data_7DU6 # _entry.id 7DU6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DU6 pdb_00007du6 10.2210/pdb7du6/pdb WWPDB D_1300020105 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DU6 _pdbx_database_status.recvd_initial_deposition_date 2021-01-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yagi, S.' 1 ? 'Tagami, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 143 _citation.language ? _citation.page_first 15998 _citation.page_last 16006 _citation.title 'Seven Amino Acid Types Suffice to Create the Core Fold of RNA Polymerase.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.1c05367 _citation.pdbx_database_id_PubMed 34559526 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yagi, S.' 1 ? primary 'Padhi, A.K.' 2 ? primary 'Vucinic, J.' 3 ? primary 'Barbe, S.' 4 ? primary 'Schiex, T.' 5 ? primary 'Nakagawa, R.' 6 0000-0002-6178-2945 primary 'Simoncini, D.' 7 ? primary 'Zhang, K.Y.J.' 8 0000-0002-9282-8045 primary 'Tagami, S.' 9 0000-0002-1720-3627 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7DU6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.891 _cell.length_a_esd ? _cell.length_b 70.891 _cell.length_b_esd ? _cell.length_c 64.045 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DU6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'mkDPBB_sym2 protein' 10118.846 1 ? ? ? ? 2 water nat water 18.015 85 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMPGKSVVARVAEAYPEDVGKRIVRMDKYERAKLGVSVGDYVEVKKVKSVVARVAEAYPEDVGKRIVRMDKYERAKLGV SVGDYVEVKKV ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMPGKSVVARVAEAYPEDVGKRIVRMDKYERAKLGVSVGDYVEVKKVKSVVARVAEAYPEDVGKRIVRMDKYERAKLGV SVGDYVEVKKV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 PRO n 1 5 GLY n 1 6 LYS n 1 7 SER n 1 8 VAL n 1 9 VAL n 1 10 ALA n 1 11 ARG n 1 12 VAL n 1 13 ALA n 1 14 GLU n 1 15 ALA n 1 16 TYR n 1 17 PRO n 1 18 GLU n 1 19 ASP n 1 20 VAL n 1 21 GLY n 1 22 LYS n 1 23 ARG n 1 24 ILE n 1 25 VAL n 1 26 ARG n 1 27 MET n 1 28 ASP n 1 29 LYS n 1 30 TYR n 1 31 GLU n 1 32 ARG n 1 33 ALA n 1 34 LYS n 1 35 LEU n 1 36 GLY n 1 37 VAL n 1 38 SER n 1 39 VAL n 1 40 GLY n 1 41 ASP n 1 42 TYR n 1 43 VAL n 1 44 GLU n 1 45 VAL n 1 46 LYS n 1 47 LYS n 1 48 VAL n 1 49 LYS n 1 50 SER n 1 51 VAL n 1 52 VAL n 1 53 ALA n 1 54 ARG n 1 55 VAL n 1 56 ALA n 1 57 GLU n 1 58 ALA n 1 59 TYR n 1 60 PRO n 1 61 GLU n 1 62 ASP n 1 63 VAL n 1 64 GLY n 1 65 LYS n 1 66 ARG n 1 67 ILE n 1 68 VAL n 1 69 ARG n 1 70 MET n 1 71 ASP n 1 72 LYS n 1 73 TYR n 1 74 GLU n 1 75 ARG n 1 76 ALA n 1 77 LYS n 1 78 LEU n 1 79 GLY n 1 80 VAL n 1 81 SER n 1 82 VAL n 1 83 GLY n 1 84 ASP n 1 85 TYR n 1 86 VAL n 1 87 GLU n 1 88 VAL n 1 89 LYS n 1 90 LYS n 1 91 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 91 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7DU6 _struct_ref.pdbx_db_accession 7DU6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7DU6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7DU6 _struct_ref_seq.db_align_beg -1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DU6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM CHES pH 9.5, 1M sodium citrate tribasic' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7DU6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15809 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.00 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.34 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.600 _reflns_shell.d_res_low 1.700 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2522 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.883 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 58.340 _refine.B_iso_mean 32.0494 _refine.B_iso_min 17.260 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DU6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6000 _refine.ls_d_res_low 44.3190 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15806 _refine.ls_number_reflns_R_free 1574 _refine.ls_number_reflns_R_work 14232 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9200 _refine.ls_percent_reflns_R_free 9.9600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1954 _refine.ls_R_factor_R_free 0.2080 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1940 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.050 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7DG7 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.4800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.6000 _refine_hist.d_res_low 44.3190 _refine_hist.number_atoms_solvent 85 _refine_hist.number_atoms_total 763 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 86 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 37.67 _refine_hist.pdbx_number_atoms_protein 678 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6003 1.6520 . . 142 1283 99.0000 . . . 0.2839 0.0000 0.2808 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6520 1.7110 . . 141 1286 100.0000 . . . 0.3443 0.0000 0.2720 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7110 1.7795 . . 143 1301 100.0000 . . . 0.2583 0.0000 0.2502 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7795 1.8605 . . 140 1283 100.0000 . . . 0.2601 0.0000 0.2450 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8605 1.9586 . . 140 1299 100.0000 . . . 0.2483 0.0000 0.2375 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9586 2.0813 . . 147 1309 100.0000 . . . 0.2259 0.0000 0.2174 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0813 2.2420 . . 139 1272 100.0000 . . . 0.2455 0.0000 0.1984 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2420 2.4676 . . 145 1323 100.0000 . . . 