48 AA1 12 GLN F 22 ? GLN F 29 ? GLN F 35 GLN F 42 AA1 13 GLY F 8 ? MET F 13 ? GLY F 21 MET F 26 AA1 14 TYR E 2 ? GLY E 7 ? TYR E 52 GLY E 57 AA2 1 GLU A 17 ? VAL A 18 ? GLU A 66 VAL A 67 AA2 2 LYS B 91 ? THR B 95 ? LYS B 107 THR B 111 AA2 3 VAL B 79 ? ALA B 83 ? VAL B 95 ALA B 99 AA2 4 SER B 121 ? LEU B 124 ? SER B 137 LEU B 140 AA2 5 VAL B 130 ? TYR B 134 ? VAL B 146 TYR B 150 AA3 1 PHE A 35 ? LEU A 37 ? PHE A 84 LEU A 86 AA3 2 ARG A 24 ? LEU A 29 ? ARG A 73 LEU A 78 AA3 3 GLY B 98 ? THR B 102 ? GLY B 114 THR B 118 AA3 4 GLY B 105 ? VAL B 110 ? GLY B 121 VAL B 126 AA3 5 TYR B 145 ? ALA B 148 ? TYR B 161 ALA B 164 AA3 6 ASN B 136 ? VAL B 139 ? ASN B 152 VAL B 155 AA3 7 LYS I 3 ? ARG I 4 ? LYS I 3 ARG I 4 AA4 1 GLY D 46 ? LEU D 48 ? GLY D 63 LEU D 65 AA4 2 LEU D 41 ? SER D 43 ? LEU D 58 SER D 60 AA4 3 MET C 2 ? GLY C 8 ? MET C 51 GLY C 57 AA4 4 GLY D 4 ? THR D 10 ? GLY D 21 THR D 27 AA4 5 THR D 17 ? GLN D 25 ? THR D 34 GLN D 42 AA4 6 VAL D 28 ? THR D 31 ? VAL D 45 THR D 48 AA4 7 LEU D 59 ? TYR D 62 ? LEU D 76 TYR D 79 AA4 8 PRO D 50 ? ASP D 54 ? PRO D 67 ASP D 71 AA5 1 GLU C 17 ? VAL C 18 ? GLU C 66 VAL C 67 AA5 2 LYS D 90 ? THR D 94 ? LYS D 107 THR D 111 AA5 3 VAL D 78 ? ALA D 82 ? VAL D 95 ALA D 99 AA5 4 SER D 120 ? LEU D 123 ? SER D 137 LEU D 140 AA5 5 VAL D 129 ? TYR D 133 ? VAL D 146 TYR D 150 AA6 1 PHE C 35 ? LEU C 37 ? PHE C 84 LEU C 86 AA6 2 ARG C 24 ? LEU C 29 ? ARG C 73 LEU C 78 AA6 3 GLY D 97 ? THR D 101 ? GLY D 114 THR D 118 AA6 4 GLY D 104 ? VAL D 109 ? GLY D 121 VAL D 126 AA6 5 TYR D 144 ? ALA D 147 ? TYR D 161 ALA D 164 AA6 6 GLY D 136 ? VAL D 138 ? GLY D 153 VAL D 155 AA7 1 GLU E 16 ? VAL E 17 ? GLU E 66 VAL E 67 AA7 2 LYS F 94 ? THR F 98 ? LYS F 107 THR F 111 AA7 3 VAL F 82 ? ALA F 86 ? VAL F 95 ALA F 99 AA7 4 SER F 124 ? LEU F 127 ? SER F 137 LEU F 140 AA7 5 VAL F 133 ? TYR F 137 ? VAL F 146 TYR F 150 AA8 1 PHE E 34 ? LEU E 36 ? PHE E 84 LEU E 86 AA8 2 ARG E 23 ? LEU E 28 ? ARG E 73 LEU E 78 AA8 3 GLY F 101 ? THR F 105 ? GLY F 114 THR F 118 AA8 4 GLY F 108 ? VAL F 113 ? GLY F 121 VAL F 126 AA8 5 TYR F 148 ? ALA F 151 ? TYR F 161 ALA F 164 AA8 6 GLY F 140 ? VAL F 142 ? GLY F 153 VAL F 155 AA9 1 GLY H 46 ? LEU H 48 ? GLY H 63 LEU H 65 AA9 2 LEU H 41 ? SER H 43 ? LEU H 58 SER H 60 AA9 3 MET G 2 ? GLY G 8 ? MET G 51 GLY G 57 AA9 4 GLY H 4 ? THR H 10 ? GLY H 21 THR H 27 AA9 5 THR H 17 ? GLN H 25 ? THR H 34 GLN H 42 AA9 6 VAL H 28 ? THR H 31 ? VAL H 45 THR H 48 AA9 7 LEU H 59 ? TYR H 62 ? LEU H 76 TYR H 79 AA9 8 PRO H 50 ? ASP H 54 ? PRO H 67 ASP H 71 AB1 1 GLU G 17 ? VAL G 18 ? GLU G 66 VAL G 67 AB1 2 LYS H 90 ? THR H 94 ? LYS H 107 THR H 111 AB1 3 VAL H 78 ? ALA H 82 ? VAL H 95 ALA H 99 AB1 4 SER H 120 ? LEU H 123 ? SER H 137 LEU H 140 AB1 5 VAL H 129 ? TYR H 133 ? VAL H 146 TYR H 150 AB2 1 PHE G 35 ? LEU G 37 ? PHE G 84 LEU G 86 AB2 2 ARG G 24 ? LEU G 29 ? ARG G 73 LEU G 78 AB2 3 GLY H 97 ? THR H 101 ? GLY H 114 THR H 118 AB2 4 GLY H 104 ? VAL H 109 ? GLY H 121 VAL H 126 AB2 5 TYR H 144 ? ALA H 147 ? TYR H 161 ALA H 164 AB2 6 GLY H 136 ? VAL H 138 ? GLY H 153 VAL H 155 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU B 49 ? O LEU B 65 N LEU B 42 ? N LEU B 58 AA1 2 3 O ARG B 43 ? O ARG B 59 N MET A 2 ? N MET A 51 AA1 3 4 N ALA A 7 ? N ALA A 56 O VAL B 6 ? O VAL B 22 AA1 4 5 N GLY B 5 ? N GLY B 21 O MET B 25 ? O MET B 41 AA1 5 6 N VAL B 24 ? N VAL B 40 O HIS B 31 ? O HIS B 47 AA1 6 7 N THR B 32 ? N THR B 48 O VAL B 61 ? O VAL B 77 AA1 7 8 O SER B 62 ? O SER B 78 N TRP B 53 ? N TRP B 69 AA1 8 9 N GLY B 54 ? N GLY B 70 O GLY F 57 ? O GLY F 70 AA1 9 10 N TRP F 56 ? N TRP F 69 O SER F 65 ? O SER F 78 AA1 10 11 O VAL F 64 ? O VAL F 77 N THR F 35 ? N THR F 48 AA1 11 12 O HIS F 34 ? O HIS F 47 N VAL F 27 ? N VAL F 40 AA1 12 13 O MET F 28 ? O MET F 41 N GLY F 8 ? N GLY F 21 AA1 13 14 O VAL F 9 ? O VAL F 22 N ALA E 6 ? N ALA E 56 AA2 1 2 N GLU A 17 ? N GLU A 66 O GLN B 94 ? O GLN B 110 AA2 2 3 O ILE B 93 ? O ILE B 109 N LEU B 81 ? N LEU B 97 AA2 3 4 N GLN B 80 ? N GLN B 96 O LEU B 124 ? O LEU B 140 AA2 4 5 N ILE B 123 ? N ILE B 139 O ILE B 131 ? O ILE B 147 AA3 1 2 O SER A 36 ? O SER A 85 N ALA A 28 ? N ALA A 77 AA3 2 3 N LEU A 25 ? N LEU A 74 O LYS B 101 ? O LYS B 117 AA3 3 4 N PHE B 100 ? N PHE B 116 O ILE B 107 ? O ILE B 123 AA3 4 5 N VAL B 110 ? N VAL B 126 O SER B 147 ? O SER B 163 AA3 5 6 O VAL B 146 ? O VAL B 162 N VAL B 138 ? N VAL B 154 AA3 6 7 N GLY B 137 ? N GLY B 153 O LYS I 3 ? O LYS I 3 AA4 1 2 O LEU D 48 ? O LEU D 65 N LEU D 41 ? N LEU D 58 AA4 2 3 O ARG D 42 ? O ARG D 59 N ILE C 4 ? N ILE C 53 AA4 3 4 N ALA C 7 ? N ALA C 56 O VAL D 5 ? O VAL D 22 AA4 4 5 N VAL D 8 ? N VAL D 25 O GLY D 20 ? O GLY D 37 AA4 5 6 N VAL D 23 ? N VAL D 40 O HIS D 30 ? O HIS D 47 AA4 6 7 N THR D 31 ? N THR D 48 O VAL D 60 ? O VAL D 77 AA4 7 8 O SER D 61 ? O SER D 78 N TRP D 52 ? N TRP D 69 AA5 1 2 N GLU C 17 ? N GLU C 66 O GLN D 93 ? O GLN D 110 AA5 2 3 O THR D 94 ? O THR D 111 N VAL D 78 ? N VAL D 95 AA5 3 4 N GLN D 79 ? N GLN D 96 O LEU D 123 ? O LEU D 140 AA5 4 5 N ILE D 122 ? N ILE D 139 O ILE D 130 ? O ILE D 147 AA6 1 2 O SER C 36 ? O SER C 85 N ALA C 28 ? N ALA C 77 AA6 2 3 N LEU C 25 ? N LEU C 74 O LYS D 100 ? O LYS D 117 AA6 3 4 N GLY D 97 ? N GLY D 114 O ALA D 108 ? O ALA D 125 AA6 4 5 N VAL D 109 ? N VAL D 126 O SER D 146 ? O SER D 163 AA6 5 6 O VAL D 145 ? O VAL D 162 N VAL D 137 ? N VAL D 154 AA7 1 2 N GLU E 16 ? N GLU E 66 O GLN F 97 ? O GLN F 110 AA7 2 3 O THR F 98 ? O THR F 111 N VAL F 82 ? N VAL F 95 AA7 3 4 N GLN F 83 ? N GLN F 96 O LEU F 127 ? O LEU F 140 AA7 4 5 N ILE F 126 ? N ILE F 139 O ILE F 134 ? O ILE F 147 AA8 1 2 O SER E 35 ? O SER E 85 N ALA E 27 ? N ALA E 77 AA8 2 3 N LEU E 24 ? N LEU E 74 O LYS F 104 ? O LYS F 117 AA8 3 4 N GLY F 101 ? N GLY F 114 O ALA F 112 ? O ALA F 125 AA8 4 5 N VAL F 113 ? N VAL F 126 O SER F 150 ? O SER F 163 AA8 5 6 O VAL F 149 ? O VAL F 162 N VAL F 141 ? N VAL F 154 AA9 1 2 O LEU H 48 ? O LEU H 65 N LEU H 41 ? N LEU H 58 AA9 2 3 O ARG H 42 ? O ARG H 59 N ILE G 4 ? N ILE G 53 AA9 3 4 N ALA G 7 ? N ALA G 56 O VAL H 5 ? O VAL H 22 AA9 4 5 N THR H 10 ? N THR H 27 O THR H 17 ? O THR H 34 AA9 5 6 N VAL H 23 ? N VAL H 40 O HIS H 30 ? O HIS H 47 AA9 6 7 N THR H 31 ? N THR H 48 O VAL H 60 ? O VAL H 77 AA9 7 8 O SER H 61 ? O SER H 78 N TYR H 51 ? N TYR H 68 AB1 1 2 N GLU G 17 ? N GLU G 66 O GLN H 93 ? O GLN H 110 AB1 2 3 O ILE H 92 ? O ILE H 109 N LEU H 80 ? N LEU H 97 AB1 3 4 N GLN H 79 ? N GLN H 96 O LEU H 123 ? O LEU H 140 AB1 4 5 N ILE H 122 ? N ILE H 139 O ILE H 130 ? O ILE H 147 AB2 1 2 O SER G 36 ? O SER G 85 N ALA G 28 ? N ALA G 77 AB2 2 3 N LEU G 25 ? N LEU G 74 O LYS H 100 ? O LYS H 117 AB2 3 4 N PHE H 99 ? N PHE H 116 O ILE H 106 ? O ILE H 123 AB2 4 5 N VAL H 109 ? N VAL H 126 O SER H 146 ? O SER H 163 AB2 5 6 O VAL H 145 ? O VAL H 162 N VAL H 137 ? N VAL H 154 # _atom_sites.entry_id 7DOC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016905 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016775 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004650 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 50 50 ASP ASP A . n A 1 2 MET 2 51 51 MET MET A . n A 1 3 TYR 3 52 52 TYR TYR A . n A 1 4 ILE 4 53 53 ILE ILE A . n A 1 5 GLU 5 54 54 GLU GLU A . n A 1 6 ARG 6 55 55 ARG ARG A . n A 1 7 ALA 7 56 56 ALA ALA A . n A 1 8 GLY 8 57 57 GLY GLY A . n A 1 9 ASP 9 58 58 ASP ASP A . n A 1 10 ILE 10 59 59 ILE ILE A . n A 1 11 THR 11 60 60 THR THR A . n A 1 12 TRP 12 61 61 TRP TRP A . n A 1 13 GLU 13 62 62 GLU GLU A . n A 1 14 LYS 14 63 63 LYS LYS A . n A 1 15 ASP 15 64 64 ASP ASP A . n A 1 16 ALA 16 65 65 ALA ALA A . n A 1 17 GLU 17 66 66 GLU GLU A . n A 1 18 VAL 18 67 67 VAL VAL A . n A 1 19 THR 19 68 68 THR THR A . n A 1 20 GLY 20 69 69 GLY GLY A . n A 1 21 ASN 21 70 70 ASN ASN A . n A 1 22 SER 22 71 71 SER SER A . n A 1 23 PRO 23 72 72 PRO PRO A . n A 1 24 ARG 24 73 73 ARG ARG A . n A 1 25 LEU 25 74 74 LEU LEU A . n A 1 26 ASP 26 75 75 ASP ASP A . n A 1 27 VAL 27 76 76 VAL VAL A . n A 1 28 ALA 28 77 77 ALA ALA A . n A 1 29 LEU 29 78 78 LEU LEU A . n A 1 30 ASP 30 79 79 ASP ASP A . n A 1 31 GLU 31 80 80 GLU GLU A . n A 1 32 SER 32 81 81 SER SER A . n A 1 33 GLY 33 82 82 GLY GLY A . n A 1 34 ASP 34 83 83 ASP ASP A . n A 1 35 PHE 35 84 84 PHE PHE A . n A 1 36 SER 36 85 85 SER SER A . n A 1 37 LEU 37 86 86 LEU LEU A . n A 1 38 VAL 38 87 87 VAL VAL A . n A 1 39 GLU 39 88 88 GLU GLU A . n B 2 1 GLU 1 17 17 GLU GLU B . n B 2 2 THR 2 18 18 THR THR B . n B 2 3 THR 3 19 19 THR THR B . n B 2 4 ASP 4 20 20 ASP ASP B . n B 2 5 GLY 5 21 21 GLY GLY B . n B 2 6 VAL 6 22 22 VAL VAL B . n B 2 7 TYR 7 23 23 TYR TYR B . n B 2 8 ARG 8 24 24 ARG ARG B . n B 2 9 VAL 9 25 25 VAL VAL B . n B 2 10 MET 10 26 26 MET MET B . n B 2 11 THR 11 27 27 THR THR B . n B 2 12 ARG 12 28 28 ARG ARG B . n B 2 13 ARG 13 29 29 ARG ARG B . n B 2 14 LEU 14 30 30 LEU LEU B . n B 2 15 LEU 15 31 31 LEU LEU B . n B 2 16 GLY 16 32 32 GLY GLY B . n B 2 17 SER 17 33 33 SER SER B . n B 2 18 THR 18 34 34 THR THR B . n B 2 19 GLN 19 35 35 GLN GLN B . n B 2 20 VAL 20 36 36 VAL VAL B . n B 2 21 GLY 21 37 37 GLY GLY B . n B 2 22 VAL 22 38 38 VAL VAL B . n B 2 23 GLY 23 39 39 GLY GLY B . n B 2 24 VAL 24 40 40 VAL VAL B . n B 2 25 MET 25 41 41 MET MET B . n B 2 26 GLN 26 42 42 GLN GLN B . n B 2 27 GLU 27 43 43 GLU GLU B . n B 2 28 GLY 28 44 44 GLY GLY B . n B 2 29 VAL 29 45 45 VAL VAL B . n B 2 30 PHE 30 46 46 PHE PHE B . n B 2 31 HIS 31 47 47 HIS HIS B . n B 2 32 THR 32 48 48 THR THR B . n B 2 33 MET 33 49 49 MET MET B . n B 2 34 TRP 34 50 50 TRP TRP B . n B 2 35 HIS 35 51 51 HIS HIS B . n B 2 36 VAL 36 52 52 VAL VAL B . n B 2 37 THR 37 53 53 THR THR B . n B 2 38 LYS 38 54 54 LYS LYS B . n B 2 39 GLY 39 55 55 GLY GLY B . n B 2 40 ALA 40 56 56 ALA ALA B . n B 2 41 ALA 41 57 57 ALA ALA B . n B 2 42 LEU 42 58 58 LEU LEU B . n B 2 43 ARG 43 59 59 ARG ARG B . n B 2 44 SER 44 60 60 SER SER B . n B 2 45 GLY 45 61 61 GLY GLY B . n B 2 46 GLU 46 62 62 GLU GLU B . n B 2 47 GLY 47 63 63 GLY GLY B . n B 2 48 ARG 48 64 64 ARG ARG B . n B 2 49 LEU 49 65 65 LEU LEU B . n B 2 50 ASP 50 66 66 ASP ASP B . n B 2 51 PRO 51 67 67 PRO PRO B . n B 2 52 TYR 52 68 68 TYR TYR B . n B 2 53 TRP 53 69 69 TRP TRP B . n B 2 54 GLY 54 70 70 GLY GLY B . n B 2 55 ASP 55 71 71 ASP ASP B . n B 2 56 VAL 56 72 72 VAL VAL B . n B 2 57 LYS 57 73 73 LYS LYS B . n B 2 58 GLN 58 74 74 GLN GLN B . n B 2 59 ASP 59 75 75 ASP ASP B . n B 2 60 LEU 60 76 76 LEU LEU B . n B 2 61 VAL 61 77 77 VAL VAL B . n B 2 62 SER 62 78 78 SER SER B . n B 2 63 TYR 63 79 79 TYR TYR B . n B 2 64 CYS 64 80 80 CYS CYS B . n B 2 65 GLY 65 81 81 GLY GLY B . n B 2 66 PRO 66 82 82 PRO PRO B . n B 2 67 TRP 67 83 83 TRP TRP B . n B 2 68 LYS 68 84 84 LYS LYS B . n B 2 69 LEU 69 85 85 LEU LEU B . n B 2 70 ASP 70 86 86 ASP ASP B . n B 2 71 ALA 71 87 87 ALA ALA B . n B 2 72 ALA 72 88 88 ALA ALA B . n B 2 73 TRP 73 89 89 TRP TRP B . n B 2 74 ASP 74 90 90 ASP ASP B . n B 2 75 GLY 75 91 91 GLY GLY B . n B 2 76 LEU 76 92 92 LEU LEU B . n B 2 77 SER 77 93 93 SER SER B . n B 2 78 GLU 78 94 94 GLU GLU B . n B 2 79 VAL 79 95 95 VAL VAL B . n B 2 80 GLN 80 96 96 GLN GLN B . n B 2 81 LEU 81 97 97 LEU LEU B . n B 2 82 LEU 82 98 98 LEU LEU B . n B 2 83 ALA 83 99 99 