0.2156 0.0000 0.2050 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4676 2.8246 . . 142 1292 100.0000 . . . 0.2427 0.0000 0.1971 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8246 3.5585 . . 148 1301 100.0000 . . . 0.1833 0.0000 0.1771 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5585 44.3190 . . 147 1283 100.0000 . . . 0.1697 0.0000 0.1682 . . . . . . . . . . . # _struct.entry_id 7DU6 _struct.title 'Crystal structure of the rationally designed mkDPBB_sym2 protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DU6 _struct_keywords.text 'Double psi beta barrel, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 16 ? VAL A 20 ? TYR A 14 VAL A 18 5 ? 5 HELX_P HELX_P2 AA2 ASP A 28 ? GLY A 36 ? ASP A 26 GLY A 34 1 ? 9 HELX_P HELX_P3 AA3 TYR A 59 ? VAL A 63 ? TYR A 57 VAL A 61 5 ? 5 HELX_P HELX_P4 AA4 ASP A 71 ? GLY A 79 ? ASP A 69 GLY A 77 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 7 ? ALA A 13 ? SER A 5 ALA A 11 AA1 2 ILE A 67 ? ARG A 69 ? ILE A 65 ARG A 67 AA1 3 ILE A 24 ? ARG A 26 ? ILE A 22 ARG A 24 AA1 4 SER A 50 ? ALA A 56 ? SER A 48 ALA A 54 AA1 5 TYR A 42 ? LYS A 46 ? TYR A 40 LYS A 44 AA1 6 TYR A 85 ? LYS A 90 ? TYR A 83 LYS A 88 AA1 7 SER A 7 ? ALA A 13 ? SER A 5 ALA A 11 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 13 ? N ALA A 11 O VAL A 68 ? O VAL A 66 AA1 2 3 O ARG A 69 ? O ARG A 67 N ARG A 26 ? N ARG A 24 AA1 3 4 N VAL A 25 ? N VAL A 23 O ALA A 56 ? O ALA A 54 AA1 4 5 O VAL A 51 ? O VAL A 49 N VAL A 45 ? N VAL A 43 AA1 5 6 N LYS A 46 ? N LYS A 44 O GLU A 87 ? O GLU A 85 AA1 6 7 O VAL A 86 ? O VAL A 84 N ALA A 10 ? N ALA A 8 # _atom_sites.entry_id 7DU6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014106 _atom_sites.fract_transf_matrix[1][2] 0.008144 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016288 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015614 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 PRO 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 PRO 4 2 ? ? ? A . n A 1 5 GLY 5 3 ? ? ? A . n A 1 6 LYS 6 4 4 LYS LYS A . n A 1 7 SER 7 5 5 SER SER A . n A 1 8 VAL 8 6 6 VAL VAL A . n A 1 9 VAL 9 7 7 VAL VAL A . n A 1 10 ALA 10 8 8 ALA ALA A . n A 1 11 ARG 11 9 9 ARG ARG A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 ALA 13 11 11 ALA ALA A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 ALA 15 13 13 ALA ALA A . n A 1 16 TYR 16 14 14 TYR TYR A . n A 1 17 PRO 17 15 15 PRO PRO A . n A 1 18 GLU 18 16 16 GLU GLU A . n A 1 19 ASP 19 17 17 ASP ASP A . n A 1 20 VAL 20 18 18 VAL VAL A . n A 1 21 GLY 21 19 19 GLY GLY A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 ARG 23 21 21 ARG ARG A . n A 1 24 ILE 24 22 22 ILE ILE A . n A 1 25 VAL 25 23 23 VAL VAL A . n A 1 26 ARG 26 24 24 ARG ARG A . n A 1 27 MET 27 25 25 MET MET A . n A 1 28 ASP 28 26 26 ASP ASP A . n A 1 29 LYS 29 27 27 LYS LYS A . n A 1 30 TYR 30 28 28 TYR TYR A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 ARG 32 30 30 ARG ARG A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 LYS 34 32 32 LYS LYS A . n A 1 35 LEU 35 33 33 LEU LEU A . n A 1 36 GLY 36 34 34 GLY GLY A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 SER 38 36 36 SER SER A . n A 1 39 VAL 39 37 37 VAL VAL A . n A 1 40 GLY 40 38 38 GLY GLY A . n A 1 41 ASP 41 39 39 ASP ASP A . n A 1 42 TYR 42 40 40 TYR TYR A . n A 1 43 VAL 43 41 41 VAL VAL A . n A 1 44 GLU 44 42 42 GLU GLU A . n A 1 45 VAL 45 43 43 VAL VAL A . n A 1 46 LYS 46 44 44 LYS LYS A . n A 1 47 LYS 47 45 45 LYS LYS A . n A 1 48 VAL 48 46 46 VAL VAL A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 SER 50 48 48 SER SER A . n A 1 51 VAL 51 49 49 VAL VAL A . n A 1 52 VAL 52 50 50 VAL VAL A . n A 1 53 ALA 53 51 51 ALA ALA A . n A 1 54 ARG 54 52 52 ARG ARG A . n A 1 55 VAL 55 53 53 VAL VAL A . n A 1 56 ALA 56 54 54 ALA ALA A . n A 1 57 GLU 57 55 55 GLU GLU A . n A 1 58 ALA 58 56 56 ALA ALA A . n A 1 59 TYR 59 57 57 TYR TYR A . n A 1 60 PRO 60 58 58 PRO PRO A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 ASP 62 60 60 ASP ASP A . n A 1 63 VAL 63 61 61 VAL VAL A . n A 1 64 GLY 64 62 62 GLY GLY A . n A 1 65 LYS 65 63 63 LYS LYS A . n A 1 66 ARG 66 64 64 ARG ARG A . n A 1 67 ILE 67 65 65 ILE ILE A . n A 1 68 VAL 68 66 66 VAL VAL A . n A 1 69 ARG 69 67 67 ARG ARG A . n A 1 70 MET 70 68 68 MET MET A . n A 1 71 ASP 71 69 69 ASP ASP A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 TYR 73 71 71 TYR TYR A . n A 1 74 GLU 74 72 72 GLU GLU A . n A 1 75 ARG 75 73 73 ARG ARG A . n A 1 76 ALA 76 74 74 ALA ALA A . n A 1 77 LYS 77 75 75 LYS LYS A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 GLY 79 77 77 GLY GLY A . n A 1 80 VAL 80 78 78 VAL VAL A . n A 1 81 SER 81 79 79 SER SER A . n A 1 82 VAL 82 80 80 VAL VAL A . n A 1 83 GLY 83 81 81 GLY GLY A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 TYR 85 83 83 TYR TYR A . n A 1 86 VAL 86 84 84 VAL VAL A . n A 1 87 GLU 87 85 85 GLU GLU A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 LYS 89 87 87 LYS LYS A . n A 1 90 LYS 90 88 88 LYS LYS A . n A 1 91 VAL 91 89 89 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 82 HOH HOH A . B 2 HOH 2 102 65 HOH HOH A . B 2 HOH 3 103 79 HOH HOH A . B 2 HOH 4 104 61 HOH HOH A . B 2 HOH 5 105 25 HOH HOH A . B 2 HOH 6 106 35 HOH HOH A . B 2 HOH 7 107 45 HOH HOH A . B 2 HOH 8 108 30 HOH HOH A . B 2 HOH 9 109 71 HOH HOH A . B 2 HOH 10 110 75 HOH HOH A . B 2 HOH 11 111 8 HOH HOH A . B 2 HOH 12 112 22 HOH HOH A . B 2 HOH 13 113 7 HOH HOH A . B 2 HOH 14 114 24 HOH HOH A . B 2 HOH 15 115 6 HOH HOH A . B 2 HOH 16 116 1 HOH HOH A . B 2 HOH 17 117 5 HOH HOH A . B 2 HOH 18 118 38 HOH HOH A . B 2 HOH 19 