ALA ALA B . n B 2 84 VAL 84 100 100 VAL VAL B . n B 2 85 PRO 85 101 101 PRO PRO B . n B 2 86 PRO 86 102 102 PRO PRO B . n B 2 87 GLY 87 103 103 GLY GLY B . n B 2 88 GLU 88 104 104 GLU GLU B . n B 2 89 ARG 89 105 105 ARG ARG B . n B 2 90 ALA 90 106 106 ALA ALA B . n B 2 91 LYS 91 107 107 LYS LYS B . n B 2 92 ASN 92 108 108 ASN ASN B . n B 2 93 ILE 93 109 109 ILE ILE B . n B 2 94 GLN 94 110 110 GLN GLN B . n B 2 95 THR 95 111 111 THR THR B . n B 2 96 LEU 96 112 112 LEU LEU B . n B 2 97 PRO 97 113 113 PRO PRO B . n B 2 98 GLY 98 114 114 GLY GLY B . n B 2 99 ILE 99 115 115 ILE ILE B . n B 2 100 PHE 100 116 116 PHE PHE B . n B 2 101 LYS 101 117 117 LYS LYS B . n B 2 102 THR 102 118 118 THR THR B . n B 2 103 LYS 103 119 119 LYS LYS B . n B 2 104 ASP 104 120 120 ASP ASP B . n B 2 105 GLY 105 121 121 GLY GLY B . n B 2 106 ASP 106 122 122 ASP ASP B . n B 2 107 ILE 107 123 123 ILE ILE B . n B 2 108 GLY 108 124 124 GLY GLY B . n B 2 109 ALA 109 125 125 ALA ALA B . n B 2 110 VAL 110 126 126 VAL VAL B . n B 2 111 ALA 111 127 127 ALA ALA B . n B 2 112 LEU 112 128 128 LEU LEU B . n B 2 113 ASP 113 129 129 ASP ASP B . n B 2 114 TYR 114 130 130 TYR TYR B . n B 2 115 PRO 115 131 131 PRO PRO B . n B 2 116 ALA 116 132 132 ALA ALA B . n B 2 117 GLY 117 133 133 GLY GLY B . n B 2 118 THR 118 134 134 THR THR B . n B 2 119 SER 119 135 135 SER SER B . n B 2 120 GLY 120 136 136 GLY GLY B . n B 2 121 SER 121 137 137 SER SER B . n B 2 122 PRO 122 138 138 PRO PRO B . n B 2 123 ILE 123 139 139 ILE ILE B . n B 2 124 LEU 124 140 140 LEU LEU B . n B 2 125 ASP 125 141 141 ASP ASP B . n B 2 126 LYS 126 142 142 LYS LYS B . n B 2 127 CYS 127 143 143 CYS CYS B . n B 2 128 GLY 128 144 144 GLY GLY B . n B 2 129 ARG 129 145 145 ARG ARG B . n B 2 130 VAL 130 146 146 VAL VAL B . n B 2 131 ILE 131 147 147 ILE ILE B . n B 2 132 GLY 132 148 148 GLY GLY B . n B 2 133 LEU 133 149 149 LEU LEU B . n B 2 134 TYR 134 150 150 TYR TYR B . n B 2 135 GLY 135 151 151 GLY GLY B . n B 2 136 ASN 136 152 152 ASN ASN B . n B 2 137 GLY 137 153 153 GLY GLY B . n B 2 138 VAL 138 154 154 VAL VAL B . n B 2 139 VAL 139 155 155 VAL VAL B . n B 2 140 ILE 140 156 156 ILE ILE B . n B 2 141 LYS 141 157 157 LYS LYS B . n B 2 142 ASN 142 158 158 ASN ASN B . n B 2 143 GLY 143 159 159 GLY GLY B . n B 2 144 SER 144 160 160 SER SER B . n B 2 145 TYR 145 161 161 TYR TYR B . n B 2 146 VAL 146 162 162 VAL VAL B . n B 2 147 SER 147 163 163 SER SER B . n B 2 148 ALA 148 164 164 ALA ALA B . n B 2 149 ILE 149 165 165 ILE ILE B . n B 2 150 THR 150 166 166 THR THR B . n B 2 151 GLN 151 167 167 GLN GLN B . n B 2 152 GLY 152 168 168 GLY GLY B . n B 2 153 LYS 153 169 169 LYS LYS B . n C 3 1 ASP 1 50 50 ASP ASP C . n C 3 2 MET 2 51 51 MET MET C . n C 3 3 TYR 3 52 52 TYR TYR C . n C 3 4 ILE 4 53 53 ILE ILE C . n C 3 5 GLU 5 54 54 GLU GLU C . n C 3 6 ARG 6 55 55 ARG ARG C . n C 3 7 ALA 7 56 56 ALA ALA C . n C 3 8 GLY 8 57 57 GLY GLY C . n C 3 9 ASP 9 58 58 ASP ASP C . n C 3 10 ILE 10 59 59 ILE ILE C . n C 3 11 THR 11 60 60 THR THR C . n C 3 12 TRP 12 61 61 TRP TRP C . n C 3 13 GLU 13 62 62 GLU GLU C . n C 3 14 LYS 14 63 63 LYS LYS C . n C 3 15 ASP 15 64 64 ASP ASP C . n C 3 16 ALA 16 65 65 ALA ALA C . n C 3 17 GLU 17 66 66 GLU GLU C . n C 3 18 VAL 18 67 67 VAL VAL C . n C 3 19 THR 19 68 68 THR THR C . n C 3 20 GLY 20 69 69 GLY GLY C . n C 3 21 ASN 21 70 70 ASN ASN C . n C 3 22 SER 22 71 71 SER SER C . n C 3 23 PRO 23 72 72 PRO PRO C . n C 3 24 ARG 24 73 73 ARG ARG C . n C 3 25 LEU 25 74 74 LEU LEU C . n C 3 26 ASP 26 75 75 ASP ASP C . n C 3 27 VAL 27 76 76 VAL VAL C . n C 3 28 ALA 28 77 77 ALA ALA C . n C 3 29 LEU 29 78 78 LEU LEU C . n C 3 30 ASP 30 79 79 ASP ASP C . n C 3 31 GLU 31 80 80 GLU GLU C . n C 3 32 SER 32 81 81 SER SER C . n C 3 33 GLY 33 82 82 GLY GLY C . n C 3 34 ASP 34 83 83 ASP ASP C . n C 3 35 PHE 35 84 84 PHE PHE C . n C 3 36 SER 36 85 85 SER SER C . n C 3 37 LEU 37 86 86 LEU LEU C . n C 3 38 VAL 38 87 87 VAL VAL C . n D 4 1 THR 1 18 18 THR THR D . n D 4 2 THR 2 19 19 THR THR D . n D 4 3 ASP 3 20 20 ASP ASP D . n D 4 4 GLY 4 21 21 GLY GLY D . n D 4 5 VAL 5 22 22 VAL VAL D . n D 4 6 TYR 6 23 23 TYR TYR D . n D 4 7 ARG 7 24 24 ARG ARG D . n D 4 8 VAL 8 25 25 VAL VAL D . n D 4 9 MET 9 26 26 MET MET D . n D 4 10 THR 10 27 27 THR THR D . n D 4 11 ARG 11 28 28 ARG ARG D . n D 4 12 ARG 12 29 29 ARG ARG D . n D 4 13 LEU 13 30 30 LEU LEU D . n D 4 14 LEU 14 31 31 LEU LEU D . n D 4 15 GLY 15 32 32 GLY GLY D . n D 4 16 SER 16 33 33 SER SER D . n D 4 17 THR 17 34 34 THR THR D . n D 4 18 GLN 18 35 35 GLN GLN D . n D 4 19 VAL 19 36 36 VAL VAL D . n D 4 20 GLY 20 37 37 GLY GLY D . n D 4 21 VAL 21 38 38 VAL VAL D . n D 4 22 GLY 22 39 39 GLY GLY D . n D 4 23 VAL 23 40 40 VAL VAL D . n D 4 24 MET 24 41 41 MET MET D . n D 4 25 GLN 25 42 42 GLN GLN D . n D 4 26 GLU 26 43 43 GLU GLU D . n D 4 27 GLY 27 44 44 GLY GLY D . n D 4 28 VAL 28 45 45 VAL VAL D . n D 4 29 PHE 29 46 46 PHE PHE D . n D 4 30 HIS 30 47 47 HIS HIS D . n D 4 31 THR 31 48 48 THR THR D . n D 4 32 MET 32 49 49 MET MET D . n D 4 33 TRP 33 50 50 TRP TRP D . n D 4 34 HIS 34 51 51 HIS HIS D . n D 4 35 VAL 35 52 52 VAL VAL D . n D 4 36 THR 36 53 53 THR THR D . n D 4 37 LYS 37 54 54 LYS LYS D . n D 4 38 GLY 38 55 55 GLY GLY D . n D 4 39 ALA 39 56 56 ALA ALA D . n D 4 40 ALA 40 57 57 ALA ALA D . n D 4 41 LEU 41 58 58 LEU LEU D . n D 4 42 ARG 42 59 59 ARG ARG D . n D 4 43 SER 43 60 60 SER SER D . n D 4 44 GLY 44 61 61 GLY GLY D . n D 4 45 GLU 45 62 62 GLU GLU D . n D 4 46 GLY 46 63 63 GLY GLY D . n D 4 47 ARG 47 64 64 ARG ARG D . n D 4 48 LEU 48 65 65 LEU LEU D . n D 4 49 ASP 49 66 66 ASP ASP D . n D 4 50 PRO 50 67 67 PRO PRO D . n D 4 51 TYR 51 68 68 TYR TYR D . n D 4 52 TRP 52 69 69 TRP TRP D . n D 4 53 GLY 53 70 70 GLY GLY D . n D 4 54 ASP 54 71 71 ASP ASP D . n D 4 55 VAL 55 72 72 VAL VAL D . n D 4 56 LYS 56 73 73 LYS LYS D . n D 4 57 GLN 57 74 74 GLN GLN D . n D 4 58 ASP 58 75 75 ASP ASP D . n D 4 59 LEU 59 76 76 LEU LEU D . n D 4 60 VAL 60 77 77 VAL VAL D . n D 4 61 SER 61 78 78 SER SER D . n D 4 62 TYR 62 79 79 TYR TYR D . n D 4 63 CYS 63 80 80 CYS CYS D . n D 4 64 GLY 64 81 81 GLY GLY D . n D 4 65 PRO 65 82 82 PRO PRO D . n D 4 66 TRP 66 83 83 TRP TRP D . n D 4 67 LYS 67 84 84 LYS LYS D . n D 4 68 LEU 68 85 85 LEU LEU D . n D 4 69 ASP 69 86 86 ASP ASP D . n D 4 70 ALA 70 87 87 ALA ALA D . n D 4 71 ALA 71 88 88 ALA ALA D . n D 4 72 TRP 72 89 89 TRP TRP D . n D 4 73 ASP 73 90 90 ASP ASP D . n D 4 74 GLY 74 91 91 GLY GLY D . n D 4 75 LEU 75 92 92 LEU LEU D . n D 4 76 SER 76 93 93 SER SER D . n D 4 77 GLU 77 94 94 GLU GLU D . n D 4 78 VAL 78 95 95 VAL VAL D . n D 4 79 GLN 79 96 96 GLN GLN D . n D 4 80 LEU 80 97 97 LEU LEU D . n D 4 81 LEU 81 98 98 LEU LEU D . n D 4 82 ALA 82 99 99 ALA ALA D . n D 4 83 VAL 83 100 100 VAL VAL D . n D 4 84 PRO 84 101 101 PRO PRO D . n D 4 85 PRO 85 102 102 PRO PRO D . n D 4 86 GLY 86 103 103 GLY GLY D . n D 4 87 GLU 87 104 104 GLU GLU D . n D 4 88 ARG 88 105 105 ARG ARG D . n D 4 89 ALA 89 106 106 ALA ALA D . n D 4 90 LYS 90 107 107 LYS LYS D . n D 4 91 ASN 91 108 108 ASN ASN D . n D 4 92 ILE 92 109 109 ILE ILE D . n D 4 93 GLN 93 110 110 GLN GLN D . n D 4 94 THR 94 111 111 THR THR D . n D 4 95 LEU 95 112 112 LEU LEU D . n D 4 96 PRO 96 113 113 PRO PRO D . n D 4 97 GLY 97 114 114 GLY GLY D . n D 4 98 ILE 98 115 115 ILE ILE D . n D 4 99 PHE 99 116 116 PHE PHE D . n D 4 100 LYS 100 117 117 LYS LYS D . n D 4 101 THR 101 118 118 THR THR D . n D 4 102 LYS 102 119 119 LYS LYS D . n D 4 103 ASP 103 120 120 ASP ASP D . n D 4 104 GLY 104 121 121 GLY GLY D . n D 4 105 ASP 105 122 122 ASP ASP D . n D 4 106 ILE 106 123 123 ILE ILE D . n D 4 107 GLY 107 124 124 GLY GLY D . n D 4 108 ALA 108 125 125 ALA ALA D . n D 4 109 VAL 109 126 126 VAL VAL D . n D 4 110 ALA 110 127 127 ALA ALA D . n D 4 111 LEU 111 128 128 LEU LEU D . n D 4 112 ASP 112 129 129 ASP ASP D . n D 4 113 TYR 113 130 130 TYR TYR D . n D 4 114 PRO 114 131 131 PRO PRO D . n D 4 115 ALA 115 132 132 ALA ALA D . n D 4 116 GLY 116 133 133 GLY GLY D . n D 4 117 THR 117 134 134 THR THR D . n D 4 118 SER 118 135 135 SER SER D . n D 4 119 GLY 119 136 136 GLY GLY D . n D 4 120 SER 120 137 137 SER SER D . n D 4 121 PRO 121 138 138 PRO PRO D . n D 4 122 ILE 122 139 139 ILE ILE D . n D 4 123 LEU 123 140 140 LEU LEU D . n D 4 124 ASP 124 141 141 ASP ASP D . n D 4 125 LYS 125 142 142 LYS LYS D . n D 4 126 CYS 126 143 143 CYS CYS D . n D 4 127 GLY 127 144 144 GLY GLY D . n D 4 128 ARG 128 145 145 ARG ARG D . n D 4 129 VAL 129 146 146 VAL VAL D . n D 4 130 ILE 130 147 147 ILE ILE D . n D 4 131 GLY 131 148 148 GLY GLY D . n D 4 132 LEU 132 149 149 LEU LEU D . n D 4 133 TYR 133 150 150 TYR TYR D . n D 4 134 GLY 134 151 151 GLY GLY D . n D 4 135 ASN 135 152 152 ASN ASN D . n D 4 136 GLY 136 153 153 GLY GLY D . n D 4 137 VAL 137 154 154 VAL VAL D . n D 4 138 VAL 138 155 155 VAL VAL D . n D 4 139 ILE 139 156 156 ILE ILE D . n D 4 140 LYS 140 157 157 LYS LYS D . n D 4 141 ASN 141 158 158 ASN ASN D . n D 4 142 GLY 142 159 159 GLY GLY D . n D 4 143 SER 143 160 160 SER SER D . n D 4 144 TYR 144 161 161 TYR TYR D . n D 4 145 VAL 145 162 162 VAL VAL D . n D 4 146 SER 146 163 163 SER SER D . n D 4 147 ALA 147 164 164 ALA ALA D . n D 4 148 ILE 148 165 165 ILE ILE D . n D 4 149 THR 149 166 166 THR THR D . n D 4 150 GLN 150 167 167 GLN GLN D . n D 4 151 GLY 151 168 168 GLY GLY D . n D 4 152 LYS 152 169 169 LYS LYS D . n E 5 1 MET 1 51 51 MET MET E . n E 5 2 TYR 2 52 52 TYR TYR E . n E 5 3 ILE 3 53 53 ILE ILE E . n E 5 4 GLU 4 54 54 GLU GLU E . n E 5 5 ARG 5 55 55 ARG ARG E . n E 5 6 ALA 6 56 56 ALA ALA E . n E 5 7 GLY 7 57 57 GLY GLY E . n E 5 8 ASP 8 58 58 ASP ASP E . n E 5 9 ILE 9 59 59 ILE ILE E . n E 5 10 THR 10 60 60 THR THR E . n E 5 11 TRP 11 61 61 TRP TRP E . n E 5 12 GLU 12 62 62 GLU GLU E . n E 5 13 LYS 13 63 63 LYS LYS E . n E 5 14 ASP 14 64 64 ASP ASP E . n E 5 15 ALA 15 65 65 ALA ALA E . n E 5 16 GLU 16 66 66 GLU GLU E . n E 5 17 VAL 17 67 67 VAL VAL E . n E 5 18 THR 18 68 68 THR THR E . n E 5 19 GLY 19 69 69 GLY GLY E . n E 5 20 ASN 20 70 70 ASN ASN E . n E 5 21 SER 21 71 71 SER SER E . n E 5 22 PRO 22 72 72 PRO PRO E . n E 5 23 ARG 23 73 73 ARG ARG E . n E 5 24 LEU 24 74 74 LEU LEU E . n E 5 25 ASP 25 75 75 ASP ASP E . n E 5 26 VAL 26 76 76 VAL VAL E . n E 5 27 ALA 27 77 77 ALA ALA E . n E 5 28 LEU 28 78 78 LEU LEU E . n E 5 29 ASP 29 79 79 ASP ASP E . n E 5 30 GLU 30 80 80 GLU GLU E . n E 5 31 SER 31 81 81 SER SER E . n E 5 32 GLY 32 82 82 GLY GLY E . n E 5 33 ASP 33 83 83 ASP ASP E . n E 5 34 PHE 34 84 84 PHE PHE E . n E 5 35 SER 35 85 85 SER SER E . n E 5 36 LEU 36 86 86 LEU LEU E . n E 5 37 VAL 37 87 87 VAL VAL E . n E 5 38 GLU 38 88 88 GLU GLU E . n E 5 39 GLU 39 89 89 GLU GLU E . n F 6 1 LYS 1 14 14 LYS LYS F . n F 6 2 LYS 2 15 15 LYS LYS F . n F 6 3 GLY 3 16 16 GLY GLY F . n F 6 4 GLU 4 17 17 GLU GLU F . n F 6 5 THR 5 18 18 THR THR F . n F 6 6 THR 6 19 19 THR THR F . n F 6 7 ASP 7 20 20 ASP ASP F . n F 6 8 GLY 8 21 21 GLY GLY F . n F 6 9 VAL 9 22 22 VAL VAL F . n F 6 10 TYR 10 23 23 TYR TYR F . n F 6 11 ARG 11 24 24 ARG ARG F . n F 6 12 VAL 12 25 25 VAL VAL F . n F 6 13 MET 13 26 26 MET MET F . n F 6 14 THR 14 27 27 THR THR F . n F 6 15 ARG 