119 49 HOH HOH A . B 2 HOH 20 120 17 HOH HOH A . B 2 HOH 21 121 27 HOH HOH A . B 2 HOH 22 122 2 HOH HOH A . B 2 HOH 23 123 26 HOH HOH A . B 2 HOH 24 124 9 HOH HOH A . B 2 HOH 25 125 4 HOH HOH A . B 2 HOH 26 126 81 HOH HOH A . B 2 HOH 27 127 39 HOH HOH A . B 2 HOH 28 128 14 HOH HOH A . B 2 HOH 29 129 52 HOH HOH A . B 2 HOH 30 130 28 HOH HOH A . B 2 HOH 31 131 36 HOH HOH A . B 2 HOH 32 132 12 HOH HOH A . B 2 HOH 33 133 57 HOH HOH A . B 2 HOH 34 134 19 HOH HOH A . B 2 HOH 35 135 41 HOH HOH A . B 2 HOH 36 136 37 HOH HOH A . B 2 HOH 37 137 78 HOH HOH A . B 2 HOH 38 138 51 HOH HOH A . B 2 HOH 39 139 10 HOH HOH A . B 2 HOH 40 140 16 HOH HOH A . B 2 HOH 41 141 18 HOH HOH A . B 2 HOH 42 142 59 HOH HOH A . B 2 HOH 43 143 23 HOH HOH A . B 2 HOH 44 144 29 HOH HOH A . B 2 HOH 45 145 15 HOH HOH A . B 2 HOH 46 146 60 HOH HOH A . B 2 HOH 47 147 3 HOH HOH A . B 2 HOH 48 148 64 HOH HOH A . B 2 HOH 49 149 47 HOH HOH A . B 2 HOH 50 150 21 HOH HOH A . B 2 HOH 51 151 74 HOH HOH A . B 2 HOH 52 152 20 HOH HOH A . B 2 HOH 53 153 53 HOH HOH A . B 2 HOH 54 154 50 HOH HOH A . B 2 HOH 55 155 32 HOH HOH A . B 2 HOH 56 156 55 HOH HOH A . B 2 HOH 57 157 33 HOH HOH A . B 2 HOH 58 158 56 HOH HOH A . B 2 HOH 59 159 63 HOH HOH A . B 2 HOH 60 160 13 HOH HOH A . B 2 HOH 61 161 84 HOH HOH A . B 2 HOH 62 162 73 HOH HOH A . B 2 HOH 63 163 43 HOH HOH A . B 2 HOH 64 164 54 HOH HOH A . B 2 HOH 65 165 69 HOH HOH A . B 2 HOH 66 166 80 HOH HOH A . B 2 HOH 67 167 77 HOH HOH A . B 2 HOH 68 168 46 HOH HOH A . B 2 HOH 69 169 62 HOH HOH A . B 2 HOH 70 170 48 HOH HOH A . B 2 HOH 71 171 31 HOH HOH A . B 2 HOH 72 172 58 HOH HOH A . B 2 HOH 73 173 66 HOH HOH A . B 2 HOH 74 174 40 HOH HOH A . B 2 HOH 75 175 72 HOH HOH A . B 2 HOH 76 176 42 HOH HOH A . B 2 HOH 77 177 11 HOH HOH A . B 2 HOH 78 178 76 HOH HOH A . B 2 HOH 79 179 83 HOH HOH A . B 2 HOH 80 180 34 HOH HOH A . B 2 HOH 81 181 68 HOH HOH A . B 2 HOH 82 182 67 HOH HOH A . B 2 HOH 83 183 44 HOH HOH A . B 2 HOH 84 184 70 HOH HOH A . B 2 HOH 85 185 85 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4970 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 116 ? B HOH . 2 1 A HOH 184 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-29 2 'Structure model' 1 1 2021-11-17 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_ASTM' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 110 ? ? O A HOH 151 ? ? 1.12 2 1 NZ A LYS 75 ? ? O A HOH 101 ? ? 1.61 3 1 O A HOH 162 ? ? O A HOH 167 ? ? 1.92 4 1 O A HOH 157 ? ? O A HOH 181 ? ? 1.98 5 1 O A HOH 158 ? ? O A HOH 164 ? ? 2.04 6 1 NZ A LYS 70 ? ? O A HOH 102 ? ? 2.05 7 1 OD1 A ASP 82 ? ? O A HOH 103 ? ? 2.08 8 1 OE2 A GLU 59 ? ? O A HOH 104 ? ? 2.12 9 1 OE2 A GLU 16 ? ? O A HOH 105 ? ? 2.13 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 135 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 174 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_555 _pdbx_validate_symm_contact.dist 2.15 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 45 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -115.99 _pdbx_validate_torsion.psi -80.19 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A PRO 0 ? A PRO 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A PRO 2 ? A PRO 4 5 1 Y 1 A GLY 3 ? A GLY 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLU N N N N 57 GLU CA C N S 58 GLU C C N N 59 GLU O O N N 60 GLU CB C N N 61 GLU CG C N N 62 GLU CD C N N 63 GLU OE1 O N N 64 GLU OE2 O N N 65 GLU OXT O N N 66 GLU H H N N 67 GLU H2 H N N 68 GLU HA H N N 69 GLU HB2 H N N 70 GLU HB3 H N N 71 GLU HG2 H N N 72 GLU HG3 H N N 73 GLU HE2 H N N 74 GLU HXT H N N 75 GLY N N N N 76 GLY CA C N N 77 GLY C C N N 78 GLY O O N N 79 GLY OXT O N N 80 GLY H H N N 81 GLY H2 H N N 82 GLY HA2 H N N 83 GLY HA3 H N N 84 GLY HXT H N N 85 HOH O O N N 86 HOH H1 H N N 87 HOH H2 H N N 88 ILE N N N N 89 ILE CA C N S 90 ILE C C N N 91 ILE O O N N 92 ILE CB C N S 93 ILE CG1 C N N 94 ILE CG2 C N N 95 ILE CD1 C N N 96 ILE OXT O N N 97 ILE H H N N 98 ILE H2 H N N 99 ILE HA H N N 100 ILE HB H N N 101 ILE HG12 H N N 102 ILE HG13 H N N 103 ILE HG21 H N N 104 ILE HG22 H N N 105 ILE HG23 H N N 106 ILE HD11 H N N 107 ILE HD12 H N N 108 ILE HD13 H N N 109 ILE HXT H N N 110 LEU N N N N 111 LEU CA C N S 112 LEU C C N N 113 LEU O O N N 114 LEU CB C N N 115 LEU CG C N N 116 LEU CD1 C N N 117 LEU CD2 C N N 118 LEU OXT O N N 119 LEU H H N N 120 LEU H2 H N N 121 LEU HA H N N 122 LEU HB2 H N N 123 LEU HB3 H N N 124 LEU HG H N N 125 LEU HD11 H N N 126 LEU HD12 H N N 127 LEU HD13 H N N 128 LEU HD21 H N N 129 LEU HD22 H N N 130 LEU HD23 H N N 131 LEU HXT H N N 132 LYS N N N N 133 LYS CA C N S 134 LYS C C N N 135 LYS O O N N 136 LYS CB C N N 137 LYS CG C N N 138 LYS CD C N N 139 LYS CE C N N 140 LYS NZ N N N 141 LYS OXT O N N 142 LYS H H N N 143 LYS H2 H N N 144 LYS HA H N N 145 LYS HB2 H N N 146 LYS HB3 H N N 147 LYS HG2 H N N 148 LYS HG3 H N N 149 LYS HD2 H N N 150 LYS HD3 H N N 151 LYS HE2 H N N 152 LYS HE3 H N N 153 LYS HZ1 H N N 154 LYS HZ2 H N N 155 LYS HZ3 H N N 156 LYS HXT H N N 157 MET N N N N 158 MET CA C N S 159 MET C C N N 160 MET O O N N 161 MET CB C N N 162 MET CG C N N 163 MET SD S N N 164 MET CE C N N 165 MET OXT O N N 166 MET H H N N 167 MET H2 H N N 168 MET HA H N N 169 MET HB2 H N N 170 MET HB3 H N N 171 MET HG2 H N N 172 MET HG3 H N N 173 MET HE1 H N N 174 MET HE2 H N N 175 MET HE3 H N N 176 MET HXT H N N 177 PRO N N N N 178 PRO CA C N S 179 PRO C C N N 180 PRO O O N N 181 PRO CB C N N 182 PRO CG C N N 183 PRO CD C N N 184 PRO OXT O N N 185 PRO H H N N 186 PRO HA H N N 187 PRO HB2 H N N 188 PRO HB3 H N N 189 PRO HG2 H N N 190 PRO HG3 H N N 191 PRO