15 28 28 ARG ARG F . n F 6 16 ARG 16 29 29 ARG ARG F . n F 6 17 LEU 17 30 30 LEU LEU F . n F 6 18 LEU 18 31 ? ? ? F . n F 6 19 GLY 19 32 ? ? ? F . n F 6 20 SER 20 33 ? ? ? F . n F 6 21 THR 21 34 34 THR THR F . n F 6 22 GLN 22 35 35 GLN GLN F . n F 6 23 VAL 23 36 36 VAL VAL F . n F 6 24 GLY 24 37 37 GLY GLY F . n F 6 25 VAL 25 38 38 VAL VAL F . n F 6 26 GLY 26 39 39 GLY GLY F . n F 6 27 VAL 27 40 40 VAL VAL F . n F 6 28 MET 28 41 41 MET MET F . n F 6 29 GLN 29 42 42 GLN GLN F . n F 6 30 GLU 30 43 43 GLU GLU F . n F 6 31 GLY 31 44 44 GLY GLY F . n F 6 32 VAL 32 45 45 VAL VAL F . n F 6 33 PHE 33 46 46 PHE PHE F . n F 6 34 HIS 34 47 47 HIS HIS F . n F 6 35 THR 35 48 48 THR THR F . n F 6 36 MET 36 49 49 MET MET F . n F 6 37 TRP 37 50 50 TRP TRP F . n F 6 38 HIS 38 51 51 HIS HIS F . n F 6 39 VAL 39 52 52 VAL VAL F . n F 6 40 THR 40 53 53 THR THR F . n F 6 41 LYS 41 54 54 LYS LYS F . n F 6 42 GLY 42 55 55 GLY GLY F . n F 6 43 ALA 43 56 56 ALA ALA F . n F 6 44 ALA 44 57 57 ALA ALA F . n F 6 45 LEU 45 58 58 LEU LEU F . n F 6 46 ARG 46 59 59 ARG ARG F . n F 6 47 SER 47 60 60 SER SER F . n F 6 48 GLY 48 61 ? ? ? F . n F 6 49 GLU 49 62 ? ? ? F . n F 6 50 GLY 50 63 ? ? ? F . n F 6 51 ARG 51 64 64 ARG ARG F . n F 6 52 LEU 52 65 65 LEU LEU F . n F 6 53 ASP 53 66 66 ASP ASP F . n F 6 54 PRO 54 67 67 PRO PRO F . n F 6 55 TYR 55 68 68 TYR TYR F . n F 6 56 TRP 56 69 69 TRP TRP F . n F 6 57 GLY 57 70 70 GLY GLY F . n F 6 58 ASP 58 71 71 ASP ASP F . n F 6 59 VAL 59 72 72 VAL VAL F . n F 6 60 LYS 60 73 73 LYS LYS F . n F 6 61 GLN 61 74 74 GLN GLN F . n F 6 62 ASP 62 75 75 ASP ASP F . n F 6 63 LEU 63 76 76 LEU LEU F . n F 6 64 VAL 64 77 77 VAL VAL F . n F 6 65 SER 65 78 78 SER SER F . n F 6 66 TYR 66 79 79 TYR TYR F . n F 6 67 CYS 67 80 80 CYS CYS F . n F 6 68 GLY 68 81 81 GLY GLY F . n F 6 69 PRO 69 82 82 PRO PRO F . n F 6 70 TRP 70 83 83 TRP TRP F . n F 6 71 LYS 71 84 84 LYS LYS F . n F 6 72 LEU 72 85 85 LEU LEU F . n F 6 73 ASP 73 86 86 ASP ASP F . n F 6 74 ALA 74 87 87 ALA ALA F . n F 6 75 ALA 75 88 88 ALA ALA F . n F 6 76 TRP 76 89 89 TRP TRP F . n F 6 77 ASP 77 90 90 ASP ASP F . n F 6 78 GLY 78 91 91 GLY GLY F . n F 6 79 LEU 79 92 92 LEU LEU F . n F 6 80 SER 80 93 93 SER SER F . n F 6 81 GLU 81 94 94 GLU GLU F . n F 6 82 VAL 82 95 95 VAL VAL F . n F 6 83 GLN 83 96 96 GLN GLN F . n F 6 84 LEU 84 97 97 LEU LEU F . n F 6 85 LEU 85 98 98 LEU LEU F . n F 6 86 ALA 86 99 99 ALA ALA F . n F 6 87 VAL 87 100 100 VAL VAL F . n F 6 88 PRO 88 101 101 PRO PRO F . n F 6 89 PRO 89 102 102 PRO PRO F . n F 6 90 GLY 90 103 103 GLY GLY F . n F 6 91 GLU 91 104 104 GLU GLU F . n F 6 92 ARG 92 105 105 ARG ARG F . n F 6 93 ALA 93 106 106 ALA ALA F . n F 6 94 LYS 94 107 107 LYS LYS F . n F 6 95 ASN 95 108 108 ASN ASN F . n F 6 96 ILE 96 109 109 ILE ILE F . n F 6 97 GLN 97 110 110 GLN GLN F . n F 6 98 THR 98 111 111 THR THR F . n F 6 99 LEU 99 112 112 LEU LEU F . n F 6 100 PRO 100 113 113 PRO PRO F . n F 6 101 GLY 101 114 114 GLY GLY F . n F 6 102 ILE 102 115 115 ILE ILE F . n F 6 103 PHE 103 116 116 PHE PHE F . n F 6 104 LYS 104 117 117 LYS LYS F . n F 6 105 THR 105 118 118 THR THR F . n F 6 106 LYS 106 119 119 LYS LYS F . n F 6 107 ASP 107 120 120 ASP ASP F . n F 6 108 GLY 108 121 121 GLY GLY F . n F 6 109 ASP 109 122 122 ASP ASP F . n F 6 110 ILE 110 123 123 ILE ILE F . n F 6 111 GLY 111 124 124 GLY GLY F . n F 6 112 ALA 112 125 125 ALA ALA F . n F 6 113 VAL 113 126 126 VAL VAL F . n F 6 114 ALA 114 127 127 ALA ALA F . n F 6 115 LEU 115 128 128 LEU LEU F . n F 6 116 ASP 116 129 129 ASP ASP F . n F 6 117 TYR 117 130 130 TYR TYR F . n F 6 118 PRO 118 131 131 PRO PRO F . n F 6 119 ALA 119 132 132 ALA ALA F . n F 6 120 GLY 120 133 133 GLY GLY F . n F 6 121 THR 121 134 134 THR THR F . n F 6 122 SER 122 135 135 SER SER F . n F 6 123 GLY 123 136 136 GLY GLY F . n F 6 124 SER 124 137 137 SER SER F . n F 6 125 PRO 125 138 138 PRO PRO F . n F 6 126 ILE 126 139 139 ILE ILE F . n F 6 127 LEU 127 140 140 LEU LEU F . n F 6 128 ASP 128 141 141 ASP ASP F . n F 6 129 LYS 129 142 142 LYS LYS F . n F 6 130 CYS 130 143 143 CYS CYS F . n F 6 131 GLY 131 144 144 GLY GLY F . n F 6 132 ARG 132 145 145 ARG ARG F . n F 6 133 VAL 133 146 146 VAL VAL F . n F 6 134 ILE 134 147 147 ILE ILE F . n F 6 135 GLY 135 148 148 GLY GLY F . n F 6 136 LEU 136 149 149 LEU LEU F . n F 6 137 TYR 137 150 150 TYR TYR F . n F 6 138 GLY 138 151 151 GLY GLY F . n F 6 139 ASN 139 152 152 ASN ASN F . n F 6 140 GLY 140 153 153 GLY GLY F . n F 6 141 VAL 141 154 154 VAL VAL F . n F 6 142 VAL 142 155 155 VAL VAL F . n F 6 143 ILE 143 156 156 ILE ILE F . n F 6 144 LYS 144 157 157 LYS LYS F . n F 6 145 ASN 145 158 158 ASN ASN F . n F 6 146 GLY 146 159 159 GLY GLY F . n F 6 147 SER 147 160 160 SER SER F . n F 6 148 TYR 148 161 161 TYR TYR F . n F 6 149 VAL 149 162 162 VAL VAL F . n F 6 150 SER 150 163 163 SER SER F . n F 6 151 ALA 151 164 164 ALA ALA F . n F 6 152 ILE 152 165 165 ILE ILE F . n F 6 153 THR 153 166 166 THR THR F . n F 6 154 GLN 154 167 167 GLN GLN F . n F 6 155 GLY 155 168 168 GLY GLY F . n F 6 156 LYS 156 169 169 LYS LYS F . n F 6 157 ARG 157 170 170 ARG ARG F . n F 6 158 GLU 158 171 171 GLU GLU F . n G 1 1 ASP 1 50 50 ASP ASP G . n G 1 2 MET 2 51 51 MET MET G . n G 1 3 TYR 3 52 52 TYR TYR G . n G 1 4 ILE 4 53 53 ILE ILE G . n G 1 5 GLU 5 54 54 GLU GLU G . n G 1 6 ARG 6 55 55 ARG ARG G . n G 1 7 ALA 7 56 56 ALA ALA G . n G 1 8 GLY 8 57 57 GLY GLY G . n G 1 9 ASP 9 58 58 ASP ASP G . n G 1 10 ILE 10 59 59 ILE ILE G . n G 1 11 THR 11 60 60 THR THR G . n G 1 12 TRP 12 61 61 TRP TRP G . n G 1 13 GLU 13 62 62 GLU GLU G . n G 1 14 LYS 14 63 63 LYS LYS G . n G 1 15 ASP 15 64 64 ASP ASP G . n G 1 16 ALA 16 65 65 ALA ALA G . n G 1 17 GLU 17 66 66 GLU GLU G . n G 1 18 VAL 18 67 67 VAL VAL G . n G 1 19 THR 19 68 68 THR THR G . n G 1 20 GLY 20 69 69 GLY GLY G . n G 1 21 ASN 21 70 70 ASN ASN G . n G 1 22 SER 22 71 71 SER SER G . n G 1 23 PRO 23 72 72 PRO PRO G . n G 1 24 ARG 24 73 73 ARG ARG G . n G 1 25 LEU 25 74 74 LEU LEU G . n G 1 26 ASP 26 75 75 ASP ASP G . n G 1 27 VAL 27 76 76 VAL VAL G . n G 1 28 ALA 28 77 77 ALA ALA G . n G 1 29 LEU 29 78 78 LEU LEU G . n G 1 30 ASP 30 79 79 ASP ASP G . n G 1 31 GLU 31 80 80 GLU GLU G . n G 1 32 SER 32 81 81 SER SER G . n G 1 33 GLY 33 82 82 GLY GLY G . n G 1 34 ASP 34 83 83 ASP ASP G . n G 1 35 PHE 35 84 84 PHE PHE G . n G 1 36 SER 36 85 85 SER SER G . n G 1 37 LEU 37 86 86 LEU LEU G . n G 1 38 VAL 38 87 87 VAL VAL G . n G 1 39 GLU 39 88 88 GLU GLU G . n H 7 1 THR 1 18 18 THR THR H . n H 7 2 THR 2 19 19 THR THR H . n H 7 3 ASP 3 20 20 ASP ASP H . n H 7 4 GLY 4 21 21 GLY GLY H . n H 7 5 VAL 5 22 22 VAL VAL H . n H 7 6 TYR 6 23 23 TYR TYR H . n H 7 7 ARG 7 24 24 ARG ARG H . n H 7 8 VAL 8 25 25 VAL VAL H . n H 7 9 MET 9 26 26 MET MET H . n H 7 10 THR 10 27 27 THR THR H . n H 7 11 ARG 11 28 28 ARG ARG H . n H 7 12 ARG 12 29 29 ARG ARG H . n H 7 13 LEU 13 30 30 LEU LEU H . n H 7 14 LEU 14 31 31 LEU LEU H . n H 7 15 GLY 15 32 32 GLY GLY H . n H 7 16 SER 16 33 33 SER SER H . n H 7 17 THR 17 34 34 THR THR H . n H 7 18 GLN 18 35 35 GLN GLN H . n H 7 19 VAL 19 36 36 VAL VAL H . n H 7 20 GLY 20 37 37 GLY GLY H . n H 7 21 VAL 21 38 38 VAL VAL H . n H 7 22 GLY 22 39 39 GLY GLY H . n H 7 23 VAL 23 40 40 VAL VAL H . n H 7 24 MET 24 41 41 MET MET H . n H 7 25 GLN 25 42 42 GLN GLN H . n H 7 26 GLU 26 43 43 GLU GLU H . n H 7 27 GLY 27 44 44 GLY GLY H . n H 7 28 VAL 28 45 45 VAL VAL H . n H 7 29 PHE 29 46 46 PHE PHE H . n H 7 30 HIS 30 47 47 HIS HIS H . n H 7 31 THR 31 48 48 THR THR H . n H 7 32 MET 32 49 49 MET MET H . n H 7 33 TRP 33 50 50 TRP TRP H . n H 7 34 HIS 34 51 51 HIS HIS H . n H 7 35 VAL 35 52 52 VAL VAL H . n H 7 36 THR 36 53 53 THR THR H . n H 7 37 LYS 37 54 54 LYS LYS H . n H 7 38 GLY 38 55 55 GLY GLY H . n H 7 39 ALA 39 56 56 ALA ALA H . n H 7 40 ALA 40 57 57 ALA ALA H . n H 7 41 LEU 41 58 58 LEU LEU H . n H 7 42 ARG 42 59 59 ARG ARG H . n H 7 43 SER 43 60 60 SER SER H . n H 7 44 GLY 44 61 61 GLY GLY H . n H 7 45 GLU 45 62 62 GLU GLU H . n H 7 46 GLY 46 63 63 GLY GLY H . n H 7 47 ARG 47 64 64 ARG ARG H . n H 7 48 LEU 48 65 65 LEU LEU H . n H 7 49 ASP 49 66 66 ASP ASP H . n H 7 50 PRO 50 67 67 PRO PRO H . n H 7 51 TYR 51 68 68 TYR TYR H . n H 7 52 TRP 52 69 69 TRP TRP H . n H 7 53 GLY 53 70 70 GLY GLY H . n H 7 54 ASP 54 71 71 ASP ASP H . n H 7 55 VAL 55 72 72 VAL VAL H . n H 7 56 LYS 56 73 73 LYS LYS H . n H 7 57 GLN 57 74 74 GLN GLN H . n H 7 58 ASP 58 75 75 ASP ASP H . n H 7 59 LEU 59 76 76 LEU LEU H . n H 7 60 VAL 60 77 77 VAL VAL H . n H 7 61 SER 61 78 78 SER SER H . n H 7 62 TYR 62 79 79 TYR TYR H . n H 7 63 CYS 63 80 80 CYS CYS H . n H 7 64 GLY 64 81 81 GLY GLY H . n H 7 65 PRO 65 82 82 PRO PRO H . n H 7 66 TRP 66 83 83 TRP TRP H . n H 7 67 LYS 67 84 84 LYS LYS H . n H 7 68 LEU 68 85 85 LEU LEU H . n H 7 69 ASP 69 86 86 ASP ASP H . n H 7 70 ALA 70 87 87 ALA ALA H . n H 7 71 ALA 71 88 88 ALA ALA H . n H 7 72 TRP 72 89 89 TRP TRP H . n H 7 73 ASP 73 90 90 ASP ASP H . n H 7 74 GLY 74 91 91 GLY GLY H . n H 7 75 LEU 75 92 92 LEU LEU H . n H 7 76 SER 76 93 93 SER SER H . n H 7 77 GLU 77 94 94 GLU GLU H . n H 7 78 VAL 78 95 95 VAL VAL H . n H 7 79 GLN 79 96 96 GLN GLN H . n H 7 80 LEU 80 97 97 LEU LEU H . n H 7 81 LEU 81 98 98 LEU LEU H . n H 7 82 ALA 82 99 99 ALA ALA H . n H 7 83 VAL 83 100 100 VAL VAL H . n H 7 84 PRO 84 101 101 PRO PRO H . n H 7 85 PRO 85 102 102 PRO PRO H . n H 7 86 GLY 86 103 103 GLY GLY H . n H 7 87 GLU 87 104 104 GLU GLU H . n H 7 88 ARG 88 105 105 ARG ARG H . n H 7 89 ALA 89 106 106 ALA ALA H . n H 7 90 LYS 90 107 107 LYS LYS H . n H 7 91 ASN 91 108 108 ASN ASN H . n H 7 92 ILE 92 109 109 ILE ILE H . n H 7 93 GLN 93 110 110 GLN GLN H . n H 7 94 THR 94 111 111 THR THR H . n H 7 95 LEU 95 112 112 LEU LEU H . n H 7 96 PRO 96 113 113 PRO PRO H . n H 7 97 GLY 97 114 114 GLY GLY H . n H 7 98 ILE 98 115 115 ILE ILE H . n H 7 99 PHE 99 116 116 PHE PHE H . n H 7 100 LYS 100 117 117 LYS LYS H . n H 7 101 THR 101 118 118 THR THR H . n H 7 102 LYS 102 119 119 LYS LYS H . n H 7 103 ASP 103 120 120 ASP ASP H . n H 7 104 GLY 104 121 121 GLY GLY H . n H 7 105 ASP 105 122 122 ASP ASP H . n H 7 106 ILE 106 123 123 ILE ILE H . n H 7 107 GLY 107 124 124 GLY GLY H . n H 7 108 ALA 108 125 125 ALA ALA H . n H 7 109 VAL 109 126 126 VAL VAL H . n H 7 110 ALA 110 127 127 ALA ALA H . n H 7 111 LEU 111 128 128 LEU LEU H . n H 7 112 ASP 112 129 129 ASP ASP H . n H 7 113 TYR 113 130 130 TYR TYR H . n H 7 114 PRO 114 131 131 PRO PRO H . n H 7 115 ALA 115 132 132 ALA ALA H . n H 7 116 GLY 116 133 133 GLY GLY H . n H 7 117 THR 117 134 134 THR THR H . n H 7 118 SER 118 135 135 SER SER H . n H 7 119 GLY 119 136 136 GLY GLY H . n H 7 120 SER 120 137 137 SER SER H . n H 7 121 PRO 121 138 138 PRO PRO H . n H 7 122 ILE 122 139 139 ILE ILE H . n H 7 123 LEU 123 140 140 LEU LEU H . n H 7 124 ASP 124 141 141 ASP ASP H . n H 7 125 LYS 125 142 142 LYS LYS H . n H 7 126 CYS 126 143 143 CYS CYS H . n H 7 127 GLY 127 144 144 GLY GLY H . n H 7 128 ARG 128 145 145 ARG ARG H . n H 7 129 VAL 129 146 146 VAL VAL H . n H 7 130 ILE 130 147 147 ILE ILE H . n H 7 131 GLY 131 148 148 GLY GLY H . n H 7 132 LEU 132 149 149 LEU LEU H . n H 7 133 TYR 133 150 150 TYR TYR H . n H 7 134 GLY 134 151 151 GLY GLY H . n H 7 135 ASN 135 152 152 ASN ASN H . n H 7 136 GLY 136 153 153 GLY GLY H . n H 7 137 VAL 137 154 154 VAL VAL H . n H 7 138 VAL 138 155 155 VAL VAL H . n H 7 139 ILE 139 156 156 ILE ILE H . n H 7 140 LYS 140 157 157 LYS LYS H . n H 7 141 ASN 141 158 158 ASN ASN H . n H 7 142 GLY 142 159 159 GLY GLY H . n H 7 143 SER 143 160 160 SER SER H . n H 7 144 TYR 144 161 161 TYR TYR H . n H 7 145 VAL 145 162 162 VAL VAL H . n H 7 146 SER 146 163 163 SER SER H . n H 7 147 ALA 147 164 164 ALA ALA H . n H 7 148 ILE 148 165 165 ILE ILE H . n H 7 149 THR 149 166 166 THR THR H . n H 7 150 GLN 150 167 167 GLN GLN H . n H 7 151 GLY 151 168 168 GLY GLY H . n H 7 152 LYS 152 169 169 LYS LYS H . n H 7 153 ARG 153 170 170 ARG ARG H . n I 8 1 HHC 1 1 201 HHC LIG I . n I 8 2 GLY 2 2 201 GLY LIG I . n I 8 3 LYS 3 3 201 LYS LIG I . n I 8 4 ARG 4 4 201 ARG LIG I . n I 8 5 LYS 5 5 201 LYS LIG I . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code J 9 HOH 1 101 99 HOH HOH A . J 9 HOH 2 102 51 HOH HOH A . J 9 HOH 3 103 114 HOH HOH A . J 9 HOH 4 104 92 HOH HOH A . J 9 HOH 5 105 277 HOH HOH A . J 9 HOH 6 106 197 HOH HOH A . J 9 HOH 7 107 267 HOH HOH A . J 9 HOH 8 108 287 HOH HOH A . J 9 HOH 9 109 170 HOH HOH A . J 9 HOH 10 110 321 HOH HOH A . J 9 HOH 11 111 194 HOH HOH A . J 9 HOH 12 112 273 HOH HOH A . K 9 HOH 1 201 344 HOH HOH B . K 9 HOH 2 202 195 HOH HOH B . K 9 HOH 3 203 370 HOH HOH B . K 9 HOH 4 204 319 HOH HOH B . K 9 HOH 5 205 54 HOH HOH B . K 9 HOH 6 206 167 HOH HOH B . K 9 HOH 7 207 348 HOH HOH B . K 9 HOH 8 208 285 HOH HOH B . K 9 HOH 9 209 137 HOH HOH B . K 9 HOH 10 210 147 HOH HOH B . K 9 HOH 11 211 233 HOH HOH B . K 9 HOH 12 212 266 HOH HOH B . K 9 HOH 13 213 190 HOH HOH B . K 9 HOH 14 214 371 HOH HOH B . K 9 HOH 15 215 40 HOH HOH B . K 9 HOH 16 216 11 HOH HOH B . K 9 HOH 17 217 120 HOH HOH B . K 9 HOH 18 218 363 HOH HOH B . K 9 HOH 19 219 224 HOH HOH B . K 9 HOH 20 220 87 HOH HOH B . K 9 HOH 21 221 126 HOH HOH B . K 9 HOH 22 222 97 HOH HOH B . K 9 HOH 23 223 37 HOH HOH B . K 9 HOH 24 224 110 HOH HOH B . K 9 HOH 25 225 303 HOH HOH B . K 9 HOH 26 226 59 HOH HOH B . K 9 HOH 27 227 200 HOH HOH B . K 9 HOH 28 228 211 HOH HOH B . K 9 HOH 29 229 81 HOH HOH B . K 9 HOH 30 230 175 HOH HOH B . K 9 HOH 31 231 84 HOH HOH B . K 9 HOH 32 232 122 HOH HOH B . K 9 HOH 33 233 327 HOH HOH B . K 9 HOH 34 234 205 HOH HOH B . K 9 HOH 35 235 101 HOH HOH B . K 9 HOH 36 236 354 HOH HOH B . K 9 HOH 37 237 132 HOH HOH B . K 9 HOH 38 238 178 HOH HOH B . K 9 HOH 39 239 188 HOH HOH B . K 9 HOH 40 240 69 HOH HOH B . K 9 HOH 41 241 336 HOH HOH B . K 9 HOH 42 242 191 HOH HOH B . K 9 HOH 43 243 136 HOH HOH B . K 9 HOH 44 244 335 HOH HOH B . K 9 HOH 45 245 184 HOH HOH B . K 9 HOH 46 246 246 HOH HOH B . K 9 HOH 47 247 332 HOH HOH B . K 9 HOH 48 248 255 HOH HOH B . K 9 HOH 49 249 271 HOH HOH B . K 9 HOH 50 250 199 HOH HOH B . L 9 HOH 1 101 142 HOH HOH C . L 9 HOH 2 102 48 HOH HOH C . L 9 HOH 3 103 129 HOH HOH C . L 9 HOH 4 104 368 HOH HOH C . L 9 HOH 5 105 45 HOH HOH C . L 9 HOH 6 106 313 HOH HOH C . L 9 HOH 7 107 276 HOH HOH C . L 9 HOH 8 108 107 HOH HOH C . L 9 HOH 9 109 131 HOH HOH C . L 9 HOH 10 110 269 HOH HOH C . L 9 HOH 11 111 243 HOH HOH C . L 9 HOH 12 112 80 HOH HOH C . L 9 HOH 13 113 353 HOH HOH C . L 9 HOH 14 114 239 HOH HOH C . L 9 HOH 15 115 282 HOH HOH C . M 9 HOH 1 201 30 HOH HOH D . M 9 HOH 2 202 290 HOH HOH D . M 9 HOH 3 203 162 HOH HOH D . M 9 HOH 4 204 173 HOH HOH D . M 9 HOH 5 205 229 HOH HOH D . M 9 HOH 6 206 139 HOH HOH D . M 9 HOH 7 207 9 HOH HOH D . M 9 HOH 8 208 180 HOH HOH D . M 9 HOH 9 209 318 HOH HOH D . M 9 HOH 10 210 128 HOH HOH D . M 9 HOH 11 211 216 HOH HOH D . M 9 HOH 12 212 14 HOH HOH D . M 9 HOH 13 213 207 HOH HOH D . M 9 HOH 14 214 262 HOH HOH D . M 9 HOH 15 215 172 HOH HOH D . M 9 HOH 16 216 62 HOH HOH D . M 9 HOH 17 217 248 HOH HOH D . M 9 HOH 18 218 57 HOH HOH D . M 9 HOH 19 219 274 HOH HOH D . M 9 HOH 20 220 179 HOH HOH D . M 9 HOH 21 221 124 HOH HOH D . M 9 HOH 22 222 206 HOH HOH D . M 9 HOH 23 223 70 HOH HOH D . M 9 HOH 24 224 77 HOH HOH D . M 9 HOH 25 225 22 HOH HOH D . M 9 HOH 26 226 43 HOH HOH D . M 9 HOH 27 227 44 HOH HOH D . M 9 HOH 28 228 316 HOH HOH D . M 9 HOH 29 229 155 HOH HOH D . M 9 HOH 30 230 86 HOH HOH D . M 9 HOH 31 231 130 HOH HOH D . M 9 HOH 32 232 17 HOH HOH D . M 9 HOH 33 233 261 HOH HOH D . M 9 HOH 34 234 127 HOH HOH D . M 9 HOH 35 235 152 HOH HOH D . M 9 HOH 36 236 307 HOH HOH D . M 9 HOH 37 237 352 HOH HOH D . M 9 HOH 38 238 148 HOH HOH D . M 9 HOH 39 239 245 HOH HOH D . M 9 HOH 40 240 297 HOH HOH D . M 9 HOH 41 241 21 HOH HOH D . M 9 HOH 42 242 168 HOH HOH D . M 9 HOH 43 243 259 HOH HOH D . M 9 HOH 44 244 268 HOH HOH D . M 9 HOH 45 245 181 HOH HOH D . M 9 HOH 46 246 166 HOH HOH D . M 9 HOH 47 247 304 HOH HOH D . M 9 HOH 48 248 347 HOH HOH D . M 9 HOH 49 249 312 HOH HOH D . M 9 HOH 50 250 192 HOH HOH D . M 9 HOH 51 251 284 HOH HOH D . M 9 HOH 52 252 343 HOH HOH D . M 9 HOH 53 253 289 HOH HOH D . M 9 HOH 54 254 340 HOH HOH D . M 9 HOH 55 255 204 HOH HOH D . M 9 HOH 56 256 63 HOH HOH D . M 9 HOH 57 257 302 HOH HOH D . M 9 HOH 58 258 264 HOH HOH D . M 9 HOH 59 259 293 HOH HOH D . M 9 HOH 60 260 214 HOH HOH D . N 9 HOH 1 101 94 HOH HOH E . N 9 HOH 2 102 301 HOH HOH E . N 9 HOH 3 103 105 HOH HOH E . N 9 HOH 4 104 291 HOH HOH E . N 9 HOH 5 105 31 HOH HOH E . N 9 HOH 6 106 236 HOH HOH E . N 9 HOH 7 107 358 HOH HOH E . N 9 HOH 8 108 18 HOH HOH E . N 9 HOH 9 109 305 HOH HOH E . N 9 HOH 10 110 91 HOH HOH E . N 9 HOH 11 111 157 HOH HOH E . N 9 HOH 12 112 232 HOH HOH E . N 9 HOH 13 113 355 HOH HOH E . N 9 HOH 14 114 156 HOH HOH E . N 9 HOH 15 115 96 HOH HOH E . N 9 HOH 16 116 115 HOH HOH E . N 9 HOH 17 117 116 HOH HOH E . N 9 HOH 18 118 198 HOH HOH E . N 9 HOH 19 119 218 HOH HOH E . N 9 HOH 20 120 369 HOH HOH E . N 9 HOH 21 121 73 HOH HOH E . N 9 HOH 22 122 329 HOH HOH E . N 9 HOH 23 123 324 HOH HOH E . N 9 HOH 24 124 164 HOH HOH E . N 9 HOH 25 125 212 HOH HOH E . O 9 HOH 1 201 315 HOH HOH F . O 9 HOH 2 202 5 HOH HOH F . O 9 HOH 3 203 53 HOH HOH F . O 9 HOH 4 204 252 HOH HOH F . O 9 HOH 5 205 144 HOH HOH F . O 9 HOH 6 206 33 HOH HOH F . O 9 HOH 7 207 254 HOH HOH F . O 9 HOH 8 208 221 HOH HOH F . O 9 HOH 9 209 286 HOH HOH F . O 9 HOH 10 210 151 HOH HOH F . O 9 HOH 11 211 160 HOH HOH F . O 9 HOH 12 212 169 HOH HOH F . O 9 HOH 13 213 294 HOH HOH F . O 9 HOH 14 214 2 HOH HOH F . O 9 HOH 15 215 260 HOH HOH F . O 9 HOH 16 216 238 HOH HOH F . O 9 HOH 17 217 295 HOH HOH F . O 9 HOH 18 218 19 HOH HOH F . O 9 HOH 19 219 215 HOH HOH F . O 9 HOH 20 220 67 HOH HOH F . O 9 HOH 21 221 34 HOH HOH F . O 9 HOH 22 222 240 HOH HOH F . O 9 HOH 23 223 85 HOH HOH F . O 9 HOH 24 224 36 HOH HOH F . O 9 HOH 25 225 117 HOH HOH F . O 9 HOH 26 226 359 HOH HOH F . O 9 HOH 27 227 146 HOH HOH F . O 9 HOH 28 228 279 HOH HOH F . O 9 HOH 29 229 25 HOH HOH F . O 9 HOH 30 230 182 HOH HOH F . O 9 HOH 31 231 143 HOH HOH F . O 9 HOH 32 232 161 HOH HOH F . O 9 HOH 33 233 317 HOH HOH F . O 9 HOH 34 234 38 HOH HOH F . O 9 HOH 35 235 158 HOH HOH F . O 9 HOH 36 236 183 HOH HOH F . O 9 HOH 37 237 49 HOH HOH F . O 9 HOH 38 238 247 HOH HOH F . O 9 HOH 39 239 226 HOH HOH F . O 9 HOH 40 240 133 HOH HOH F . O 9 HOH 41 241 82 HOH HOH F . O 9 HOH 42 242 362 HOH HOH F . O 9 HOH 43 243 50 HOH HOH F . O 9 HOH 44 244 275 HOH HOH F . O 9 HOH 45 245 89 HOH HOH F . O 9 HOH 46 246 28 HOH HOH F . O 9 HOH 47 247 52 HOH HOH F . O 9 HOH 48 248 103 HOH HOH F . O 9 HOH 49 249 64 HOH HOH F . O 9 HOH 50 250 79 HOH HOH F . O 9 HOH 51 251 256 HOH HOH F . O 9 HOH 52 252 225 HOH HOH F . O 9 HOH 53 253 210 HOH HOH F . O 9 HOH 54 254 60 HOH HOH F . O 9 HOH 55 255 55 HOH HOH F . O 9 HOH 56 256 350 HOH HOH F . O 9 HOH 57 257 176 HOH HOH F . O 9 HOH 58 258 149 HOH HOH F . O 9 HOH 59 259 83 HOH HOH F . O 9 HOH 60 260 185 HOH HOH F . O 9 HOH 61 261 23 HOH HOH F . O 9 HOH 62 262 119 HOH HOH F . O 9 HOH 63 263 366 HOH HOH F . O 9 HOH 64 264 109 HOH HOH F . O 9 HOH 65 265 219 HOH HOH F . O 9 HOH 66 266 356 HOH HOH F . O 9 HOH 67 267 367 HOH HOH F . O 9 HOH 68 268 66 HOH HOH F . O 9 HOH 69 269 341 HOH HOH F . O 9 HOH 70 270 145 HOH HOH F . O 9 HOH 71 271 237 HOH HOH F . O 9 HOH 72 272 76 HOH HOH F . O 9 HOH 73 273 134 HOH HOH F . O 9 HOH 74 274 361 HOH HOH F . O 9 HOH 75 275 310 HOH HOH F . O 9 HOH 76 276 171 HOH HOH F . O 9 HOH 77 277 338 HOH HOH F . O 9 HOH 78 278 189 HOH HOH F . O 9 HOH 79 279 346 HOH HOH F . O 9 HOH 80 280 330 HOH HOH F . O 9 HOH 81 281 299 HOH HOH F . O 9 HOH 82 282 93 HOH HOH F . O 9 HOH 83 283 228 HOH HOH F . O 9 HOH 84 284 203 HOH HOH F . O 9 HOH 85 285 241 HOH HOH F . O 9 HOH 86 286 258 HOH HOH F . O 9 HOH 87 287 331 HOH HOH F . O 9 HOH 88 288 257 HOH HOH F . O 9 HOH 89 289 234 HOH HOH F . P 9 HOH 1 101 322 HOH HOH G . P 9 HOH 2 102 242 HOH HOH G . P 9 HOH 3 103 6 HOH HOH G . P 9 HOH 4 104 140 HOH HOH G . P 9 HOH 5 105 112 HOH HOH G . P 9 HOH 6 106 7 HOH HOH G . P 9 HOH 7 107 3 HOH HOH G . P 9 HOH 8 108 108 HOH HOH G . P 9 HOH 9 109 4 HOH HOH G . P 9 HOH 10 110 138 HOH HOH G . P 9 HOH 11 111 141 HOH HOH G . P 9 HOH 12 112 10 HOH HOH G . P 9 HOH 13 113 365 HOH HOH G . P 9 HOH 14 114 272 HOH HOH G . P 9 HOH 15 115 90 HOH HOH G . P 9 HOH 16 116 56 HOH HOH G . P 9 HOH 17 117 244 HOH HOH G . P 9 HOH 18 118 1 HOH HOH G . P 9 HOH 19 119 278 HOH HOH G . P 9 HOH 20 120 263 HOH HOH G . P 9 HOH 21 121 13 HOH HOH G . P 9 HOH 22 122 337 HOH HOH G . P 9 HOH 23 123 35 HOH HOH G . P 9 HOH 24 124 339 HOH HOH G . P 9 HOH 25 125 61 HOH HOH G . P 9 HOH 26 126 222 HOH HOH G . P 9 HOH 27 127 345 HOH HOH G . P 9 HOH 28 128 298 HOH HOH G . P 9 HOH 29 129 227 HOH HOH G . P 9 HOH 30 130 292 HOH HOH G . P 9 HOH 31 131 209 HOH HOH G . P 9 HOH 32 132 283 HOH HOH G . Q 9 HOH 1 201 174 HOH HOH H . Q 9 HOH 2 202 46 HOH HOH H . Q 9 HOH 3 203 270 HOH HOH H . Q 9 HOH 4 204 39 HOH HOH H . Q 9 HOH 5 205 113 HOH HOH H . Q 9 HOH 6 206 201 HOH HOH H . Q 9 HOH 7 207 123 HOH HOH H . Q 9 HOH 8 208 220 HOH HOH H . Q 9 HOH 9 209 47 HOH HOH H . Q 9 HOH 10 210 296 HOH HOH H . Q 9 HOH 11 211 217 HOH HOH H . Q 9 HOH 12 212 223 HOH HOH H . Q 9 HOH 13 213 65 HOH HOH H . Q 9 HOH 14 214 104 HOH HOH H . Q 9 HOH 15 215 135 HOH HOH H . Q 9 HOH 16 216 281 HOH HOH H . Q 9 HOH 17 217 15 HOH HOH H . Q 9 HOH 18 218 334 HOH HOH H . Q 9 HOH 19 219 27 HOH HOH H . Q 9 HOH 20 220 150 HOH HOH H . Q 9 HOH 21 221 8 HOH HOH H . Q 9 HOH 22 222 314 HOH HOH H . Q 9 HOH 23 223 68 HOH HOH H . Q 9 HOH 24 224 121 HOH HOH H . Q 9 HOH 25 225 118 HOH HOH H . Q 9 HOH 26 226 20 HOH HOH H . Q 9 HOH 27 227 196 HOH HOH H . Q 9 HOH 28 228 26 HOH HOH H . Q 9 HOH 29 229 193 HOH HOH H . Q 9 HOH 30 230 106 HOH HOH H . Q 9 HOH 31 231 12 HOH HOH H . Q 9 HOH 32 232 78 HOH HOH H . Q 9 HOH 33 233 41 HOH HOH H . Q 9 HOH 34 234 202 HOH HOH H . Q 9 HOH 35 235 71 HOH HOH H . Q 9 HOH 36 236 32 HOH HOH H . Q 9 HOH 37 237 364 HOH HOH H . Q 9 HOH 38 238 72 HOH HOH H . Q 9 HOH 39 239 98 HOH HOH H . Q 9 HOH 40 240 208 HOH HOH H . Q 9 HOH 41 241 74 HOH HOH H . Q 9 HOH 42 242 24 HOH HOH H . Q 9 HOH 43 243 111 HOH HOH H . Q 9 HOH 44 244 300 HOH HOH H . Q 9 HOH 45 245 58 HOH HOH H . Q 9 HOH 46 246 29 HOH HOH H . Q 9 HOH 47 247 230 HOH HOH H . Q 9 HOH 48 248 187 HOH HOH H . Q 9 HOH 49 249 349 HOH HOH H . Q 9 HOH 50 250 249 HOH HOH H . Q 9 HOH 51 251 95 HOH HOH H . Q 9 HOH 52 252 42 HOH HOH H . Q 9 HOH 53 253 16 HOH HOH H . Q 9 HOH 54 254 235 HOH HOH H . Q 9 HOH 55 255 75 HOH HOH H . Q 9 HOH 56 256 265 HOH HOH H . Q 9 HOH 57 257 308 HOH HOH H . Q 9 HOH 58 258 100 HOH HOH H . Q 9 HOH 59 259 163 HOH HOH H . Q 9 HOH 60 260 102 HOH HOH H . Q 9 HOH 61 261 186 HOH HOH H . Q 9 HOH 62 262 154 HOH HOH H . Q 9 HOH 63 263 342 HOH HOH H . Q 9 HOH 64 264 125 HOH HOH H . Q 9 HOH 65 265 357 HOH HOH H . Q 9 HOH 66 266 159 HOH HOH H . Q 9 HOH 67 267 250 HOH HOH H . Q 9 HOH 68 268 280 HOH HOH H . Q 9 HOH 69 269 320 HOH HOH H . Q 9 HOH 70 270 333 HOH HOH H . Q 9 HOH 71 271 213 HOH HOH H . Q 9 HOH 72 272 88 HOH HOH H . Q 9 HOH 73 273 165 HOH HOH H . Q 9 HOH 74 274 309 HOH HOH H . Q 9 HOH 75 275 351 HOH HOH H . Q 9 HOH 76 276 177 HOH HOH H . Q 9 HOH 77 277 323 HOH HOH H . Q 9 HOH 78 278 360 HOH HOH H . Q 9 HOH 79 279 328 HOH HOH H . Q 9 HOH 80 280 288 HOH HOH H . Q 9 HOH 81 281 306 HOH HOH H . Q 9 HOH 82 282 153 HOH HOH H . Q 9 HOH 83 283 325 HOH HOH H . Q 9 HOH 84 284 311 HOH HOH H . Q 9 HOH 85 285 253 HOH HOH H . Q 9 HOH 86 286 326 HOH HOH H . Q 9 HOH 87 287 251 HOH HOH H . Q 9 HOH 88 288 231 HOH HOH H . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 author_and_software_defined_assembly PISA dimeric 2 4 author_and_software_defined_assembly PISA dimeric 2 5 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,J,K 2 1 C,D,L,M 3 1 E,F,N,O 4 1 G,H,P,Q 5 1 I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3780 ? 1 MORE -26 ? 1 'SSA (A^2)' 8850 ? 2 'ABSA (A^2)' 3780 ? 2 MORE -28 ? 2 'SSA (A^2)' 8390 ? 3 'ABSA (A^2)' 3700 ? 3 MORE -26 ? 3 'SSA (A^2)' 9150 ? 4 'ABSA (A^2)' 3810 ? 4 MORE -27 ? 4 'SSA (A^2)' 8930 ? 5 'ABSA (A^2)' 0 ? 5 MORE 0 ? 5 'SSA (A^2)' 1150 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-14 2 'Structure model' 1 1 2021-06-16 3 'Structure model' 2 0 2023-11-15 4 'Structure model' 2 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' struct_conn 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_atom_site.auth_atom_id' 7 3 'Structure model' '_atom_site.label_atom_id' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' 10 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -8.9807 -0.5382 40.2330 0.5833 ? 0.0878 ? 0.1434 ? 0.6624 ? -0.0473 ? 0.3915 ? 5.3374 ? 0.9637 ? 2.7406 ? 3.0533 ? -1.1052 ? 2.3053 ? 0.0897 ? -0.7683 ? 1.0930 ? 0.8508 ? -0.0855 ? 0.9012 ? -0.6763 ? -0.3187 ? -0.0883 ? 2 'X-RAY DIFFRACTION' ? refined 1.7774 -5.2771 50.4588 0.7322 ? 0.0260 ? -0.0630 ? 0.5152 ? 0.0317 ? 0.2971 ? 3.7946 ? -2.1435 ? 1.5963 ? 7.6238 ? -2.1779 ? 0.9237 ? 0.1489 ? 0.3016 ? -0.0996 ? 0.8049 ? -0.4879 ? -0.6483 ? -1.1144 ? -0.2178 ? 0.2337 ? 3 'X-RAY DIFFRACTION' ? refined 1.4756 -18.1344 59.3230 1.3447 ? -0.0182 ? -0.0289 ? 0.7391 ? 0.0466 ? 0.2115 ? 3.6973 ? -0.4136 ? 4.7570 ? 0.0983 ? -0.3671 ? 6.5704 ? 0.0546 ? -1.3349 ? 0.0922 ? 1.7733 ? -0.3772 ? 0.3565 ? -0.1315 ? 0.3682 ? 0.1469 ? 4 'X-RAY DIFFRACTION' ? refined -4.6179 -33.6390 50.0877 1.0056 ? -0.0817 ? -0.0085 ? 0.7305 ? 0.1329 ? 0.3013 ? 6.0150 ? 0.5895 ? 1.4195 ? 8.8221 ? -0.8988 ? 0.4557 ? 0.1974 ? 0.1550 ? 0.1892 ? 0.7228 ? -0.0152 ? 0.6331 ? -0.1228 ? 1.0276 ? -0.2919 ? 5 'X-RAY DIFFRACTION' ? refined -9.8242 -30.3579 35.3695 0.6460 ? -0.1599 ? 0.0586 ? 0.7348 ? -0.0244 ? 0.2290 ? 3.3549 ? -1.0529 ? 1.8314 ? 1.6975 ? -1.7082 ? 2.7236 ? -0.2294 ? 0.0424 ? -0.3494 ? -0.7167 ? 0.2193 ? -0.0088 ? 0.4769 ? 0.0506 ? 0.0596 ? 6 'X-RAY DIFFRACTION' ? refined -6.6541 -4.4106 43.4568 0.5576 ? 0.0475 ? 0.0147 ? 0.5499 ? -0.0659 ? 0.2253 ? 5.5518 ? -0.3859 ? -0.8131 ? 1.5700 ? -1.0473 ? 3.0567 ? -0.2518 ? 0.1625 ? 0.6723 ? 0.1073 ? 0.2637 ? 0.1479 ? -0.6161 ? -0.1985 ? -0.1096 ? 7 'X-RAY DIFFRACTION' ? refined -2.6572 -10.7770 36.9924 0.5304 ? -0.0243 ? 0.0354 ? 0.5252 ? -0.0313 ? 0.1237 ? 3.5402 ? 0.3518 ? -0.7514 ? 1.8607 ? 0.0870 ? 2.9665 ? -0.2749 ? 0.0105 ? -0.1382 ? -0.1168 ? 0.1800 ? 0.1283 ? -0.2931 ? -0.1871 ? 0.1348 ? 8 'X-RAY DIFFRACTION' ? refined -3.0755 -5.2267 32.3258 0.5459 ? 0.0044 ? 0.0127 ? 0.6200 ? 0.0663 ? 0.2817 ? 1.9714 ? -1.9258 ? 0.7905 ? 6.5808 ? -0.1656 ? 3.8495 ? -0.0952 ? 0.1519 ? 0.0917 ? -0.5611 ? 0.2794 ? 0.4977 ? -0.8410 ? -0.2364 ? -0.2352 ? 9 'X-RAY DIFFRACTION' ? refined -3.2628 -15.7839 33.0385 0.4777 ? 0.0153 ? 0.0073 ? 0.5101 ? 0.0277 ? 0.1454 ? 2.8310 ? 2.3718 ? -0.7280 ? 6.8708 ? 1.4955 ? 2.7543 ? -0.0881 ? -0.5368 ? -0.1624 ? -0.4656 ? -0.0691 ? -0.5108 ? -0.0188 ? -0.2654 ? 0.0919 ? 10 'X-RAY DIFFRACTION' ? refined 6.6350 -19.5223 42.9962 0.5499 ? -0.0278 ? -0.0473 ? 0.6108 ? -0.0007 ? 0.2326 ? 1.4940 ? 0.3127 ? 0.6351 ? 1.8550 ? -1.2952 ? 3.2463 ? 0.2002 ? -0.2789 ? -0.1983 ? 0.6485 ? -0.1363 ? -0.3897 ? -0.3504 ? 0.5457 ? -0.1314 ? 11 'X-RAY DIFFRACTION' ? refined -4.7422 -20.7228 49.3484 0.6643 ? -0.0789 ? 0.0113 ? 0.5888 ? 0.0367 ? 0.2172 ? 0.6893 ? 1.1998 ? -0.2696 ? 2.5260 ? 0.2461 ? 1.2951 ? 0.0593 ? -0.2353 ? -0.0697 ? 1.0951 ? -0.1185 ? 0.2795 ? 0.3518 ? -0.0357 ? -0.0447 ? 12 'X-RAY DIFFRACTION' ? refined 5.8049 -17.0176 49.4497 0.7080 ? 0.0842 ? -0.0965 ? 0.6088 ? -0.0620 ? 0.3174 ? 9.3454 ? 2.7652 ? 4.6082 ? 6.8980 ? 0.7514 ? 2.8392 ? 0.5275 ? -0.5809 ? -0.6375 ? 0.8772 ? 0.3807 ? -0.9597 ? 0.8998 ? 0.1638 ? -0.7976 ? 13 'X-RAY DIFFRACTION' ? refined -6.4110 -23.6111 44.5574 0.6755 ? -0.0068 ? 0.0330 ? 0.6643 ? 0.0526 ? 0.1511 ? 1.3165 ? -0.0004 ? 0.5676 ? 1.6916 ? 0.7498 ? 1.0095 ? 0.1311 ? -0.1564 ? 0.2410 ? 0.1035 ? -0.0793 ? 0.3038 ? 0.5208 ? -0.4249 ? 0.0237 ? 14 'X-RAY DIFFRACTION' ? refined -21.6570 0.4882 67.9924 0.8999 ? -0.4297 ? 0.0882 ? 0.9360 ? 0.0521 ? 0.4483 ? 4.7986 ? -1.2037 ? -1.0005 ? 8.5286 ? 2.0857 ? 9.0773 ? 1.3150 ? -0.3158 ? 0.5387 ? 0.9119 ? -0.4274 ? -1.1377 ? -2.1047 ? 1.7723 ? -0.2144 ? 15 'X-RAY DIFFRACTION' ? refined -29.2433 -17.3860 52.9269 0.6255 ? 0.0854 ? 0.0016 ? 0.9918 ? -0.1085 ? 0.3141 ? 0.1538 ? 0.4800 ? 0.0138 ? 2.1220 ? -0.9203 ? 1.5828 ? 0.1306 ? 0.8453 ? -0.0939 ? -0.8921 ? -0.3022 ? -0.3738 ? 0.1015 ? 0.3497 ? 0.0966 ? 16 'X-RAY DIFFRACTION' ? refined -20.9285 -28.6703 72.5636 0.5844 ? 0.1799 ? -0.0708 ? 0.9354 ? -0.0782 ? 0.2745 ? 2.3410 ? -1.8516 ? -1.2801 ? 3.4144 ? -0.0777 ? 1.3199 ? -0.0674 ? 0.2288 ? -0.2505 ? 0.1265 ? 0.1544 ? 0.0557 ? 0.2926 ? 0.1041 ? -0.1352 ? 17 'X-RAY DIFFRACTION' ? refined -27.4291 -2.6329 63.3992 0.6097 ? -0.0172 ? 0.0197 ? 0.6361 ? 0.1352 ? 0.1833 ? 3.9917 ? 1.8713 ? 2.4219 ? 1.6794 ? 1.6476 ? 6.3914 ? -0.5846 ? -0.2126 ? 0.2614 ? -0.2356 ? 0.1174 ? 0.2040 ? -0.7599 ? -0.0483 ? 0.2055 ? 18 'X-RAY DIFFRACTION' ? refined -21.0658 -4.6675 65.4663 0.6246 ? 0.0997 ? -0.0598 ? 0.8803 ? 0.0662 ? -0.0537 ? 2.0023 ? -1.8366 ? -0.8621 ? 2.7810 ? -0.5769 ? 3.8823 ? -0.6894 ? -0.6376 ? 0.8059 ? 0.2510 ? 0.3549 ? -0.9212 ? -0.2029 ? 0.8160 ? 0.4104 ? 19 'X-RAY DIFFRACTION' ? refined -28.4840 -9.6969 70.8864 0.4312 ? -0.0319 ? 0.0192 ? 0.5711 ? 0.0033 ? 0.1517 ? 3.2554 ? -0.7251 ? -1.1058 ? 3.1576 ? 0.6588 ? 3.6124 ? -0.4458 ? 0.1572 ? 0.0047 ? 0.0706 ? 0.2395 ? -0.2241 ? -0.5567 ? 0.8700 ? 0.1840 ? 20 'X-RAY DIFFRACTION' ? refined -28.4748 -4.2481 75.5968 0.5786 ? -0.1122 ? -0.0270 ? 0.7089 ? -0.0204 ? 0.1914 ? 1.8321 ? -0.1719 ? -0.9306 ? 4.7484 ? 0.8468 ? 0.8721 ? -0.2210 ? -0.0201 ? 0.4530 ? -0.1218 ? 0.4143 ? -0.7654 ? -0.5992 ? 0.2892 ? -0.2463 ? 21 'X-RAY DIFFRACTION' ? refined -28.1355 -14.7168 74.8488 0.4617 ? 0.0275 ? 0.0249 ? 0.5445 ? -0.0039 ? 0.1545 ? 1.9554 ? -1.8536 ? 0.8106 ? 6.3052 ? -1.2089 ? 2.8450 ? -0.0986 ? 0.0561 ? -0.0906 ? -0.1517 ? 0.4071 ? 0.1628 ? 0.1956 ? 0.4221 ? -0.4175 ? 22 'X-RAY DIFFRACTION' ? refined -37.4005 -18.3100 64.6663 0.4618 ? -0.0143 ? 0.0041 ? 0.6128 ? -0.0287 ? 0.1878 ? 1.7561 ? -0.1636 ? 0.4960 ? 6.1759 ? 4.2232 ? 4.9039 ? -0.1315 ? 0.3509 ? -0.2033 ? 0.1371 ? 0.0292 ? 0.1490 ? 0.2528 ? -0.1786 ? -0.0077 ? 23 'X-RAY DIFFRACTION' ? refined -26.3259 -18.8461 56.4561 0.5567 ? 0.1044 ? 0.0590 ? 0.7565 ? -0.0391 ? 0.2346 ? 1.2154 ? 0.4908 ? -0.4741 ? 2.9124 ? 0.7675 ? 0.5466 ? -0.1259 ? 0.2822 ? -0.0163 ? -0.6453 ? 0.1896 ? -0.1953 ? -0.0869 ? 0.1160 ? -0.0623 ? 24 'X-RAY DIFFRACTION' ? refined -25.9751 -20.9763 62.2831 0.5675 ? 0.0476 ? 0.0232 ? 0.7724 ? -0.0700 ? 0.1836 ? 2.0339 ? 0.0779 ? 0.2179 ? 2.4123 ? -0.7478 ? 1.7538 ? 0.2303 ? 0.3360 ? -0.4533 ? -0.1788 ? -0.1562 ? -0.0768 ? 0.1376 ? 0.6760 ? -0.0114 ? 25 'X-RAY DIFFRACTION' ? refined -15.1058 -9.3530 10.9148 0.3445 ? -0.0449 ? 0.0164 ? 0.8557 ? 0.2314 ? 0.4123 ? 5.7816 ? 2.3233 ? -0.7115 ? 8.8909 ? 3.2718 ? 8.8168 ? 0.3248 ? 0.5128 ? 0.6372 ? -0.2844 ? 0.4824 ? 0.6661 ? -0.5479 ? -1.4217 ? -0.3728 ? 26 'X-RAY DIFFRACTION' ? refined -8.4859 -18.6898 2.0703 0.4001 ? -0.0519 ? -0.0231 ? 0.5566 ? 0.0921 ? 0.2165 ? 5.8241 ? -1.7072 ? 4.1416 ? 5.2479 ? 0.7227 ? 4.0992 ? 0.3196 ? 0.4165 ? -0.0945 ? -1.6393 ? 0.0558 ? -0.0688 ? 0.2110 ? 0.2097 ? -0.2293 ? 27 'X-RAY DIFFRACTION' ? refined 3.9246 -15.3502 -5.6298 0.5732 ? 0.0134 ? -0.0275 ? 0.7708 ? 0.0456 ? 0.3351 ? 4.9503 ? 3.5970 ? -2.3587 ? 3.0428 ? -1.4070 ? 1.5889 ? -0.5932 ? 0.9989 ? 0.7270 ? -1.5985 ? 0.3887 ? 0.3535 ? -0.0119 ? -0.1123 ? -0.0089 ? 28 'X-RAY DIFFRACTION' ? refined 18.0673 -8.3010 6.2523 0.4325 ? -0.0295 ? 0.0339 ? 0.6100 ? 0.1782 ? 0.4260 ? 5.3391 ? -1.8502 ? -0.9100 ? 8.6115 ? 3.9982 ? 8.2615 ? 0.2253 ? 0.1160 ? -0.0699 ? 0.2194 ? -0.2984 ? -1.2410 ? -0.4318 ? 0.2042 ? 0.1686 ? 29 'X-RAY DIFFRACTION' ? refined 10.9150 -4.8762 20.9767 0.7286 ? -0.2175 ? -0.0312 ? 0.6143 ? 0.0164 ? 0.2215 ? 2.7871 ? -1.9563 ? -0.3670 ? 1.6121 ? 0.3202 ? 0.0689 ? 0.3198 ? -0.8031 ? 0.1127 ? 0.6545 ? -0.2240 ? -0.0286 ? -0.2782 ? 0.4062 ? 0.1262 ? 30 'X-RAY DIFFRACTION' ? refined 18.4245 -1.7513 14.0336 0.5388 ? -0.1162 ? 0.0583 ? 0.5701 ? -0.0725 ? 0.4254 ? 3.1427 ? -1.3826 ? -0.5004 ? 9.5946 ? 2.8925 ? 9.2265 ? 0.0557 ? -0.1914 ? 0.7998 ? -0.2016 ? 0.7061 ? -1.2990 ? -0.2361 ? 1.2679 ? -0.7201 ? 31 'X-RAY DIFFRACTION' ? refined -14.4653 -19.2080 9.9103 0.4040 ? 0.0436 ? -0.0218 ? 0.6162 ? 0.0605 ? 0.3017 ? 0.9258 ? 2.0774 ? -0.5933 ? 9.6378 ? -1.1792 ? 0.3833 ? 0.0244 ? 0.5993 ? 0.1270 ? -0.0199 ? -0.0223 ? 1.0364 ? 0.0496 ? 0.0381 ? 0.1004 ? 32 'X-RAY DIFFRACTION' ? refined -10.1815 -7.5729 11.7064 0.4434 ? 0.0030 ? 0.0793 ? 0.7040 ? -0.0282 ? 0.1113 ? 2.5416 ? 0.0931 ? 2.0689 ? 8.9896 ? -1.8114 ? 2.0661 ? 0.0747 ? -0.0139 ? 0.5867 ? 0.4551 ? -0.6515 ? 0.4931 ? -0.0992 ? -0.4946 ? 0.4866 ? 33 'X-RAY DIFFRACTION' ? refined -2.9088 -15.3526 17.2889 0.4159 ? -0.0173 ? -0.0066 ? 0.4347 ? 0.0220 ? 0.1343 ? 2.1616 ? 0.4737 ? -1.5905 ? 1.8193 ? -0.2311 ? 2.2236 ? 0.1613 ? -0.0147 ? 0.0556 ? 0.2958 ? -0.1213 ? 0.1495 ? -0.0466 ? -0.1871 ? -0.0423 ? 34 'X-RAY DIFFRACTION' ? refined 4.8536 -11.4410 6.2804 0.3422 ? -0.0035 ? 0.0044 ? 0.4434 ? 0.0420 ? 0.1473 ? 2.8351 ? 1.7760 ? -0.7754 ? 2.6155 ? -0.7160 ? 0.2997 ? -0.0734 ? 0.0390 ? -0.0430 ? -0.0475 ? 0.0535 ? -0.0548 ? -0.0048 ? 0.0609 ? 0.0313 ? 35 'X-RAY DIFFRACTION' ? refined -38.1364 -40.2198 7.7478 0.3743 ? -0.0360 ? -0.0199 ? 0.4537 ? 0.0908 ? 0.2285 ? 4.1030 ? -0.4793 ? 0.1389 ? 2.1526 ? 1.8468 ? 2.7070 ? 0.1409 ? 0.0743 ? 0.0216 ? -0.2815 ? -0.0511 ? 0.4847 ? -0.0166 ? -0.5983 ? -0.0402 ? 36 'X-RAY DIFFRACTION' ? refined -21.8131 -46.4875 -4.9393 0.7829 ? 0.0736 ? 0.0290 ? 0.7792 ? 0.0056 ? 0.1951 ? 3.1520 ? 1.7825 ? 0.1053 ? 4.3897 ? 1.7900 ? 0.8676 ? -0.7331 ? 1.9121 ? 0.1342 ? -1.9580 ? 0.4155 ? 0.4426 ? 0.0725 ? -0.3528 ? 0.3422 ? 37 'X-RAY DIFFRACTION' ? refined -7.4858 -38.8878 5.1926 0.4233 ? -0.1042 ? 0.0733 ? 0.6111 ? -0.0461 ? 0.1829 ? 2.0016 ? 0.7328 ? 9.6342 ? 5.6168 ? 3.1684 ? 2.0009 ? -0.6827 ? -0.2219 ? 0.6665 ? -0.2101 ? -0.5789 ? -0.1096 ? -0.1988 ? -0.1713 ? 0.4017 ? 38 'X-RAY DIFFRACTION' ? refined -10.6369 -34.7038 19.5510 0.5779 ? -0.1543 ? -0.0121 ? 0.5756 ? 0.0084 ? 0.1973 ? 0.1213 ? -0.4317 ? 0.6276 ? 3.3279 ? -1.8608 ? 3.3113 ? 0.3921 ? -0.8036 ? 0.0157 ? 0.3610 ? -0.4047 ? -0.1953 ? -0.1478 ? 0.9015 ? -0.0004 ? 39 'X-RAY DIFFRACTION' ? refined -37.4168 -40.7488 8.4523 0.3678 ? -0.0121 ? -0.0279 ? 0.5266 ? 0.0554 ? 0.2100 ? 3.3843 ? 2.5220 ? -0.3635 ? 6.5226 ? 3.4719 ? 3.6958 ? 0.0665 ? -0.0881 ? 0.3711 ? 0.6362 ? -0.1875 ? 0.9886 ? 0.5308 ? -0.3906 ? 0.0766 ? 40 'X-RAY DIFFRACTION' ? refined -35.6227 -34.9390 9.8334 0.3990 ? 0.0015 ? 0.0207 ? 0.5546 ? 0.0422 ? 0.2927 ? 3.9328 ? 2.1159 ? 2.1458 ? 1.6702 ? -0.0263 ? 3.8062 ? -0.1965 ? 0.4205 ? 0.9796 ? -0.2308 ? -0.0438 ? 0.7043 ? -0.3276 ? -0.6491 ? 0.2746 ? 41 'X-RAY DIFFRACTION' ? refined -34.5936 -41.2598 18.6748 0.3956 ? 0.0216 ? 0.0314 ? 0.4924 ? 0.0355 ? 0.1678 ? 3.0039 ? 1.9077 ? -0.5092 ? 2.7497 ? -0.0647 ? 3.2744 ? -0.0714 ? -0.0623 ? 0.4144 ? 0.4311 ? 0.1560 ? 0.3557 ? 0.0312 ? -0.3469 ? -0.0590 ? 42 'X-RAY DIFFRACTION' ? refined -23.0642 -47.5255 14.6457 0.4001 ? -0.0041 ? -0.0174 ? 0.3839 ? 0.0390 ? 0.1474 ? 4.0939 ? 0.1447 ? -2.2056 ? 0.7618 ? 0.1268 ? 1.8508 ? -0.0358 ? 0.0634 ? -0.3543 ? -0.0274 ? -0.1288 ? -0.0396 ? 0.2882 ? -0.1154 ? 0.1138 ? 43 'X-RAY DIFFRACTION' ? refined -19.9532 -41.5169 6.0436 0.3653 ? 0.0046 ? -0.0003 ? 0.4013 ? 0.0203 ? 0.1132 ? 2.9539 ? 0.9783 ? -1.0534 ? 2.6580 ? -0.0803 ? 0.3816 ? -0.0472 ? 0.1792 ? -0.0403 ? -0.0893 ? 0.0742 ? -0.0144 ? 0.1014 ? -0.0106 ? -0.0173 ? 44 'X-RAY DIFFRACTION' ? refined -16.7266 -38.8969 10.6895 0.3685 ? 0.1317 ? 0.0693 ? 0.5419 ? 0.0219 ? 0.2183 ? 2.4499 ? -0.4656 ? 1.3291 ? 2.4604 ? 1.8611 ? 2.5639 ? 0.0244 ? -0.3090 ? 0.1761 ? -0.4288 ? 0.0454 ? -0.3269 ? -0.0144 ? 0.2209 ? -0.0073 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 50 ? ? ? A 54 ? ? ;chain 'A' and (resid 50 through 54 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 55 ? ? ? A 59 ? ? ;chain 'A' and (resid 55 through 59 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 60 ? ? ? A 69 ? ? ;chain 'A' and (resid 60 through 69 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 70 ? ? ? A 74 ? ? ;chain 'A' and (resid 70 through 74 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 75 ? ? ? A 88 ? ? ;chain 'A' and (resid 75 through 88 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 17 ? ? ? B 42 ? ? ;chain 'B' and (resid 17 through 42 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 43 ? ? ? B 53 ? ? ;chain 'B' and (resid 43 through 53 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 54 ? ? ? B 71 ? ? ;chain 'B' and (resid 54 through 71 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 72 ? ? ? B 79 ? ? ;chain 'B' and (resid 72 through 79 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? B 80 ? ? ? B 94 ? ? ;chain 'B' and (resid 80 through 94 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? B 95 ? ? ? B 136 ? ? ;chain 'B' and (resid 95 through 136 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? B 137 ? ? ? B 145 ? ? ;chain 'B' and (resid 137 through 145 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? B 146 ? ? ? B 169 ? ? ;chain 'B' and (resid 146 through 169 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? C 50 ? ? ? C 54 ? ? ;chain 'C' and (resid 50 through 54 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? C 55 ? ? ? C 74 ? ? ;chain 'C' and (resid 55 through 74 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? C 75 ? ? ? C 87 ? ? ;chain 'C' and (resid 75 through 87 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? D 18 ? ? ? D 27 ? ? ;chain 'D' and (resid 18 through 27 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? D 28 ? ? ? D 42 ? ? ;chain 'D' and (resid 28 through 42 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? D 43 ? ? ? D 53 ? ? ;chain 'D' and (resid 43 through 53 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? D 54 ? ? ? D 71 ? ? ;chain 'D' and (resid 54 through 71 ) ; 21 'X-RAY DIFFRACTION' 21 ? ? D 72 ? ? ? D 79 ? ? ;chain 'D' and (resid 72 through 79 ) ; 22 'X-RAY DIFFRACTION' 22 ? ? D 80 ? ? ? D 94 ? ? ;chain 'D' and (resid 80 through 94 ) ; 23 'X-RAY DIFFRACTION' 23 ? ? D 95 ? ? ? D 118 ? ? ;chain 'D' and (resid 95 through 118 ) ; 24 'X-RAY DIFFRACTION' 24 ? ? D 119 ? ? ? D 169 ? ? ;chain 'D' and (resid 119 through 169 ) ; 25 'X-RAY DIFFRACTION' 25 ? ? E 51 ? ? ? E 55 ? ? ;chain 'E' and (resid 51 through 55 ) ; 26 'X-RAY DIFFRACTION' 26 ? ? E 56 ? ? ? E 60 ? ? ;chain 'E' and (resid 56 through 60 ) ; 27 'X-RAY DIFFRACTION' 27 ? ? E 61 ? ? ? E 70 ? ? ;chain 'E' and (resid 61 through 70 ) ; 28 'X-RAY DIFFRACTION' 28 ? ? E 71 ? ? ? E 75 ? ? ;chain 'E' and (resid 71 through 75 ) ; 29 'X-RAY DIFFRACTION' 29 ? ? E 76 ? ? ? E 83 ? ? ;chain 'E' and (resid 76 through 83 ) ; 30 'X-RAY DIFFRACTION' 30 ? ? E 84 ? ? ? E 89 ? ? ;chain 'E' and (resid 84 through 89 ) ; 31 'X-RAY DIFFRACTION' 31 ? ? F 14 ? ? ? F 26 ? ? ;chain 'F' and (resid 14 through 26 ) ; 32 'X-RAY DIFFRACTION' 32 ? ? F 27 ? ? ? F 42 ? ? ;chain 'F' and (resid 27 through 42 ) ; 33 'X-RAY DIFFRACTION' 33 ? ? F 43 ? ? ? F 94 ? ? ;chain 'F' and (resid 43 through 94 ) ; 34 'X-RAY DIFFRACTION' 34 ? ? F 95 ? ? ? F 171 ? ? ;chain 'F' and (resid 95 through 171 ) ; 35 'X-RAY DIFFRACTION' 35 ? ? G 50 ? ? ? G 59 ? ? ;chain 'G' and (resid 50 through 59 ) ; 36 'X-RAY DIFFRACTION' 36 ? ? G 60 ? ? ? G 69 ? ? ;chain 'G' and (resid 60 through 69 ) ; 37 'X-RAY DIFFRACTION' 37 ? ? G 70 ? ? ? G 74 ? ? ;chain 'G' and (resid 70 through 74 ) ; 38 'X-RAY DIFFRACTION' 38 ? ? G 75 ? ? ? G 88 ? ? ;chain 'G' and (resid 75 through 88 ) ; 39 'X-RAY DIFFRACTION' 39 ? ? H 18 ? ? ? H 28 ? ? ;chain 'H' and (resid 18 through 28 ) ; 40 'X-RAY DIFFRACTION' 40 ? ? H 29 ? ? ? H 42 ? ? ;chain 'H' and (resid 29 through 42 ) ; 41 'X-RAY DIFFRACTION' 41 ? ? H 43 ? ? ? H 71 ? ? ;chain 'H' and (resid 43 through 71 ) ; 42 'X-RAY DIFFRACTION' 42 ? ? H 72 ? ? ? H 94 ? ? ;chain 'H' and (resid 72 through 94 ) ; 43 'X-RAY DIFFRACTION' 43 ? ? H 95 ? ? ? H 155 ? ? ;chain 'H' and (resid 95 through 155 ) ; 44 'X-RAY DIFFRACTION' 44 ? ? H 156 ? ? ? H 170 ? ? ;chain 'H' and (resid 156 through 170 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7DOC _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O H HOH 285 ? ? O H HOH 288 ? ? 1.83 2 1 O F HOH 269 ? ? O F HOH 280 ? ? 1.93 3 1 OD2 F ASP 86 ? ? O F HOH 201 ? ? 1.93 4 1 O B HOH 228 ? ? O B HOH 246 ? ? 1.97 5 1 O H HOH 222 ? ? O H HOH 273 ? ? 1.98 6 1 O H HOH 206 ? ? O H HOH 275 ? ? 1.99 7 1 O F HOH 206 ? ? O F HOH 212 ? ? 2.03 8 1 O G HOH 124 ? ? O H HOH 263 ? ? 2.04 9 1 O F HOH 228 ? ? O F HOH 271 ? ? 2.04 10 1 OE2 H GLU 104 ? ? O H HOH 201 ? ? 2.05 11 1 O C HOH 111 ? ? O C HOH 114 ? ? 2.05 12 1 O B HOH 207 ? ? O B HOH 240 ? ? 2.11 13 1 OE1 E GLU 62 ? ? O E HOH 101 ? ? 2.11 14 1 N D GLY 133 ? ? O D HOH 201 ? ? 2.11 15 1 OD2 F ASP 129 ? ? O F HOH 202 ? ? 2.12 16 1 OE1 G GLU 80 ? ? O G HOH 101 ? ? 2.12 17 1 OD2 B ASP 141 ? ? O B HOH 201 ? ? 2.12 18 1 O H HOH 257 ? ? O H HOH 281 ? ? 2.13 19 1 O F HOH 243 ? ? O F HOH 286 ? ? 2.14 20 1 N D ARG 28 ? ? O D HOH 202 ? ? 2.14 21 1 O H HOH 257 ? ? O H HOH 258 ? ? 2.15 22 1 O F SER 60 ? ? O F HOH 203 ? ? 2.15 23 1 OE1 H GLU 94 ? ? NE2 H GLN 110 ? ? 2.15 24 1 OD1 F ASN 158 ? ? OG F SER 160 ? ? 2.15 25 1 OD1 F ASP 20 ? ? O F HOH 204 ? ? 2.15 26 1 O D HOH 249 ? ? O D HOH 250 ? ? 2.16 27 1 OD1 B ASN 158 ? ? OG B SER 160 ? ? 2.17 28 1 N H GLY 133 ? ? O H HOH 202 ? ? 2.17 29 1 O B HOH 215 ? ? O B HOH 245 ? ? 2.17 30 1 O A HOH 108 ? ? O B HOH 225 ? ? 2.18 31 1 NH2 B ARG 24 ? ? O B GLU 104 ? ? 2.18 32 1 NH2 H ARG 24 ? ? O H GLU 104 ? ? 2.19 33 1 OD1 H ASP 66 ? ? O H HOH 203 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OD1 A ASP 58 ? ? 1_555 OD1 A ASN 70 ? ? 3_555 1.41 2 1 O F HOH 281 ? ? 1_555 O H HOH 274 ? ? 4_545 1.97 3 1 O A HOH 109 ? ? 1_555 O B HOH 243 ? ? 3_555 2.09 4 1 CG A ASP 58 ? ? 1_555 OD1 A ASN 70 ? ? 3_555 2.14 5 1 OH D TYR 68 ? ? 1_555 O G GLU 80 ? ? 3_455 2.17 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE I ARG 4 ? ? CZ I ARG 4 ? ? 1.450 1.326 0.124 0.013 N 2 1 CZ I ARG 4 ? ? NH2 I ARG 4 ? ? 1.451 1.326 0.125 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 64 ? ? -105.46 55.05 2 1 LEU B 30 ? ? -75.05 -149.33 3 1 CYS B 80 ? ? 74.63 -9.26 4 1 VAL B 100 ? ? -118.44 79.13 5 1 ASP C 64 ? ? -104.31 54.82 6 1 LEU D 30 ? ? -76.05 -162.60 7 1 CYS D 80 ? ? 74.61 -10.18 8 1 LEU D 92 ? ? -122.17 -52.30 9 1 VAL D 100 ? ? -118.65 77.43 10 1 ASP E 64 ? ? -103.94 56.60 11 1 CYS F 80 ? ? 72.60 -6.48 12 1 VAL F 100 ? ? -119.23 76.80 13 1 ASP G 64 ? ? -103.83 55.72 14 1 ARG H 28 ? ? -114.45 68.21 15 1 LEU H 30 ? ? -75.84 -73.91 16 1 LEU H 31 ? ? -176.39 108.92 17 1 CYS H 80 ? ? 75.45 -9.54 18 1 VAL H 100 ? ? -118.98 76.59 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? E HOH 125 ? 6.29 . 2 1 O ? H HOH 288 ? 6.10 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 63 ? CG ? A LYS 14 CG 2 1 Y 1 A LYS 63 ? CD ? A LYS 14 CD 3 1 Y 1 A LYS 63 ? CE ? A LYS 14 CE 4 1 Y 1 A LYS 63 ? NZ ? A LYS 14 NZ 5 1 Y 1 A ASP 64 ? CG ? A ASP 15 CG 6 1 Y 1 A ASP 64 ? OD1 ? A ASP 15 OD1 7 1 Y 1 A ASP 64 ? OD2 ? A ASP 15 OD2 8 1 Y 1 A GLU 66 ? CG ? A GLU 17 CG 9 1 Y 1 A GLU 66 ? CD ? A GLU 17 CD 10 1 Y 1 A GLU 66 ? OE1 ? A GLU 17 OE1 11 1 Y 1 A GLU 66 ? OE2 ? A GLU 17 OE2 12 1 Y 1 A GLU 88 ? CG ? A GLU 39 CG 13 1 Y 1 A GLU 88 ? CD ? A GLU 39 CD 14 1 Y 1 A GLU 88 ? OE1 ? A GLU 39 OE1 15 1 Y 1 A GLU 88 ? OE2 ? A GLU 39 OE2 16 1 Y 1 B GLU 17 ? CG ? B GLU 1 CG 17 1 Y 1 B GLU 17 ? CD ? B GLU 1 CD 18 1 Y 1 B GLU 17 ? OE1 ? B GLU 1 OE1 19 1 Y 1 B GLU 17 ? OE2 ? B GLU 1 OE2 20 1 Y 1 B ARG 28 ? CG ? B ARG 12 CG 21 1 Y 1 B ARG 28 ? CD ? B ARG 12 CD 22 1 Y 1 B ARG 28 ? NE ? B ARG 12 NE 23 1 Y 1 B ARG 28 ? CZ ? B ARG 12 CZ 24 1 Y 1 B ARG 28 ? NH1 ? B ARG 12 NH1 25 1 Y 1 B ARG 28 ? NH2 ? B ARG 12 NH2 26 1 Y 1 B ARG 29 ? CG ? B ARG 13 CG 27 1 Y 1 B ARG 29 ? CD ? B ARG 13 CD 28 1 Y 1 B ARG 29 ? NE ? B ARG 13 NE 29 1 Y 1 B ARG 29 ? CZ ? B ARG 13 CZ 30 1 Y 1 B ARG 29 ? NH1 ? B ARG 13 NH1 31 1 Y 1 B ARG 29 ? NH2 ? B ARG 13 NH2 32 1 Y 1 B ARG 59 ? CG ? B ARG 43 CG 33 1 Y 1 B ARG 59 ? CD ? B ARG 43 CD 34 1 Y 1 B ARG 59 ? NE ? B ARG 43 NE 35 1 Y 1 B ARG 59 ? CZ ? B ARG 43 CZ 36 1 Y 1 B ARG 59 ? NH1 ? B ARG 43 NH1 37 1 Y 1 B ARG 59 ? NH2 ? B ARG 43 NH2 38 1 Y 1 B GLU 62 ? CG ? B GLU 46 CG 39 1 Y 1 B GLU 62 ? CD ? B GLU 46 CD 40 1 Y 1 B GLU 62 ? OE1 ? B GLU 46 OE1 41 1 Y 1 B GLU 62 ? OE2 ? B GLU 46 OE2 42 1 Y 1 B ARG 64 ? CG ? B ARG 48 CG 43 1 Y 1 B ARG 64 ? CD ? B ARG 48 CD 44 1 Y 1 B ARG 64 ? NE ? B ARG 48 NE 45 1 Y 1 B ARG 64 ? CZ ? B ARG 48 CZ 46 1 Y 1 B ARG 64 ? NH1 ? B ARG 48 NH1 47 1 Y 1 B ARG 64 ? NH2 ? B ARG 48 NH2 48 1 Y 1 B ARG 105 ? CG ? B ARG 89 CG 49 1 Y 1 B ARG 105 ? CD ? B ARG 89 CD 50 1 Y 1 B ARG 105 ? NE ? B ARG 89 NE 51 1 Y 1 B ARG 105 ? CZ ? B ARG 89 CZ 52 1 Y 1 B ARG 105 ? NH1 ? B ARG 89 NH1 53 1 Y 1 B ARG 105 ? NH2 ? B ARG 89 NH2 54 1 Y 1 B LYS 107 ? CG ? B LYS 91 CG 55 1 Y 1 B LYS 107 ? CD ? B LYS 91 CD 56 1 Y 1 B LYS 107 ? CE ? B LYS 91 CE 57 1 Y 1 B LYS 107 ? NZ ? B LYS 91 NZ 58 1 Y 1 B LYS 117 ? CG ? B LYS 101 CG 59 1 Y 1 B LYS 117 ? CD ? B LYS 101 CD 60 1 Y 1 B LYS 117 ? CE ? B LYS 101 CE 61 1 Y 1 B LYS 117 ? NZ ? B LYS 101 NZ 62 1 Y 1 B LYS 119 ? CG ? B LYS 103 CG 63 1 Y 1 B LYS 119 ? CD ? B LYS 103 CD 64 1 Y 1 B LYS 119 ? CE ? B LYS 103 CE 65 1 Y 1 B LYS 119 ? NZ ? B LYS 103 NZ 66 1 Y 1 B ASP 120 ? CG ? B ASP 104 CG 67 1 Y 1 B ASP 120 ? OD1 ? B ASP 104 OD1 68 1 Y 1 B ASP 120 ? OD2 ? B ASP 104 OD2 69 1 Y 1 B LYS 142 ? CG ? B LYS 126 CG 70 1 Y 1 B LYS 142 ? CD ? B LYS 126 CD 71 1 Y 1 B LYS 142 ? CE ? B LYS 126 CE 72 1 Y 1 B LYS 142 ? NZ ? B LYS 126 NZ 73 1 Y 1 B LYS 157 ? CG ? B LYS 141 CG 74 1 Y 1 B LYS 157 ? CD ? B LYS 141 CD 75 1 Y 1 B LYS 157 ? CE ? B LYS 141 CE 76 1 Y 1 B LYS 157 ? NZ ? B LYS 141 NZ 77 1 Y 1 B LYS 169 ? CG ? B LYS 153 CG 78 1 Y 1 B LYS 169 ? CD ? B LYS 153 CD 79 1 Y 1 B LYS 169 ? CE ? B LYS 153 CE 80 1 Y 1 B LYS 169 ? NZ ? B LYS 153 NZ 81 1 Y 1 C GLU 62 ? CG ? C GLU 13 CG 82 1 Y 1 C GLU 62 ? CD ? C GLU 13 CD 83 1 Y 1 C GLU 62 ? OE1 ? C GLU 13 OE1 84 1 Y 1 C GLU 62 ? OE2 ? C GLU 13 OE2 85 1 Y 1 C LYS 63 ? CG ? C LYS 14 CG 86 1 Y 1 C LYS 63 ? CD ? C LYS 14 CD 87 1 Y 1 C LYS 63 ? CE ? C LYS 14 CE 88 1 Y 1 C LYS 63 ? NZ ? C LYS 14 NZ 89 1 Y 1 C ASP 64 ? CG ? C ASP 15 CG 90 1 Y 1 C ASP 64 ? OD1 ? C ASP 15 OD1 91 1 Y 1 C ASP 64 ? OD2 ? C ASP 15 OD2 92 1 Y 1 C ARG 73 ? CG ? C ARG 24 CG 93 1 Y 1 C ARG 73 ? CD ? C ARG 24 CD 94 1 Y 1 C ARG 73 ? NE ? C ARG 24 NE 95 1 Y 1 C ARG 73 ? CZ ? C ARG 24 CZ 96 1 Y 1 C ARG 73 ? NH1 ? C ARG 24 NH1 97 1 Y 1 C ARG 73 ? NH2 ? C ARG 24 NH2 98 1 Y 1 C GLU 80 ? CG ? C GLU 31 CG 99 1 Y 1 C GLU 80 ? CD ? C GLU 31 CD 100 1 Y 1 C GLU 80 ? OE1 ? C GLU 31 OE1 101 1 Y 1 C GLU 80 ? OE2 ? C GLU 31 OE2 102 1 Y 1 D ARG 28 ? CG ? D ARG 11 CG 103 1 Y 1 D ARG 28 ? CD ? D ARG 11 CD 104 1 Y 1 D ARG 28 ? NE ? D ARG 11 NE 105 1 Y 1 D ARG 28 ? CZ ? D ARG 11 CZ 106 1 Y 1 D ARG 28 ? NH1 ? D ARG 11 NH1 107 1 Y 1 D ARG 28 ? NH2 ? D ARG 11 NH2 108 1 Y 1 D ARG 29 ? CG ? D ARG 12 CG 109 1 Y 1 D ARG 29 ? CD ? D ARG 12 CD 110 1 Y 1 D ARG 29 ? NE ? D ARG 12 NE 111 1 Y 1 D ARG 29 ? CZ ? D ARG 12 CZ 112 1 Y 1 D ARG 29 ? NH1 ? D ARG 12 NH1 113 1 Y 1 D ARG 29 ? NH2 ? D ARG 12 NH2 114 1 Y 1 D LEU 30 ? CG ? D LEU 13 CG 115 1 Y 1 D LEU 30 ? CD1 ? D LEU 13 CD1 116 1 Y 1 D LEU 30 ? CD2 ? D LEU 13 CD2 117 1 Y 1 D LEU 31 ? CG ? D LEU 14 CG 118 1 Y 1 D LEU 31 ? CD1 ? D LEU 14 CD1 119 1 Y 1 D LEU 31 ? CD2 ? D LEU 14 CD2 120 1 Y 1 D ARG 59 ? CG ? D ARG 42 CG 121 1 Y 1 D ARG 59 ? CD ? D ARG 42 CD 122 1 Y 1 D ARG 59 ? NE ? D ARG 42 NE 123 1 Y 1 D ARG 59 ? CZ ? D ARG 42 CZ 124 1 Y 1 D ARG 59 ? NH1 ? D ARG 42 NH1 125 1 Y 1 D ARG 59 ? NH2 ? D ARG 42 NH2 126 1 Y 1 D GLU 62 ? CG ? D GLU 45 CG 127 1 Y 1 D GLU 62 ? CD ? D GLU 45 CD 128 1 Y 1 D GLU 62 ? OE1 ? D GLU 45 OE1 129 1 Y 1 D GLU 62 ? OE2 ? D GLU 45 OE2 130 1 Y 1 D ARG 64 ? CG ? D ARG 47 CG 131 1 Y 1 D ARG 64 ? CD ? D ARG 47 CD 132 1 Y 1 D ARG 64 ? NE ? D ARG 47 NE 133 1 Y 1 D ARG 64 ? CZ ? D ARG 47 CZ 134 1 Y 1 D ARG 64 ? NH1 ? D ARG 47 NH1 135 1 Y 1 D ARG 64 ? NH2 ? D ARG 47 NH2 136 1 Y 1 D GLU 94 ? CG ? D GLU 77 CG 137 1 Y 1 D GLU 94 ? CD ? D GLU 77 CD 138 1 Y 1 D GLU 94 ? OE1 ? D GLU 77 OE1 139 1 Y 1 D GLU 94 ? OE2 ? D GLU 77 OE2 140 1 Y 1 D ARG 105 ? CG ? D ARG 88 CG 141 1 Y 1 D ARG 105 ? CD ? D ARG 88 CD 142 1 Y 1 D ARG 105 ? NE ? D ARG 88 NE 143 1 Y 1 D ARG 105 ? CZ ? D ARG 88 CZ 144 1 Y 1 D ARG 105 ? NH1 ? D ARG 88 NH1 145 1 Y 1 D ARG 105 ? NH2 ? D ARG 88 NH2 146 1 Y 1 D LYS 107 ? CG ? D LYS 90 CG 147 1 Y 1 D LYS 107 ? CD ? D LYS 90 CD 148 1 Y 1 D LYS 107 ? CE ? D LYS 90 CE 149 1 Y 1 D LYS 107 ? NZ ? D LYS 90 NZ 150 1 Y 1 D LYS 119 ? CG ? D LYS 102 CG 151 1 Y 1 D LYS 119 ? CD ? D LYS 102 CD 152 1 Y 1 D LYS 119 ? CE ? D LYS 102 CE 153 1 Y 1 D LYS 119 ? NZ ? D LYS 102 NZ 154 1 Y 1 D LYS 142 ? CG ? D LYS 125 CG 155 1 Y 1 D LYS 142 ? CD ? D LYS 125 CD 156 1 Y 1 D LYS 142 ? CE ? D LYS 125 CE 157 1 Y 1 D LYS 142 ? NZ ? D LYS 125 NZ 158 1 Y 1 D ARG 145 ? CG ? D ARG 128 CG 159 1 Y 1 D ARG 145 ? CD ? D ARG 128 CD 160 1 Y 1 D ARG 145 ? NE ? D ARG 128 NE 161 1 Y 1 D ARG 145 ? CZ ? D ARG 128 CZ 162 1 Y 1 D ARG 145 ? NH1 ? D ARG 128 NH1 163 1 Y 1 D ARG 145 ? NH2 ? D ARG 128 NH2 164 1 Y 1 D LYS 157 ? CG ? D LYS 140 CG 165 1 Y 1 D LYS 157 ? CD ? D LYS 140 CD 166 1 Y 1 D LYS 157 ? CE ? D LYS 140 CE 167 1 Y 1 D LYS 157 ? NZ ? D LYS 140 NZ 168 1 Y 1 D ASN 158 ? CG ? D ASN 141 CG 169 1 Y 1 D ASN 158 ? OD1 ? D ASN 141 OD1 170 1 Y 1 D ASN 158 ? ND2 ? D ASN 141 ND2 171 1 Y 1 D LYS 169 ? CG ? D LYS 152 CG 172 1 Y 1 D LYS 169 ? CD ? D LYS 152 CD 173 1 Y 1 D LYS 169 ? CE ? D LYS 152 CE 174 1 Y 1 D LYS 169 ? NZ ? D LYS 152 NZ 175 1 Y 1 E LYS 63 ? CG ? E LYS 13 CG 176 1 Y 1 E LYS 63 ? CD ? E LYS 13 CD 177 1 Y 1 E LYS 63 ? CE ? E LYS 13 CE 178 1 Y 1 E LYS 63 ? NZ ? E LYS 13 NZ 179 1 Y 1 E ASP 64 ? CG ? E ASP 14 CG 180 1 Y 1 E ASP 64 ? OD1 ? E ASP 14 OD1 181 1 Y 1 E ASP 64 ? OD2 ? E ASP 14 OD2 182 1 Y 1 E GLU 66 ? CG ? E GLU 16 CG 183 1 Y 1 E GLU 66 ? CD ? E GLU 16 CD 184 1 Y 1 E GLU 66 ? OE1 ? E GLU 16 OE1 185 1 Y 1 E GLU 66 ? OE2 ? E GLU 16 OE2 186 1 Y 1 E ARG 73 ? CG ? E ARG 23 CG 187 1 Y 1 E ARG 73 ? CD ? E ARG 23 CD 188 1 Y 1 E ARG 73 ? NE ? E ARG 23 NE 189 1 Y 1 E ARG 73 ? CZ ? E ARG 23 CZ 190 1 Y 1 E ARG 73 ? NH1 ? E ARG 23 NH1 191 1 Y 1 E ARG 73 ? NH2 ? E ARG 23 NH2 192 1 Y 1 F ARG 28 ? CG ? F ARG 15 CG 193 1 Y 1 F ARG 28 ? CD ? F ARG 15 CD 194 1 Y 1 F ARG 28 ? NE ? F ARG 15 NE 195 1 Y 1 F ARG 28 ? CZ ? F ARG 15 CZ 196 1 Y 1 F ARG 28 ? NH1 ? F ARG 15 NH1 197 1 Y 1 F ARG 28 ? NH2 ? F ARG 15 NH2 198 1 Y 1 F ARG 29 ? CG ? F ARG 16 CG 199 1 Y 1 F ARG 29 ? CD ? F ARG 16 CD 200 1 Y 1 F ARG 29 ? NE ? F ARG 16 NE 201 1 Y 1 F ARG 29 ? CZ ? F ARG 16 CZ 202 1 Y 1 F ARG 29 ? NH1 ? F ARG 16 NH1 203 1 Y 1 F ARG 29 ? NH2 ? F ARG 16 NH2 204 1 Y 1 F LEU 30 ? CG ? F LEU 17 CG 205 1 Y 1 F LEU 30 ? CD1 ? F LEU 17 CD1 206 1 Y 1 F LEU 30 ? CD2 ? F LEU 17 CD2 207 1 Y 1 F LYS 54 ? CG ? F LYS 41 CG 208 1 Y 1 F LYS 54 ? CD ? F LYS 41 CD 209 1 Y 1 F LYS 54 ? CE ? F LYS 41 CE 210 1 Y 1 F LYS 54 ? NZ ? F LYS 41 NZ 211 1 Y 1 F ARG 59 ? CG ? F ARG 46 CG 212 1 Y 1 F ARG 59 ? CD ? F ARG 46 CD 213 1 Y 1 F ARG 59 ? NE ? F ARG 46 NE 214 1 Y 1 F ARG 59 ? CZ ? F ARG 46 CZ 215 1 Y 1 F ARG 59 ? NH1 ? F ARG 46 NH1 216 1 Y 1 F ARG 59 ? NH2 ? F ARG 46 NH2 217 1 Y 1 F ARG 105 ? CG ? F ARG 92 CG 218 1 Y 1 F ARG 105 ? CD ? F ARG 92 CD 219 1 Y 1 F ARG 105 ? NE ? F ARG 92 NE 220 1 Y 1 F ARG 105 ? CZ ? F ARG 92 CZ 221 1 Y 1 F ARG 105 ? NH1 ? F ARG 92 NH1 222 1 Y 1 F ARG 105 ? NH2 ? F ARG 92 NH2 223 1 Y 1 F LYS 119 ? CG ? F LYS 106 CG 224 1 Y 1 F LYS 119 ? CD ? F LYS 106 CD 225 1 Y 1 F LYS 119 ? CE ? F LYS 106 CE 226 1 Y 1 F LYS 119 ? NZ ? F LYS 106 NZ 227 1 Y 1 F LYS 142 ? CG ? F LYS 129 CG 228 1 Y 1 F LYS 142 ? CD ? F LYS 129 CD 229 1 Y 1 F LYS 142 ? CE ? F LYS 129 CE 230 1 Y 1 F LYS 142 ? NZ ? F LYS 129 NZ 231 1 Y 1 F LYS 157 ? CG ? F LYS 144 CG 232 1 Y 1 F LYS 157 ? CD ? F LYS 144 CD 233 1 Y 1 F LYS 157 ? CE ? F LYS 144 CE 234 1 Y 1 F LYS 157 ? NZ ? F LYS 144 NZ 235 1 Y 1 F LYS 169 ? CG ? F LYS 156 CG 236 1 Y 1 F LYS 169 ? CD ? F LYS 156 CD 237 1 Y 1 F LYS 169 ? CE ? F LYS 156 CE 238 1 Y 1 F LYS 169 ? NZ ? F LYS 156 NZ 239 1 Y 1 F GLU 171 ? CG ? F GLU 158 CG 240 1 Y 1 F GLU 171 ? CD ? F GLU 158 CD 241 1 Y 1 F GLU 171 ? OE1 ? F GLU 158 OE1 242 1 Y 1 F GLU 171 ? OE2 ? F GLU 158 OE2 243 1 Y 1 G LYS 63 ? CG ? G LYS 14 CG 244 1 Y 1 G LYS 63 ? CD ? G LYS 14 CD 245 1 Y 1 G LYS 63 ? CE ? G LYS 14 CE 246 1 Y 1 G LYS 63 ? NZ ? G LYS 14 NZ 247 1 Y 1 G ASP 64 ? CG ? G ASP 15 CG 248 1 Y 1 G ASP 64 ? OD1 ? G ASP 15 OD1 249 1 Y 1 G ASP 64 ? OD2 ? G ASP 15 OD2 250 1 Y 1 G GLU 66 ? CG ? G GLU 17 CG 251 1 Y 1 G GLU 66 ? CD ? G GLU 17 CD 252 1 Y 1 G GLU 66 ? OE1 ? G GLU 17 OE1 253 1 Y 1 G GLU 66 ? OE2 ? G GLU 17 OE2 254 1 Y 1 G ARG 73 ? CG ? G ARG 24 CG 255 1 Y 1 G ARG 73 ? CD ? G ARG 24 CD 256 1 Y 1 G ARG 73 ? NE ? G ARG 24 NE 257 1 Y 1 G ARG 73 ? CZ ? G ARG 24 CZ 258 1 Y 1 G ARG 73 ? NH1 ? G ARG 24 NH1 259 1 Y 1 G ARG 73 ? NH2 ? G ARG 24 NH2 260 1 Y 1 H ARG 28 ? CG ? H ARG 11 CG 261 1 Y 1 H ARG 28 ? CD ? H ARG 11 CD 262 1 Y 1 H ARG 28 ? NE ? H ARG 11 NE 263 1 Y 1 H ARG 28 ? CZ ? H ARG 11 CZ 264 1 Y 1 H ARG 28 ? NH1 ? H ARG 11 NH1 265 1 Y 1 H ARG 28 ? NH2 ? H ARG 11 NH2 266 1 Y 1 H ARG 29 ? CG ? H ARG 12 CG 267 1 Y 1 H ARG 29 ? CD ? H ARG 12 CD 268 1 Y 1 H ARG 29 ? NE ? H ARG 12 NE 269 1 Y 1 H ARG 29 ? CZ ? H ARG 12 CZ 270 1 Y 1 H ARG 29 ? NH1 ? H ARG 12 NH1 271 1 Y 1 H ARG 29 ? NH2 ? H ARG 12 NH2 272 1 Y 1 H LEU 30 ? CG ? H LEU 13 CG 273 1 Y 1 H LEU 30 ? CD1 ? H LEU 13 CD1 274 1 Y 1 H LEU 30 ? CD2 ? H LEU 13 CD2 275 1 Y 1 H GLU 62 ? CG ? H GLU 45 CG 276 1 Y 1 H GLU 62 ? CD ? H GLU 45 CD 277 1 Y 1 H GLU 62 ? OE1 ? H GLU 45 OE1 278 1 Y 1 H GLU 62 ? OE2 ? H GLU 45 OE2 279 1 Y 1 H LEU 65 ? CG ? H LEU 48 CG 280 1 Y 1 H LEU 65 ? CD1 ? H LEU 48 CD1 281 1 Y 1 H LEU 65 ? CD2 ? H LEU 48 CD2 282 1 Y 1 H ARG 105 ? CG ? H ARG 88 CG 283 1 Y 1 H ARG 105 ? CD ? H ARG 88 CD 284 1 Y 1 H ARG 105 ? NE ? H ARG 88 NE 285 1 Y 1 H ARG 105 ? CZ ? H ARG 88 CZ 286 1 Y 1 H ARG 105 ? NH1 ? H ARG 88 NH1 287 1 Y 1 H ARG 105 ? NH2 ? H ARG 88 NH2 288 1 Y 1 H LYS 142 ? CG ? H LYS 125 CG 289 1 Y 1 H LYS 142 ? CD ? H LYS 125 CD 290 1 Y 1 H LYS 142 ? CE ? H LYS 125 CE 291 1 Y 1 H LYS 142 ? NZ ? H LYS 125 NZ 292 1 Y 1 H LYS 157 ? CG ? H LYS 140 CG 293 1 Y 1 H LYS 157 ? CD ? H LYS 140 CD 294 1 Y 1 H LYS 157 ? CE ? H LYS 140 CE 295 1 Y 1 H LYS 157 ? NZ ? H LYS 140 NZ 296 1 Y 1 H LYS 169 ? CG ? H LYS 152 CG 297 1 Y 1 H LYS 169 ? CD ? H LYS 152 CD 298 1 Y 1 H LYS 169 ? CE ? H LYS 152 CE 299 1 Y 1 H LYS 169 ? NZ ? H LYS 152 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 F LEU 31 ? F LEU 18 2 1 Y 1 F GLY 32 ? F GLY 19 3 1 Y 1 F SER 33 ? F SER 20 4 1 Y 1 F GLY 61 ? F GLY 48 5 1 Y 1 F GLU 62 ? F GLU 49 6 1 Y 1 F GLY 63 ? F GLY 50 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HHC C10 C Y N 137 HHC C13 C N N 138 HHC C15 C N N 139 HHC C C N N 140 HHC C02 C N N 141 HHC C04 C N R 142 HHC C06 C N N 143 HHC C08 C N N 144 HHC C11 C Y N 145 HHC C12 C Y N 146 HHC CA C N R 147 HHC C55 C Y N 148 HHC C56 C Y N 149 HHC N01 N N N 150 HHC N05 N N N 151 HHC N07 N N N 152 HHC N N N N 153 HHC N54 N Y N 154 HHC O03 O N N 155 HHC O09 O N N 156 HHC O O N N 157 HHC S14 S N N 158 HHC H151 H N N 159 HHC H152 H N N 160 HHC H6 H N N 161 HHC H3 H N N 162 HHC H061 H N N 163 HHC H062 H N N 164 HHC H111 H N N 165 HHC HA H N N 166 HHC H551 H N N 167 HHC H561 H N N 168 HHC H011 H N N 169 HHC H012 H N N 170 HHC H5 H N N 171 HHC H051 H N N 172 HHC H071 H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 HOH O O N N 195 HOH H1 H N N 196 HOH H2 H N N 197 ILE N N N N 198 ILE CA C N S 199 ILE C C N N 200 ILE O O N N 201 ILE CB C N S 202 ILE CG1 C N N 203 ILE CG2 C N N 204 ILE CD1 C N N 205 ILE OXT O N N 206 ILE H H N N 207 ILE H2 H N N 208 ILE HA H N N 209 ILE HB H N N 210 ILE HG12 H N N 211 ILE HG13 H N N 212 ILE HG21 H N N 213 ILE HG22 H N N 214 ILE HG23 H N N 215 ILE HD11 H N N 216 ILE HD12 H N N 217 ILE HD13 H N N 218 ILE HXT H N N 219 LEU N N N N 220 LEU CA C N S 221 LEU C C N N 222 LEU O O N N 223 LEU CB C N N 224 LEU CG C N N 225 LEU CD1 C N N 226 LEU CD2 C N N 227 LEU OXT O N N 228 LEU H H N N 229 LEU H2 H N N 230 LEU HA H N N 231 LEU HB2 H N N 232 LEU HB3 H N N 233 LEU HG H N N 234 LEU HD11 H N N 235 LEU HD12 H N N 236 LEU HD13 H N N 237 LEU HD21 H N N 238 LEU HD22 H N N 239 LEU HD23 H N N 240 LEU HXT H N N 241 LYS N N N N 242 LYS CA C N S 243 LYS C C N N 244 LYS O O N N 245 LYS CB C N N 246 LYS CG C N N 247 LYS CD C N N 248 LYS CE C N N 249 LYS NZ N N N 250 LYS OXT O N N 251 LYS H H N N 252 LYS H2 H N N 253 LYS HA H N N 254 LYS HB2 H N N 255 LYS HB3 H N N 256 LYS HG2 H N N 257 LYS HG3 H N N 258 LYS HD2 H N N 259 LYS HD3 H N N 260 LYS HE2 H N N 261 LYS HE3 H N N 262 LYS HZ1 H N N 263 LYS HZ2 H N N 264 LYS HZ3 H N N 265 LYS HXT H N N 266 MET N N N N 267 MET CA C N S 268 MET C C N N 269 MET O O N N 270 MET CB C N N 271 MET CG C N N 272 MET SD S N N 273 MET CE C N N 274 MET OXT O N N 275 MET H H N N 276 MET H2 H N N 277 MET HA H N N 278 MET HB2 H N N 279 MET HB3 H N N 280 MET HG2 H N N 281 MET HG3 H N N 282 MET HE1 H N N 283 MET HE2 H N N 284 MET HE3 H N N 285 MET HXT H N N 286 PHE N N N N 287 PHE CA C N S 288 PHE C C N N 289 PHE O O N N 290 PHE CB C N N 291 PHE CG C Y N 292 PHE CD1 C Y N 293 PHE CD2 C Y N 294 PHE CE1 C Y N 295 PHE CE2 C Y N 296 PHE CZ C Y N 297 PHE OXT O N N 298 PHE H H N N 299 PHE H2 H N N 300 PHE HA H N N 301 PHE HB2 H N N 302 PHE HB3 H N N 303 PHE HD1 H N N 304 PHE HD2 H N N 305 PHE HE1 H N N 306 PHE HE2 H N N 307 PHE HZ H N N 308 PHE HXT H N N 309 PRO N N N N 310 PRO CA C N S 311 PRO C C N N 312 PRO O O N N 313 PRO CB C N N 314 PRO CG C N N 315 PRO CD C N N 316 PRO OXT O N N 317 PRO H H N N 318 PRO HA H N N 319 PRO HB2 H N N 320 PRO HB3 H N N 321 PRO HG2 H N N 322 PRO HG3 H N N 323 PRO HD2 H N N 324 PRO HD3 H N N 325 PRO HXT H N N 326 SER N N N N 327 SER CA C N S 328 SER C C N N 329 SER O O N N 330 SER CB C N N 331 SER OG O N N 332 SER OXT O N N 333 SER H H N N 334 SER H2 H N N 335 SER HA H N N 336 SER HB2 H N N 337 SER HB3 H N N 338 SER HG H N N 339 SER HXT H N N 340 THR N N N N 341 THR CA C N S 342 THR C C N N 343 THR O O N N 344 THR CB C N R 345 THR OG1 O N N 346 THR CG2 C N N 347 THR OXT O N N 348 THR H H N N 349 THR H2 H N N 350 THR HA H N N 351 THR HB H N N 352 THR HG1 H N N 353 THR HG21 H N N 354 THR HG22 H N N 355 THR HG23 H N N 356 THR HXT H N N 357 TRP N N N N 358 TRP CA C N S 359 TRP C C N N 360 TRP O O N N 361 TRP CB C N N 362 TRP CG C Y N 363 TRP CD1 C Y N 364 TRP CD2 C Y N 365 TRP NE1 N Y N 366 TRP CE2 C Y N 367 TRP CE3 C Y N 368 TRP CZ2 C Y N 369 TRP CZ3 C Y N 370 TRP CH2 C Y N 371 TRP OXT O N N 372 TRP H H N N 373 TRP H2 H N N 374 TRP HA H N N 375 TRP HB2 H N N 376 TRP HB3 H N N 377 TRP HD1 H N N 378 TRP HE1 H N N 379 TRP HE3 H N N 380 TRP HZ2 H N N 381 TRP HZ3 H N N 382 TRP HH2 H N N 383 TRP HXT H N N 384 TYR N N N N 385 TYR CA C N S 386 TYR C C N N 387 TYR O O N N 388 TYR CB C N N 389 TYR CG C Y N 390 TYR CD1 C Y N 391 TYR CD2 C Y N 392 TYR CE1 C Y N 393 TYR CE2 C Y N 394 TYR CZ C Y N 395 TYR OH O N N 396 TYR OXT O N N 397 TYR H H N N 398 TYR H2 H N N 399 TYR HA H N N 400 TYR HB2 H N N 401 TYR HB3 H N N 402 TYR HD1 H N N 403 TYR HD2 H N N 404 TYR HE1 H N N 405 TYR HE2 H N N 406 TYR HH H N N 407 TYR HXT H N N 408 VAL N N N N 409 VAL CA C N S 410 VAL C C N N 411 VAL O O N N 412 VAL CB C N N 413 VAL CG1 C N N 414 VAL CG2 C N N 415 VAL OXT O N N 416 VAL H H N N 417 VAL H2 H N N 418 VAL HA H N N 419 VAL HB H N N 420 VAL HG11 H N N 421 VAL HG12 H N N 422 VAL HG13 H N N 423 VAL HG21 H N N 424 VAL HG22 H N N 425 VAL HG23 H N N 426 VAL HXT H N N 427 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HHC O03 C02 doub N N 129 HHC O09 C08 doub N N 130 HHC N01 C02 sing N N 131 HHC C02 C04 sing N N 132 HHC C06 C04 sing N N 133 HHC C06 N07 sing N N 134 HHC C08 N07 sing N N 135 HHC C08 C10 sing N N 136 HHC C04 N05 sing N N 137 HHC C56 C10 doub Y N 138 HHC C56 C55 sing Y N 139 HHC C10 C11 sing Y N 140 HHC C55 N54 doub Y N 141 HHC C11 C12 doub Y N 142 HHC N54 C12 sing Y N 143 HHC C12 C13 sing N N 144 HHC C13 N doub N N 145 HHC C13 S14 sing N N 146 HHC N CA sing N N 147 HHC S14 C15 sing N N 148 HHC C CA sing N N 149 HHC C O doub N N 150 HHC CA C15 sing N N 151 HHC C15 H151 sing N N 152 HHC C15 H152 sing N N 153 HHC C H6 sing N N 154 HHC C04 H3 sing N N 155 HHC C06 H061 sing N N 156 HHC C06 H062 sing N N 157 HHC C11 H111 sing N N 158 HHC CA HA sing N N 159 HHC C55 H551 sing N N 160 HHC C56 H561 sing N N 161 HHC N01 H011 sing N N 162 HHC N01 H012 sing N N 163 HHC N05 H5 sing N N 164 HHC N05 H051 sing N N 165 HHC N07 H071 sing N N 166 HIS N CA sing N N 167 HIS N H sing N N 168 HIS N H2 sing N N 169 HIS CA C sing N N 170 HIS CA CB sing N N 171 HIS CA HA sing N N 172 HIS C O doub N N 173 HIS C OXT sing N N 174 HIS CB CG sing N N 175 HIS CB HB2 sing N N 176 HIS CB HB3 sing N N 177 HIS CG ND1 sing Y N 178 HIS CG CD2 doub Y N 179 HIS ND1 CE1 doub Y N 180 HIS ND1 HD1 sing N N 181 HIS CD2 NE2 sing Y N 182 HIS CD2 HD2 sing N N 183 HIS CE1 NE2 sing Y N 184 HIS CE1 HE1 sing N N 185 HIS NE2 HE2 sing N N 186 HIS OXT HXT sing N N 187 HOH O H1 sing N N 188 HOH O H2 sing N N 189 ILE N CA sing N N 190 ILE N H sing N N 191 ILE N H2 sing N N 192 ILE CA C sing N N 193 ILE CA CB sing N N 194 ILE CA HA sing N N 195 ILE C O doub N N 196 ILE C OXT sing N N 197 ILE CB CG1 sing N N 198 ILE CB CG2 sing N N 199 ILE CB HB sing N N 200 ILE CG1 CD1 sing N N 201 ILE CG1 HG12 sing N N 202 ILE CG1 HG13 sing N N 203 ILE CG2 HG21 sing N N 204 ILE CG2 HG22 sing N N 205 ILE CG2 HG23 sing N N 206 ILE CD1 HD11 sing N N 207 ILE CD1 HD12 sing N N 208 ILE CD1 HD13 sing N N 209 ILE OXT HXT sing N N 210 LEU N CA sing N N 211 LEU N H sing N N 212 LEU N H2 sing N N 213 LEU CA C sing N N 214 LEU CA CB sing N N 215 LEU CA HA sing N N 216 LEU C O doub N N 217 LEU C OXT sing N N 218 LEU CB CG sing N N 219 LEU CB HB2 sing N N 220 LEU CB HB3 sing N N 221 LEU CG CD1 sing N N 222 LEU CG CD2 sing N N 223 LEU CG HG sing N N 224 LEU CD1 HD11 sing N N 225 LEU CD1 HD12 sing N N 226 LEU CD1 HD13 sing N N 227 LEU CD2 HD21 sing N N 228 LEU CD2 HD22 sing N N 229 LEU CD2 HD23 sing N N 230 LEU OXT HXT sing N N 231 LYS N CA sing N N 232 LYS N H sing N N 233 LYS N H2 sing N N 234 LYS CA C sing N N 235 LYS CA CB sing N N 236 LYS CA HA sing N N 237 LYS C O doub N N 238 LYS C OXT sing N N 239 LYS CB CG sing N N 240 LYS CB HB2 sing N N 241 LYS CB HB3 sing N N 242 LYS CG CD sing N N 243 LYS CG HG2 sing N N 244 LYS CG HG3 sing N N 245 LYS CD CE sing N N 246 LYS CD HD2 sing N N 247 LYS CD HD3 sing N N 248 LYS CE NZ sing N N 249 LYS CE HE2 sing N N 250 LYS CE HE3 sing N N 251 LYS NZ HZ1 sing N N 252 LYS NZ HZ2 sing N N 253 LYS NZ HZ3 sing N N 254 LYS OXT HXT sing N N 255 MET N CA sing N N 256 MET N H sing N N 257 MET N H2 sing N N 258 MET CA C sing N N 259 MET CA CB sing N N 260 MET CA HA sing N N 261 MET C O doub N N 262 MET C OXT sing N N 263 MET CB CG sing N N 264 MET CB HB2 sing N N 265 MET CB HB3 sing N N 266 MET CG SD sing N N 267 MET CG HG2 sing N N 268 MET CG HG3 sing N N 269 MET SD CE sing N N 270 MET CE HE1 sing N N 271 MET CE HE2 sing N N 272 MET CE HE3 sing N N 273 MET OXT HXT sing N N 274 PHE N CA sing N N 275 PHE N H sing N N 276 PHE N H2 sing N N 277 PHE CA C sing N N 278 PHE CA CB sing N N 279 PHE CA HA sing N N 280 PHE C O doub N N 281 PHE C OXT sing N N 282 PHE CB CG sing N N 283 PHE CB HB2 sing N N 284 PHE CB HB3 sing N N 285 PHE CG CD1 doub Y N 286 PHE CG CD2 sing Y N 287 PHE CD1 CE1 sing Y N 288 PHE CD1 HD1 sing N N 289 PHE CD2 CE2 doub Y N 290 PHE CD2 HD2 sing N N 291 PHE CE1 CZ doub Y N 292 PHE CE1 HE1 sing N N 293 PHE CE2 CZ sing Y N 294 PHE CE2 HE2 sing N N 295 PHE CZ HZ sing N N 296 PHE OXT HXT sing N N 297 PRO N CA sing N N 298 PRO N CD sing N N 299 PRO N H sing N N 300 PRO CA C sing N N 301 PRO CA CB sing N N 302 PRO CA HA sing N N 303 PRO C O doub N N 304 PRO C OXT sing N N 305 PRO CB CG sing N N 306 PRO CB HB2 sing N N 307 PRO CB HB3 sing N N 308 PRO CG CD sing N N 309 PRO CG HG2 sing N N 310 PRO CG HG3 sing N N 311 PRO CD HD2 sing N N 312 PRO CD HD3 sing N N 313 PRO OXT HXT sing N N 314 SER N CA sing N N 315 SER N H sing N N 316 SER N H2 sing N N 317 SER CA C sing N N 318 SER CA CB sing N N 319 SER CA HA sing N N 320 SER C O doub N N 321 SER C OXT sing N N 322 SER CB OG sing N N 323 SER CB HB2 sing N N 324 SER CB HB3 sing N N 325 SER OG HG sing N N 326 SER OXT HXT sing N N 327 THR N CA sing N N 328 THR N H sing N N 329 THR N H2 sing N N 330 THR CA C sing N N 331 THR CA CB sing N N 332 THR CA HA sing N N 333 THR C O doub N N 334 THR C OXT sing N N 335 THR CB OG1 sing N N 336 THR CB CG2 sing N N 337 THR CB HB sing N N 338 THR OG1 HG1 sing N N 339 THR CG2 HG21 sing N N 340 THR CG2 HG22 sing N N 341 THR CG2 HG23 sing N N 342 THR OXT HXT sing N N 343 TRP N CA sing N N 344 TRP N H sing N N 345 TRP N H2 sing N N 346 TRP CA C sing N N 347 TRP CA CB sing N N 348 TRP CA HA sing N N 349 TRP C O doub N N 350 TRP C OXT sing N N 351 TRP CB CG sing N N 352 TRP CB HB2 sing N N 353 TRP CB HB3 sing N N 354 TRP CG CD1 doub Y N 355 TRP CG CD2 sing Y N 356 TRP CD1 NE1 sing Y N 357 TRP CD1 HD1 sing N N 358 TRP CD2 CE2 doub Y N 359 TRP CD2 CE3 sing Y N 360 TRP NE1 CE2 sing Y N 361 TRP NE1 HE1 sing N N 362 TRP CE2 CZ2 sing Y N 363 TRP CE3 CZ3 doub Y N 364 TRP CE3 HE3 sing N N 365 TRP CZ2 CH2 doub Y N 366 TRP CZ2 HZ2 sing N N 367 TRP CZ3 CH2 sing Y N 368 TRP CZ3 HZ3 sing N N 369 TRP CH2 HH2 sing N N 370 TRP OXT HXT sing N N 371 TYR N CA sing N N 372 TYR N H sing N N 373 TYR N H2 sing N N 374 TYR CA C sing N N 375 TYR CA CB sing N N 376 TYR CA HA sing N N 377 TYR C O doub N N 378 TYR C OXT sing N N 379 TYR CB CG sing N N 380 TYR CB HB2 sing N N 381 TYR CB HB3 sing N N 382 TYR CG CD1 doub Y N 383 TYR CG CD2 sing Y N 384 TYR CD1 CE1 sing Y N 385 TYR CD1 HD1 sing N N 386 TYR CD2 CE2 doub Y N 387 TYR CD2 HD2 sing N N 388 TYR CE1 CZ doub Y N 389 TYR CE1 HE1 sing N N 390 TYR CE2 CZ sing Y N 391 TYR CE2 HE2 sing N N 392 TYR CZ OH sing N N 393 TYR OH HH sing N N 394 TYR OXT HXT sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Other government' Singapore 'Start up grant' 1 'Other government' Singapore CBRG15May045 2 'Other government' Singapore NRF2016NRF-CRP001-063 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HHC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HHC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 9 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5GPI _pdbx_initial_refinement_model.details ? # _pdbx_reflns_twin.domain_id 1 _pdbx_reflns_twin.crystal_id 1 _pdbx_reflns_twin.diffrn_id 1 _pdbx_reflns_twin.fraction 0.150 _pdbx_reflns_twin.operator k,h,-l _pdbx_reflns_twin.type ? _pdbx_reflns_twin.mean_F_square_over_mean_F2 ? _pdbx_reflns_twin.mean_I2_over_mean_I_square ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 2 'gel filtration' ? 3 4 'gel filtration' ? 4 3 'gel filtration' ? #