HD2 H N N 192 PRO HD3 H N N 193 PRO HXT H N N 194 SER N N N N 195 SER CA C N S 196 SER C C N N 197 SER O O N N 198 SER CB C N N 199 SER OG O N N 200 SER OXT O N N 201 SER H H N N 202 SER H2 H N N 203 SER HA H N N 204 SER HB2 H N N 205 SER HB3 H N N 206 SER HG H N N 207 SER HXT H N N 208 TYR N N N N 209 TYR CA C N S 210 TYR C C N N 211 TYR O O N N 212 TYR CB C N N 213 TYR CG C Y N 214 TYR CD1 C Y N 215 TYR CD2 C Y N 216 TYR CE1 C Y N 217 TYR CE2 C Y N 218 TYR CZ C Y N 219 TYR OH O N N 220 TYR OXT O N N 221 TYR H H N N 222 TYR H2 H N N 223 TYR HA H N N 224 TYR HB2 H N N 225 TYR HB3 H N N 226 TYR HD1 H N N 227 TYR HD2 H N N 228 TYR HE1 H N N 229 TYR HE2 H N N 230 TYR HH H N N 231 TYR HXT H N N 232 VAL N N N N 233 VAL CA C N S 234 VAL C C N N 235 VAL O O N N 236 VAL CB C N N 237 VAL CG1 C N N 238 VAL CG2 C N N 239 VAL OXT O N N 240 VAL H H N N 241 VAL H2 H N N 242 VAL HA H N N 243 VAL HB H N N 244 VAL HG11 H N N 245 VAL HG12 H N N 246 VAL HG13 H N N 247 VAL HG21 H N N 248 VAL HG22 H N N 249 VAL HG23 H N N 250 VAL HXT H N N 251 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLU N CA sing N N 54 GLU N H sing N N 55 GLU N H2 sing N N 56 GLU CA C sing N N 57 GLU CA CB sing N N 58 GLU CA HA sing N N 59 GLU C O doub N N 60 GLU C OXT sing N N 61 GLU CB CG sing N N 62 GLU CB HB2 sing N N 63 GLU CB HB3 sing N N 64 GLU CG CD sing N N 65 GLU CG HG2 sing N N 66 GLU CG HG3 sing N N 67 GLU CD OE1 doub N N 68 GLU CD OE2 sing N N 69 GLU OE2 HE2 sing N N 70 GLU OXT HXT sing N N 71 GLY N CA sing N N 72 GLY N H sing N N 73 GLY N H2 sing N N 74 GLY CA C sing N N 75 GLY CA HA2 sing N N 76 GLY CA HA3 sing N N 77 GLY C O doub N N 78 GLY C OXT sing N N 79 GLY OXT HXT sing N N 80 HOH O H1 sing N N 81 HOH O H2 sing N N 82 ILE N CA sing N N 83 ILE N H sing N N 84 ILE N H2 sing N N 85 ILE CA C sing N N 86 ILE CA CB sing N N 87 ILE CA HA sing N N 88 ILE C O doub N N 89 ILE C OXT sing N N 90 ILE CB CG1 sing N N 91 ILE CB CG2 sing N N 92 ILE CB HB sing N N 93 ILE CG1 CD1 sing N N 94 ILE CG1 HG12 sing N N 95 ILE CG1 HG13 sing N N 96 ILE CG2 HG21 sing N N 97 ILE CG2 HG22 sing N N 98 ILE CG2 HG23 sing N N 99 ILE CD1 HD11 sing N N 100 ILE CD1 HD12 sing N N 101 ILE CD1 HD13 sing N N 102 ILE OXT HXT sing N N 103 LEU N CA sing N N 104 LEU N H sing N N 105 LEU N H2 sing N N 106 LEU CA C sing N N 107 LEU CA CB sing N N 108 LEU CA HA sing N N 109 LEU C O doub N N 110 LEU C OXT sing N N 111 LEU CB CG sing N N 112 LEU CB HB2 sing N N 113 LEU CB HB3 sing N N 114 LEU CG CD1 sing N N 115 LEU CG CD2 sing N N 116 LEU CG HG sing N N 117 LEU CD1 HD11 sing N N 118 LEU CD1 HD12 sing N N 119 LEU CD1 HD13 sing N N 120 LEU CD2 HD21 sing N N 121 LEU CD2 HD22 sing N N 122 LEU CD2 HD23 sing N N 123 LEU OXT HXT sing N N 124 LYS N CA sing N N 125 LYS N H sing N N 126 LYS N H2 sing N N 127 LYS CA C sing N N 128 LYS CA CB sing N N 129 LYS CA HA sing N N 130 LYS C O doub N N 131 LYS C OXT sing N N 132 LYS CB CG sing N N 133 LYS CB HB2 sing N N 134 LYS CB HB3 sing N N 135 LYS CG CD sing N N 136 LYS CG HG2 sing N N 137 LYS CG HG3 sing N N 138 LYS CD CE sing N N 139 LYS CD HD2 sing N N 140 LYS CD HD3 sing N N 141 LYS CE NZ sing N N 142 LYS CE HE2 sing N N 143 LYS CE HE3 sing N N 144 LYS NZ HZ1 sing N N 145 LYS NZ HZ2 sing N N 146 LYS NZ HZ3 sing N N 147 LYS OXT HXT sing N N 148 MET N CA sing N N 149 MET N H sing N N 150 MET N H2 sing N N 151 MET CA C sing N N 152 MET CA CB sing N N 153 MET CA HA sing N N 154 MET C O doub N N 155 MET C OXT sing N N 156 MET CB CG sing N N 157 MET CB HB2 sing N N 158 MET CB HB3 sing N N 159 MET CG SD sing N N 160 MET CG HG2 sing N N 161 MET CG HG3 sing N N 162 MET SD CE sing N N 163 MET CE HE1 sing N N 164 MET CE HE2 sing N N 165 MET CE HE3 sing N N 166 MET OXT HXT sing N N 167 PRO N CA sing N N 168 PRO N CD sing N N 169 PRO N H sing N N 170 PRO CA C sing N N 171 PRO CA CB sing N N 172 PRO CA HA sing N N 173 PRO C O doub N N 174 PRO C OXT sing N N 175 PRO CB CG sing N N 176 PRO CB HB2 sing N N 177 PRO CB HB3 sing N N 178 PRO CG CD sing N N 179 PRO CG HG2 sing N N 180 PRO CG HG3 sing N N 181 PRO CD HD2 sing N N 182 PRO CD HD3 sing N N 183 PRO OXT HXT sing N N 184 SER N CA sing N N 185 SER N H sing N N 186 SER N H2 sing N N 187 SER CA C sing N N 188 SER CA CB sing N N 189 SER CA HA sing N N 190 SER C O doub N N 191 SER C OXT sing N N 192 SER CB OG sing N N 193 SER CB HB2 sing N N 194 SER CB HB3 sing N N 195 SER OG HG sing N N 196 SER OXT HXT sing N N 197 TYR N CA sing N N 198 TYR N H sing N N 199 TYR N H2 sing N N 200 TYR CA C sing N N 201 TYR CA CB sing N N 202 TYR CA HA sing N N 203 TYR C O doub N N 204 TYR C OXT sing N N 205 TYR CB CG sing N N 206 TYR CB HB2 sing N N 207 TYR CB HB3 sing N N 208 TYR CG CD1 doub Y N 209 TYR CG CD2 sing Y N 210 TYR CD1 CE1 sing Y N 211 TYR CD1 HD1 sing N N 212 TYR CD2 CE2 doub Y N 213 TYR CD2 HD2 sing N N 214 TYR CE1 CZ doub Y N 215 TYR CE1 HE1 sing N N 216 TYR CE2 CZ sing Y N 217 TYR CE2 HE2 sing N N 218 TYR CZ OH sing N N 219 TYR OH HH sing N N 220 TYR OXT HXT sing N N 221 VAL N CA sing N N 222 VAL N H sing N N 223 VAL N H2 sing N N 224 VAL CA C sing N N 225 VAL CA CB sing N N 226 VAL CA HA sing N N 227 VAL C O doub N N 228 VAL C OXT sing N N 229 VAL CB CG1 sing N N 230 VAL CB CG2 sing N N 231 VAL CB HB sing N N 232 VAL CG1 HG11 sing N N 233 VAL CG1 HG12 sing N N 234 VAL CG1 HG13 sing N N 235 VAL CG2 HG21 sing N N 236 VAL CG2 HG22 sing N N 237 VAL CG2 HG23 sing N N 238 VAL OXT HXT sing N N 239 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 18H01328 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7DG7 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #