data_7DVS # _entry.id 7DVS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DVS pdb_00007dvs 10.2210/pdb7dvs/pdb WWPDB D_1300020278 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DVS _pdbx_database_status.recvd_initial_deposition_date 2021-01-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Muraki, N.' 1 0000-0003-4112-2955 'Aono, S.' 2 0000-0002-2870-3694 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Commun Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2399-3642 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 467 _citation.page_last 467 _citation.title 'Heme controls the structural rearrangement of its sensor protein mediating the hemolytic bacterial survival.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s42003-021-01987-5 _citation.pdbx_database_id_PubMed 33850260 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nishinaga, M.' 1 ? primary 'Sugimoto, H.' 2 0000-0002-3140-8362 primary 'Nishitani, Y.' 3 0000-0002-0818-1999 primary 'Nagai, S.' 4 ? primary 'Nagatoishi, S.' 5 0000-0002-0794-3963 primary 'Muraki, N.' 6 ? primary 'Tosha, T.' 7 0000-0002-8971-0759 primary 'Tsumoto, K.' 8 ? primary 'Aono, S.' 9 0000-0002-2870-3694 primary 'Shiro, Y.' 10 0000-0003-0695-8327 primary 'Sawai, H.' 11 0000-0002-0714-8337 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 92.810 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7DVS _cell.details ? _cell.formula_units_Z ? _cell.length_a 122.980 _cell.length_a_esd ? _cell.length_b 46.020 _cell.length_b_esd ? _cell.length_c 135.220 _cell.length_c_esd ? _cell.volume 764362.766 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DVS _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MarR family transcriptional regulator' _entity.formula_weight 18809.873 _entity.pdbx_number_of_molecules 4 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Transcriptional regulator,MarR family' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHSSGLVPRGSHMENPLQKARILVNQLEKYLDRYAKEYDVEHLAGPQGHLVMHLYKHPDKDMSIKDAEEILHISKS VASNLVKRMEKNGFIAIVPSKTDKRVKYLYLTHLGKQKATQFEIFLEKLHSTMLAGITKEEIRTTKKVIRTLAKNMAMED FD ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHSSGLVPRGSHMENPLQKARILVNQLEKYLDRYAKEYDVEHLAGPQGHLVMHLYKHPDKDMSIKDAEEILHISKS VASNLVKRMEKNGFIAIVPSKTDKRVKYLYLTHLGKQKATQFEIFLEKLHSTMLAGITKEEIRTTKKVIRTLAKNMAMED FD ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 SER n 1 8 SER n 1 9 GLY n 1 10 LEU n 1 11 VAL n 1 12 PRO n 1 13 ARG n 1 14 GLY n 1 15 SER n 1 16 HIS n 1 17 MET n 1 18 GLU n 1 19 ASN n 1 20 PRO n 1 21 LEU n 1 22 GLN n 1 23 LYS n 1 24 ALA n 1 25 ARG n 1 26 ILE n 1 27 LEU n 1 28 VAL n 1 29 ASN n 1 30 GLN n 1 31 LEU n 1 32 GLU n 1 33 LYS n 1 34 TYR n 1 35 LEU n 1 36 ASP n 1 37 ARG n 1 38 TYR n 1 39 ALA n 1 40 LYS n 1 41 GLU n 1 42 TYR n 1 43 ASP n 1 44 VAL n 1 45 GLU n 1 46 HIS n 1 47 LEU n 1 48 ALA n 1 49 GLY n 1 50 PRO n 1 51 GLN n 1 52 GLY n 1 53 HIS n 1 54 LEU n 1 55 VAL n 1 56 MET n 1 57 HIS n 1 58 LEU n 1 59 TYR n 1 60 LYS n 1 61 HIS n 1 62 PRO n 1 63 ASP n 1 64 LYS n 1 65 ASP n 1 66 MET n 1 67 SER n 1 68 ILE n 1 69 LYS n 1 70 ASP n 1 71 ALA n 1 72 GLU n 1 73 GLU n 1 74 ILE n 1 75 LEU n 1 76 HIS n 1 77 ILE n 1 78 SER n 1 79 LYS n 1 80 SER n 1 81 VAL n 1 82 ALA n 1 83 SER n 1 84 ASN n 1 85 LEU n 1 86 VAL n 1 87 LYS n 1 88 ARG n 1 89 MET n 1 90 GLU n 1 91 LYS n 1 92 ASN n 1 93 GLY n 1 94 PHE n 1 95 ILE n 1 96 ALA n 1 97 ILE n 1 98 VAL n 1 99 PRO n 1 100 SER n 1 101 LYS n 1 102 THR n 1 103 ASP n 1 104 LYS n 1 105 ARG n 1 106 VAL n 1 107 LYS n 1 108 TYR n 1 109 LEU n 1 110 TYR n 1 111 LEU n 1 112 THR n 1 113 HIS n 1 114 LEU n 1 115 GLY n 1 116 LYS n 1 117 GLN n 1 118 LYS n 1 119 ALA n 1 120 THR n 1 121 GLN n 1 122 PHE n 1 123 GLU n 1 124 ILE n 1 125 PHE n 1 126 LEU n 1 127 GLU n 1 128 LYS n 1 129 LEU n 1 130 HIS n 1 131 SER n 1 132 THR n 1 133 MET n 1 134 LEU n 1 135 ALA n 1 136 GLY n 1 137 ILE n 1 138 THR n 1 139 LYS n 1 140 GLU n 1 141 GLU n 1 142 ILE n 1 143 ARG n 1 144 THR n 1 145 THR n 1 146 LYS n 1 147 LYS n 1 148 VAL n 1 149 ILE n 1 150 ARG n 1 151 THR n 1 152 LEU n 1 153 ALA n 1 154 LYS n 1 155 ASN n 1 156 MET n 1 157 ALA n 1 158 MET n 1 159 GLU n 1 160 ASP n 1 161 PHE n 1 162 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 162 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AX245_08385, C6N10_09725, DX05_07110, E8E04_04745, F5043_04730, GD434_04460, NCTC6175_00806, RDF_1281' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus agalactiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1311 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET15b _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R4Z9I5_STRAG _struct_ref.pdbx_db_accession R4Z9I5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MENPLQKARILVNQLEKYLDRYAKEYDVEHLAGPQGHLVMHLYKHPDKDMSIKDAEEILHISKSVASNLVKRMEKNGFIA IVPSKTDKRVKYLYLTHLGKQKATQFEIFLEKLHSTMLAGITKEEIRTTKKVIRTLAKNMAMEDFD ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7DVS A 17 ? 162 ? R4Z9I5 1 ? 146 ? 1 146 2 1 7DVS B 17 ? 162 ? R4Z9I5 1 ? 146 ? 1 146 3 1 7DVS C 17 ? 162 ? R4Z9I5 1 ? 146 ? 1 146 4 1 7DVS D 17 ? 162 ? R4Z9I5 1 ? 146 ? 1 146 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7DVS HIS A 1 ? UNP R4Z9I5 ? ? 'expression tag' -15 1 1 7DVS HIS A 2 ? UNP R4Z9I5 ? ? 'expression tag' -14 2 1 7DVS HIS A 3 ? UNP R4Z9I5 ? ? 'expression tag' -13 3 1 7DVS HIS A 4 ? UNP R4Z9I5 ? ? 'expression tag' -12 4 1 7DVS HIS A 5 ? UNP R4Z9I5 ? ? 'expression tag' -11 5 1 7DVS HIS A 6 ? UNP R4Z9I5 ? ? 'expression tag' -10 6 1 7DVS SER A 7 ? UNP R4Z9I5 ? ? 'expression tag' -9 7 1 7DVS SER A 8 ? UNP R4Z9I5 ? ? 'expression tag' -8 8 1 7DVS GLY A 9 ? UNP R4Z9I5 ? ? 'expression tag' -7 9 1 7DVS LEU A 10 ? UNP R4Z9I5 ? ? 'expression tag' -6 10 1 7DVS VAL A 11 ? UNP R4Z9I5 ? ? 'expression tag' -5 11 1 7DVS PRO A 12 ? UNP R4Z9I5 ? ? 'expression tag' -4 12 1 7DVS ARG A 13 ? UNP R4Z9I5 ? ? 'expression tag' -3 13 1 7DVS GLY A 14 ? UNP R4Z9I5 ? ? 'expression tag' -2 14 1 7DVS SER A 15 ? UNP R4Z9I5 ? ? 'expression tag' -1 15 1 7DVS HIS A 16 ? UNP R4Z9I5 ? ? 'expression tag' 0 16 2 7DVS HIS B 1 ? UNP R4Z9I5 ? ? 'expression tag' -15 17 2 7DVS HIS B 2 ? UNP R4Z9I5 ? ? 'expression tag' -14 18 2 7DVS HIS B 3 ? UNP R4Z9I5 ? ? 'expression tag' -13 19 2 7DVS HIS B 4 ? UNP R4Z9I5 ? ? 'expression tag' -12 20 2 7DVS HIS B 5 ? UNP R4Z9I5 ? ? 'expression tag' -11 21 2 7DVS HIS B 6 ? UNP R4Z9I5 ? ? 'expression tag' -10 22 2 7DVS SER B 7 ? UNP R4Z9I5 ? ? 'expression tag' -9 23 2 7DVS SER B 8 ? UNP R4Z9I5 ? ? 'expression tag' -8 24 2 7DVS GLY B 9 ? UNP R4Z9I5 ? ? 'expression tag' -7 25 2 7DVS LEU B 10 ? UNP R4Z9I5 ? ? 'expression tag' -6 26 2 7DVS VAL B 11 ? UNP R4Z9I5 ? ? 'expression tag' -5 27 2 7DVS PRO B 12 ? UNP R4Z9I5 ? ? 'expression tag' -4 28 2 7DVS ARG B 13 ? UNP R4Z9I5 ? ? 'expression tag' -3 29 2 7DVS GLY B 14 ? UNP R4Z9I5 ? ? 'expression tag' -2 30 2 7DVS SER B 15 ? UNP R4Z9I5 ? ? 'expression tag' -1 31 2 7DVS HIS B 16 ? UNP R4Z9I5 ? ? 'expression tag' 0 32 3 7DVS HIS C 1 ? UNP R4Z9I5 ? ? 'expression tag' -15 33 3 7DVS HIS C 2 ? UNP R4Z9I5 ? ? 'expression tag' -14 34 3 7DVS HIS C 3 ? UNP R4Z9I5 ? ? 'expression tag' -13 35 3 7DVS HIS C 4 ? UNP R4Z9I5 ? ? 'expression tag' -12 36 3 7DVS HIS C 5 ? UNP R4Z9I5 ? ? 'expression tag' -11 37 3 7DVS HIS C 6 ? UNP R4Z9I5 ? ? 'expression tag' -10 38 3 7DVS SER C 7 ? UNP R4Z9I5 ? ? 'expression tag' -9 39 3 7DVS SER C 8 ? UNP R4Z9I5 ? ? 'expression tag' -8 40 3 7DVS GLY C 9 ? UNP R4Z9I5 ? ? 'expression tag' -7 41 3 7DVS LEU C 10 ? UNP R4Z9I5 ? ? 'expression tag' -6 42 3 7DVS VAL C 11 ? UNP R4Z9I5 ? ? 'expression tag' -5 43 3 7DVS PRO C 12 ? UNP R4Z9I5 ? ? 'expression tag' -4 44 3 7DVS ARG C 13 ? UNP R4Z9I5 ? ? 'expression tag' -3 45 3 7DVS GLY C 14 ? UNP R4Z9I5 ? ? 'expression tag' -2 46 3 7DVS SER C 15 ? UNP R4Z9I5 ? ? 'expression tag' -1 47 3 7DVS HIS C 16 ? UNP R4Z9I5 ? ? 'expression tag' 0 48 4 7DVS HIS D 1 ? UNP R4Z9I5 ? ? 'expression tag' -15 49 4 7DVS HIS D 2 ? UNP R4Z9I5 ? ? 'expression tag' -14 50 4 7DVS HIS D 3 ? UNP R4Z9I5 ? ? 'expression tag' -13 51 4 7DVS HIS D 4 ? UNP R4Z9I5 ? ? 'expression tag' -12 52 4 7DVS HIS D 5 ? UNP R4Z9I5 ? ? 'expression tag' -11 53 4 7DVS HIS D 6 ? UNP R4Z9I5 ? ? 'expression tag' -10 54 4 7DVS SER D 7 ? UNP R4Z9I5 ? ? 'expression tag' -9 55 4 7DVS SER D 8 ? UNP R4Z9I5 ? ? 'expression tag' -8 56 4 7DVS GLY D 9 ? UNP R4Z9I5 ? ? 'expression tag' -7 57 4 7DVS LEU D 10 ? UNP R4Z9I5 ? ? 'expression tag' -6 58 4 7DVS VAL D 11 ? UNP R4Z9I5 ? ? 'expression tag' -5 59 4 7DVS PRO D 12 ? UNP R4Z9I5 ? ? 'expression tag' -4 60 4 7DVS ARG D 13 ? UNP R4Z9I5 ? ? 'expression tag' -3 61 4 7DVS GLY D 14 ? UNP R4Z9I5 ? ? 'expression tag' -2 62 4 7DVS SER D 15 ? UNP R4Z9I5 ? ? 'expression tag' -1 63 4 7DVS HIS D 16 ? UNP R4Z9I5 ? ? 'expression tag' 0 64 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DVS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '24% (w/v) polyethylene glycol 4000, 0.2 M magnesium chloride, 0.1 M sodium acetate (pH4.6), 16% (v/v) 1,3-butanediol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-04-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 78.93 _reflns.entry_id 7DVS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23177 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.7 _reflns.pdbx_Rmerge_I_obs 0.038 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.044 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.67 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1674 _reflns_shell.percent_possible_all 97.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.653 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.759 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.836 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 107.13 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DVS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 46.59 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23158 _refine.ls_number_reflns_R_free 1157 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.53 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2390 _refine.ls_R_factor_R_free 0.2877 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2363 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6LW6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.4974 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3696 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 46.59 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3704 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3704 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0071 ? 3767 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8853 ? 5119 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0496 ? 620 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0067 ? 647 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.2943 ? 2275 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.60 2.72 . . 144 2734 97.39 . . . 0.3568 . 0.2949 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.72 2.86 . . 145 2750 99.11 . . . 0.4162 . 0.2825 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.86 3.04 . . 144 2738 99.11 . . . 0.3130 . 0.2768 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.04 3.28 . . 148 2818 99.36 . . . 0.4290 . 0.2850 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.28 3.60 . . 145 2756 99.38 . . . 0.2993 . 0.2542 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.60 4.13 . . 146 2810 99.36 . . . 0.2543 . 0.2073 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.13 5.20 . . 149 2828 99.50 . . . 0.2297 . 0.2049 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.20 46.59 . . 136 2567 87.50 . . . 0.3025 . 0.2467 . . . . . . . . . . . # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A ASN 19 . A MET 156 . A ASN 3 A MET 140 ? ;(chain 'A' and (resid 3 through 16 or (resid 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 29 or (resid 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 56 or (resid 57 and (name N or name CA or name C or name O or name CB )) or resid 58 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 140)) ; 1 2 1 B ASN 19 . B MET 156 . B ASN 3 B MET 140 ? ;(chain 'B' and (resid 3 through 47 or (resid 48 and (name N or name CA or name C or name O or name CB )) or resid 49 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 84 or (resid 85 and (name N or name CA or name C or name O or name CB )) or resid 86 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 101 and (name N or name CA or name C or name O or name CB )) or resid 102 through 111 or (resid 112 and (name N or name CA or name C or name O or name CB )) or resid 113 through 130 or (resid 131 and (name N or name CA or name C or name O or name CB )) or resid 132 through 140)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7DVS _struct.title 'Crystal structure of Apo (heme-free) PefR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DVS _struct_keywords.text 'Heme, transcription regulator, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 19 ? ASP A 43 ? ASN A 3 ASP A 27 1 ? 25 HELX_P HELX_P2 AA2 VAL A 44 ? ALA A 48 ? VAL A 28 ALA A 32 5 ? 5 HELX_P HELX_P3 AA3 GLY A 49 ? HIS A 61 ? GLY A 33 HIS A 45 1 ? 13 HELX_P HELX_P4 AA4 ILE A 68 ? HIS A 76 ? ILE A 52 HIS A 60 1 ? 9 HELX_P HELX_P5 AA5 SER A 78 ? ASN A 92 ? SER A 62 ASN A 76 1 ? 15 HELX_P HELX_P6 AA6 THR A 112 ? THR A 132 ? THR A 96 THR A 116 1 ? 21 HELX_P HELX_P7 AA7 THR A 138 ? MET A 156 ? THR A 122 MET A 140 1 ? 19 HELX_P HELX_P8 AA8 PRO B 20 ? TYR B 42 ? PRO B 4 TYR B 26 1 ? 23 HELX_P HELX_P9 AA9 GLY B 49 ? HIS B 61 ? GLY B 33 HIS B 45 1 ? 13 HELX_P HELX_P10 AB1 ILE B 68 ? HIS B 76 ? ILE B 52 HIS B 60 1 ? 9 HELX_P HELX_P11 AB2 SER B 78 ? ASN B 92 ? SER B 62 ASN B 76 1 ? 15 HELX_P HELX_P12 AB3 THR B 112 ? MET B 133 ? THR B 96 MET B 117 1 ? 22 HELX_P HELX_P13 AB4 THR B 138 ? MET B 156 ? THR B 122 MET B 140 1 ? 19 HELX_P HELX_P14 AB5 PRO C 20 ? TYR C 42 ? PRO C 4 TYR C 26 1 ? 23 HELX_P HELX_P15 AB6 GLY C 49 ? HIS C 61 ? GLY C 33 HIS C 45 1 ? 13 HELX_P HELX_P16 AB7 ILE C 68 ? LEU C 75 ? ILE C 52 LEU C 59 1 ? 8 HELX_P HELX_P17 AB8 SER C 78 ? GLY C 93 ? SER C 62 GLY C 77 1 ? 16 HELX_P HELX_P18 AB9 THR C 112 ? THR C 132 ? THR C 96 THR C 116 1 ? 21 HELX_P HELX_P19 AC1 LEU D 21 ? ALA D 39 ? LEU D 5 ALA D 23 1 ? 19 HELX_P HELX_P20 AC2 GLY D 49 ? TYR D 59 ? GLY D 33 TYR D 43 1 ? 11 HELX_P HELX_P21 AC3 SER D 67 ? HIS D 76 ? SER D 51 HIS D 60 1 ? 10 HELX_P HELX_P22 AC4 LYS D 79 ? GLY D 93 ? LYS D 63 GLY D 77 1 ? 15 HELX_P HELX_P23 AC5 THR D 144 ? ALA D 157 ? THR D 128 ALA D 141 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 66 ? SER A 67 ? MET A 50 SER A 51 AA1 2 LYS A 107 ? LEU A 111 ? LYS A 91 LEU A 95 AA1 3 ILE A 95 ? PRO A 99 ? ILE A 79 PRO A 83 AA2 1 MET B 66 ? SER B 67 ? MET B 50 SER B 51 AA2 2 LYS B 107 ? LEU B 111 ? LYS B 91 LEU B 95 AA2 3 ILE B 95 ? PRO B 99 ? ILE B 79 PRO B 83 AA3 1 MET C 66 ? SER C 67 ? MET C 50 SER C 51 AA3 2 LYS C 107 ? LEU C 111 ? LYS C 91 LEU C 95 AA3 3 ILE C 95 ? PRO C 99 ? ILE C 79 PRO C 83 AA4 1 ILE D 95 ? PRO D 99 ? ILE D 79 PRO D 83 AA4 2 LYS D 107 ? LEU D 111 ? LYS D 91 LEU D 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 66 ? N MET A 50 O LEU A 109 ? O LEU A 93 AA1 2 3 O TYR A 108 ? O TYR A 92 N VAL A 98 ? N VAL A 82 AA2 1 2 N MET B 66 ? N MET B 50 O LEU B 109 ? O LEU B 93 AA2 2 3 O TYR B 110 ? O TYR B 94 N ALA B 96 ? N ALA B 80 AA3 1 2 N MET C 66 ? N MET C 50 O LEU C 109 ? O LEU C 93 AA3 2 3 O TYR C 108 ? O TYR C 92 N VAL C 98 ? N VAL C 82 AA4 1 2 N VAL D 98 ? N VAL D 82 O TYR D 108 ? O TYR D 92 # _atom_sites.entry_id 7DVS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008131 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000399 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021730 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007404 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -15 ? ? ? A . n A 1 2 HIS 2 -14 ? ? ? A . n A 1 3 HIS 3 -13 ? ? ? A . n A 1 4 HIS 4 -12 ? ? ? A . n A 1 5 HIS 5 -11 ? ? ? A . n A 1 6 HIS 6 -10 ? ? ? A . n A 1 7 SER 7 -9 ? ? ? A . n A 1 8 SER 8 -8 ? ? ? A . n A 1 9 GLY 9 -7 ? ? ? A . n A 1 10 LEU 10 -6 ? ? ? A . n A 1 11 VAL 11 -5 ? ? ? A . n A 1 12 PRO 12 -4 ? ? ? A . n A 1 13 ARG 13 -3 ? ? ? A . n A 1 14 GLY 14 -2 ? ? ? A . n A 1 15 SER 15 -1 ? ? ? A . n A 1 16 HIS 16 0 ? ? ? A . n A 1 17 MET 17 1 ? ? ? A . n A 1 18 GLU 18 2 ? ? ? A . n A 1 19 ASN 19 3 3 ASN ASN A . n A 1 20 PRO 20 4 4 PRO PRO A . n A 1 21 LEU 21 5 5 LEU LEU A . n A 1 22 GLN 22 6 6 GLN GLN A . n A 1 23 LYS 23 7 7 LYS LYS A . n A 1 24 ALA 24 8 8 ALA ALA A . n A 1 25 ARG 25 9 9 ARG ARG A . n A 1 26 ILE 26 10 10 ILE ILE A . n A 1 27 LEU 27 11 11 LEU LEU A . n A 1 28 VAL 28 12 12 VAL VAL A . n A 1 29 ASN 29 13 13 ASN ASN A . n A 1 30 GLN 30 14 14 GLN GLN A . n A 1 31 LEU 31 15 15 LEU LEU A . n A 1 32 GLU 32 16 16 GLU GLU A . n A 1 33 LYS 33 17 17 LYS LYS A . n A 1 34 TYR 34 18 18 TYR TYR A . n A 1 35 LEU 35 19 19 LEU LEU A . n A 1 36 ASP 36 20 20 ASP ASP A . n A 1 37 ARG 37 21 21 ARG ARG A . n A 1 38 TYR 38 22 22 TYR TYR A . n A 1 39 ALA 39 23 23 ALA ALA A . n A 1 40 LYS 40 24 24 LYS LYS A . n A 1 41 GLU 41 25 25 GLU GLU A . n A 1 42 TYR 42 26 26 TYR TYR A . n A 1 43 ASP 43 27 27 ASP ASP A . n A 1 44 VAL 44 28 28 VAL VAL A . n A 1 45 GLU 45 29 29 GLU GLU A . n A 1 46 HIS 46 30 30 HIS HIS A . n A 1 47 LEU 47 31 31 LEU LEU A . n A 1 48 ALA 48 32 32 ALA ALA A . n A 1 49 GLY 49 33 33 GLY GLY A . n A 1 50 PRO 50 34 34 PRO PRO A . n A 1 51 GLN 51 35 35 GLN GLN A . n A 1 52 GLY 52 36 36 GLY GLY A . n A 1 53 HIS 53 37 37 HIS HIS A . n A 1 54 LEU 54 38 38 LEU LEU A . n A 1 55 VAL 55 39 39 VAL VAL A . n A 1 56 MET 56 40 40 MET MET A . n A 1 57 HIS 57 41 41 HIS HIS A . n A 1 58 LEU 58 42 42 LEU LEU A . n A 1 59 TYR 59 43 43 TYR TYR A . n A 1 60 LYS 60 44 44 LYS LYS A . n A 1 61 HIS 61 45 45 HIS HIS A . n A 1 62 PRO 62 46 46 PRO PRO A . n A 1 63 ASP 63 47 47 ASP ASP A . n A 1 64 LYS 64 48 48 LYS LYS A . n A 1 65 ASP 65 49 49 ASP ASP A . n A 1 66 MET 66 50 50 MET MET A . n A 1 67 SER 67 51 51 SER SER A . n A 1 68 ILE 68 52 52 ILE ILE A . n A 1 69 LYS 69 53 53 LYS LYS A . n A 1 70 ASP 70 54 54 ASP ASP A . n A 1 71 ALA 71 55 55 ALA ALA A . n A 1 72 GLU 72 56 56 GLU GLU A . n A 1 73 GLU 73 57 57 GLU GLU A . n A 1 74 ILE 74 58 58 ILE ILE A . n A 1 75 LEU 75 59 59 LEU LEU A . n A 1 76 HIS 76 60 60 HIS HIS A . n A 1 77 ILE 77 61 61 ILE ILE A . n A 1 78 SER 78 62 62 SER SER A . n A 1 79 LYS 79 63 63 LYS LYS A . n A 1 80 SER 80 64 64 SER SER A . n A 1 81 VAL 81 65 65 VAL VAL A . n A 1 82 ALA 82 66 66 ALA ALA A . n A 1 83 SER 83 67 67 SER SER A . n A 1 84 ASN 84 68 68 ASN ASN A . n A 1 85 LEU 85 69 69 LEU LEU A . n A 1 86 VAL 86 70 70 VAL VAL A . n A 1 87 LYS 87 71 71 LYS LYS A . n A 1 88 ARG 88 72 72 ARG ARG A . n A 1 89 MET 89 73 73 MET MET A . n A 1 90 GLU 90 74 74 GLU GLU A . n A 1 91 LYS 91 75 75 LYS LYS A . n A 1 92 ASN 92 76 76 ASN ASN A . n A 1 93 GLY 93 77 77 GLY GLY A . n A 1 94 PHE 94 78 78 PHE PHE A . n A 1 95 ILE 95 79 79 ILE ILE A . n A 1 96 ALA 96 80 80 ALA ALA A . n A 1 97 ILE 97 81 81 ILE ILE A . n A 1 98 VAL 98 82 82 VAL VAL A . n A 1 99 PRO 99 83 83 PRO PRO A . n A 1 100 SER 100 84 84 SER SER A . n A 1 101 LYS 101 85 85 LYS LYS A . n A 1 102 THR 102 86 86 THR THR A . n A 1 103 ASP 103 87 87 ASP ASP A . n A 1 104 LYS 104 88 88 LYS LYS A . n A 1 105 ARG 105 89 89 ARG ARG A . n A 1 106 VAL 106 90 90 VAL VAL A . n A 1 107 LYS 107 91 91 LYS LYS A . n A 1 108 TYR 108 92 92 TYR TYR A . n A 1 109 LEU 109 93 93 LEU LEU A . n A 1 110 TYR 110 94 94 TYR TYR A . n A 1 111 LEU 111 95 95 LEU LEU A . n A 1 112 THR 112 96 96 THR THR A . n A 1 113 HIS 113 97 97 HIS HIS A . n A 1 114 LEU 114 98 98 LEU LEU A . n A 1 115 GLY 115 99 99 GLY GLY A . n A 1 116 LYS 116 100 100 LYS LYS A . n A 1 117 GLN 117 101 101 GLN GLN A . n A 1 118 LYS 118 102 102 LYS LYS A . n A 1 119 ALA 119 103 103 ALA ALA A . n A 1 120 THR 120 104 104 THR THR A . n A 1 121 GLN 121 105 105 GLN GLN A . n A 1 122 PHE 122 106 106 PHE PHE A . n A 1 123 GLU 123 107 107 GLU GLU A . n A 1 124 ILE 124 108 108 ILE ILE A . n A 1 125 PHE 125 109 109 PHE PHE A . n A 1 126 LEU 126 110 110 LEU LEU A . n A 1 127 GLU 127 111 111 GLU GLU A . n A 1 128 LYS 128 112 112 LYS LYS A . n A 1 129 LEU 129 113 113 LEU LEU A . n A 1 130 HIS 130 114 114 HIS HIS A . n A 1 131 SER 131 115 115 SER SER A . n A 1 132 THR 132 116 116 THR THR A . n A 1 133 MET 133 117 117 MET MET A . n A 1 134 LEU 134 118 118 LEU LEU A . n A 1 135 ALA 135 119 119 ALA ALA A . n A 1 136 GLY 136 120 120 GLY GLY A . n A 1 137 ILE 137 121 121 ILE ILE A . n A 1 138 THR 138 122 122 THR THR A . n A 1 139 LYS 139 123 123 LYS LYS A . n A 1 140 GLU 140 124 124 GLU GLU A . n A 1 141 GLU 141 125 125 GLU GLU A . n A 1 142 ILE 142 126 126 ILE ILE A . n A 1 143 ARG 143 127 127 ARG ARG A . n A 1 144 THR 144 128 128 THR THR A . n A 1 145 THR 145 129 129 THR THR A . n A 1 146 LYS 146 130 130 LYS LYS A . n A 1 147 LYS 147 131 131 LYS LYS A . n A 1 148 VAL 148 132 132 VAL VAL A . n A 1 149 ILE 149 133 133 ILE ILE A . n A 1 150 ARG 150 134 134 ARG ARG A . n A 1 151 THR 151 135 135 THR THR A . n A 1 152 LEU 152 136 136 LEU LEU A . n A 1 153 ALA 153 137 137 ALA ALA A . n A 1 154 LYS 154 138 138 LYS LYS A . n A 1 155 ASN 155 139 139 ASN ASN A . n A 1 156 MET 156 140 140 MET MET A . n A 1 157 ALA 157 141 141 ALA ALA A . n A 1 158 MET 158 142 ? ? ? A . n A 1 159 GLU 159 143 ? ? ? A . n A 1 160 ASP 160 144 ? ? ? A . n A 1 161 PHE 161 145 ? ? ? A . n A 1 162 ASP 162 146 ? ? ? A . n B 1 1 HIS 1 -15 ? ? ? B . n B 1 2 HIS 2 -14 ? ? ? B . n B 1 3 HIS 3 -13 ? ? ? B . n B 1 4 HIS 4 -12 ? ? ? B . n B 1 5 HIS 5 -11 ? ? ? B . n B 1 6 HIS 6 -10 ? ? ? B . n B 1 7 SER 7 -9 ? ? ? B . n B 1 8 SER 8 -8 ? ? ? B . n B 1 9 GLY 9 -7 ? ? ? B . n B 1 10 LEU 10 -6 ? ? ? B . n B 1 11 VAL 11 -5 ? ? ? B . n B 1 12 PRO 12 -4 ? ? ? B . n B 1 13 ARG 13 -3 ? ? ? B . n B 1 14 GLY 14 -2 ? ? ? B . n B 1 15 SER 15 -1 ? ? ? B . n B 1 16 HIS 16 0 ? ? ? B . n B 1 17 MET 17 1 ? ? ? B . n B 1 18 GLU 18 2 ? ? ? B . n B 1 19 ASN 19 3 3 ASN ASN B . n B 1 20 PRO 20 4 4 PRO PRO B . n B 1 21 LEU 21 5 5 LEU LEU B . n B 1 22 GLN 22 6 6 GLN GLN B . n B 1 23 LYS 23 7 7 LYS LYS B . n B 1 24 ALA 24 8 8 ALA ALA B . n B 1 25 ARG 25 9 9 ARG ARG B . n B 1 26 ILE 26 10 10 ILE ILE B . n B 1 27 LEU 27 11 11 LEU LEU B . n B 1 28 VAL 28 12 12 VAL VAL B . n B 1 29 ASN 29 13 13 ASN ASN B . n B 1 30 GLN 30 14 14 GLN GLN B . n B 1 31 LEU 31 15 15 LEU LEU B . n B 1 32 GLU 32 16 16 GLU GLU B . n B 1 33 LYS 33 17 17 LYS LYS B . n B 1 34 TYR 34 18 18 TYR TYR B . n B 1 35 LEU 35 19 19 LEU LEU B . n B 1 36 ASP 36 20 20 ASP ASP B . n B 1 37 ARG 37 21 21 ARG ARG B . n B 1 38 TYR 38 22 22 TYR TYR B . n B 1 39 ALA 39 23 23 ALA ALA B . n B 1 40 LYS 40 24 24 LYS LYS B . n B 1 41 GLU 41 25 25 GLU GLU B . n B 1 42 TYR 42 26 26 TYR TYR B . n B 1 43 ASP 43 27 27 ASP ASP B . n B 1 44 VAL 44 28 28 VAL VAL B . n B 1 45 GLU 45 29 29 GLU GLU B . n B 1 46 HIS 46 30 30 HIS HIS B . n B 1 47 LEU 47 31 31 LEU LEU B . n B 1 48 ALA 48 32 32 ALA ALA B . n B 1 49 GLY 49 33 33 GLY GLY B . n B 1 50 PRO 50 34 34 PRO PRO B . n B 1 51 GLN 51 35 35 GLN GLN B . n B 1 52 GLY 52 36 36 GLY GLY B . n B 1 53 HIS 53 37 37 HIS HIS B . n B 1 54 LEU 54 38 38 LEU LEU B . n B 1 55 VAL 55 39 39 VAL VAL B . n B 1 56 MET 56 40 40 MET MET B . n B 1 57 HIS 57 41 41 HIS HIS B . n B 1 58 LEU 58 42 42 LEU LEU B . n B 1 59 TYR 59 43 43 TYR TYR B . n B 1 60 LYS 60 44 44 LYS LYS B . n B 1 61 HIS 61 45 45 HIS HIS B . n B 1 62 PRO 62 46 46 PRO PRO B . n B 1 63 ASP 63 47 47 ASP ASP B . n B 1 64 LYS 64 48 48 LYS LYS B . n B 1 65 ASP 65 49 49 ASP ASP B . n B 1 66 MET 66 50 50 MET MET B . n B 1 67 SER 67 51 51 SER SER B . n B 1 68 ILE 68 52 52 ILE ILE B . n B 1 69 LYS 69 53 53 LYS LYS B . n B 1 70 ASP 70 54 54 ASP ASP B . n B 1 71 ALA 71 55 55 ALA ALA B . n B 1 72 GLU 72 56 56 GLU GLU B . n B 1 73 GLU 73 57 57 GLU GLU B . n B 1 74 ILE 74 58 58 ILE ILE B . n B 1 75 LEU 75 59 59 LEU LEU B . n B 1 76 HIS 76 60 60 HIS HIS B . n B 1 77 ILE 77 61 61 ILE ILE B . n B 1 78 SER 78 62 62 SER SER B . n B 1 79 LYS 79 63 63 LYS LYS B . n B 1 80 SER 80 64 64 SER SER B . n B 1 81 VAL 81 65 65 VAL VAL B . n B 1 82 ALA 82 66 66 ALA ALA B . n B 1 83 SER 83 67 67 SER SER B . n B 1 84 ASN 84 68 68 ASN ASN B . n B 1 85 LEU 85 69 69 LEU LEU B . n B 1 86 VAL 86 70 70 VAL VAL B . n B 1 87 LYS 87 71 71 LYS LYS B . n B 1 88 ARG 88 72 72 ARG ARG B . n B 1 89 MET 89 73 73 MET MET B . n B 1 90 GLU 90 74 74 GLU GLU B . n B 1 91 LYS 91 75 75 LYS LYS B . n B 1 92 ASN 92 76 76 ASN ASN B . n B 1 93 GLY 93 77 77 GLY GLY B . n B 1 94 PHE 94 78 78 PHE PHE B . n B 1 95 ILE 95 79 79 ILE ILE B . n B 1 96 ALA 96 80 80 ALA ALA B . n B 1 97 ILE 97 81 81 ILE ILE B . n B 1 98 VAL 98 82 82 VAL VAL B . n B 1 99 PRO 99 83 83 PRO PRO B . n B 1 100 SER 100 84 84 SER SER B . n B 1 101 LYS 101 85 85 LYS LYS B . n B 1 102 THR 102 86 86 THR THR B . n B 1 103 ASP 103 87 87 ASP ASP B . n B 1 104 LYS 104 88 88 LYS LYS B . n B 1 105 ARG 105 89 89 ARG ARG B . n B 1 106 VAL 106 90 90 VAL VAL B . n B 1 107 LYS 107 91 91 LYS LYS B . n B 1 108 TYR 108 92 92 TYR TYR B . n B 1 109 LEU 109 93 93 LEU LEU B . n B 1 110 TYR 110 94 94 TYR TYR B . n B 1 111 LEU 111 95 95 LEU LEU B . n B 1 112 THR 112 96 96 THR THR B . n B 1 113 HIS 113 97 97 HIS HIS B . n B 1 114 LEU 114 98 98 LEU LEU B . n B 1 115 GLY 115 99 99 GLY GLY B . n B 1 116 LYS 116 100 100 LYS LYS B . n B 1 117 GLN 117 101 101 GLN GLN B . n B 1 118 LYS 118 102 102 LYS LYS B . n B 1 119 ALA 119 103 103 ALA ALA B . n B 1 120 THR 120 104 104 THR THR B . n B 1 121 GLN 121 105 105 GLN GLN B . n B 1 122 PHE 122 106 106 PHE PHE B . n B 1 123 GLU 123 107 107 GLU GLU B . n B 1 124 ILE 124 108 108 ILE ILE B . n B 1 125 PHE 125 109 109 PHE PHE B . n B 1 126 LEU 126 110 110 LEU LEU B . n B 1 127 GLU 127 111 111 GLU GLU B . n B 1 128 LYS 128 112 112 LYS LYS B . n B 1 129 LEU 129 113 113 LEU LEU B . n B 1 130 HIS 130 114 114 HIS HIS B . n B 1 131 SER 131 115 115 SER SER B . n B 1 132 THR 132 116 116 THR THR B . n B 1 133 MET 133 117 117 MET MET B . n B 1 134 LEU 134 118 118 LEU LEU B . n B 1 135 ALA 135 119 119 ALA ALA B . n B 1 136 GLY 136 120 120 GLY GLY B . n B 1 137 ILE 137 121 121 ILE ILE B . n B 1 138 THR 138 122 122 THR THR B . n B 1 139 LYS 139 123 123 LYS LYS B . n B 1 140 GLU 140 124 124 GLU GLU B . n B 1 141 GLU 141 125 125 GLU GLU B . n B 1 142 ILE 142 126 126 ILE ILE B . n B 1 143 ARG 143 127 127 ARG ARG B . n B 1 144 THR 144 128 128 THR THR B . n B 1 145 THR 145 129 129 THR THR B . n B 1 146 LYS 146 130 130 LYS LYS B . n B 1 147 LYS 147 131 131 LYS LYS B . n B 1 148 VAL 148 132 132 VAL VAL B . n B 1 149 ILE 149 133 133 ILE ILE B . n B 1 150 ARG 150 134 134 ARG ARG B . n B 1 151 THR 151 135 135 THR THR B . n B 1 152 LEU 152 136 136 LEU LEU B . n B 1 153 ALA 153 137 137 ALA ALA B . n B 1 154 LYS 154 138 138 LYS LYS B . n B 1 155 ASN 155 139 139 ASN ASN B . n B 1 156 MET 156 140 140 MET MET B . n B 1 157 ALA 157 141 ? ? ? B . n B 1 158 MET 158 142 ? ? ? B . n B 1 159 GLU 159 143 ? ? ? B . n B 1 160 ASP 160 144 ? ? ? B . n B 1 161 PHE 161 145 ? ? ? B . n B 1 162 ASP 162 146 ? ? ? B . n C 1 1 HIS 1 -15 ? ? ? C . n C 1 2 HIS 2 -14 ? ? ? C . n C 1 3 HIS 3 -13 ? ? ? C . n C 1 4 HIS 4 -12 ? ? ? C . n C 1 5 HIS 5 -11 ? ? ? C . n C 1 6 HIS 6 -10 ? ? ? C . n C 1 7 SER 7 -9 ? ? ? C . n C 1 8 SER 8 -8 ? ? ? C . n C 1 9 GLY 9 -7 ? ? ? C . n C 1 10 LEU 10 -6 ? ? ? C . n C 1 11 VAL 11 -5 ? ? ? C . n C 1 12 PRO 12 -4 ? ? ? C . n C 1 13 ARG 13 -3 ? ? ? C . n C 1 14 GLY 14 -2 ? ? ? C . n C 1 15 SER 15 -1 ? ? ? C . n C 1 16 HIS 16 0 ? ? ? C . n C 1 17 MET 17 1 ? ? ? C . n C 1 18 GLU 18 2 ? ? ? C . n C 1 19 ASN 19 3 3 ASN ASN C . n C 1 20 PRO 20 4 4 PRO PRO C . n C 1 21 LEU 21 5 5 LEU LEU C . n C 1 22 GLN 22 6 6 GLN GLN C . n C 1 23 LYS 23 7 7 LYS LYS C . n C 1 24 ALA 24 8 8 ALA ALA C . n C 1 25 ARG 25 9 9 ARG ARG C . n C 1 26 ILE 26 10 10 ILE ILE C . n C 1 27 LEU 27 11 11 LEU LEU C . n C 1 28 VAL 28 12 12 VAL VAL C . n C 1 29 ASN 29 13 13 ASN ASN C . n C 1 30 GLN 30 14 14 GLN GLN C . n C 1 31 LEU 31 15 15 LEU LEU C . n C 1 32 GLU 32 16 16 GLU GLU C . n C 1 33 LYS 33 17 17 LYS LYS C . n C 1 34 TYR 34 18 18 TYR TYR C . n C 1 35 LEU 35 19 19 LEU LEU C . n C 1 36 ASP 36 20 20 ASP ASP C . n C 1 37 ARG 37 21 21 ARG ARG C . n C 1 38 TYR 38 22 22 TYR TYR C . n C 1 39 ALA 39 23 23 ALA ALA C . n C 1 40 LYS 40 24 24 LYS LYS C . n C 1 41 GLU 41 25 25 GLU GLU C . n C 1 42 TYR 42 26 26 TYR TYR C . n C 1 43 ASP 43 27 27 ASP ASP C . n C 1 44 VAL 44 28 28 VAL VAL C . n C 1 45 GLU 45 29 29 GLU GLU C . n C 1 46 HIS 46 30 30 HIS HIS C . n C 1 47 LEU 47 31 31 LEU LEU C . n C 1 48 ALA 48 32 32 ALA ALA C . n C 1 49 GLY 49 33 33 GLY GLY C . n C 1 50 PRO 50 34 34 PRO PRO C . n C 1 51 GLN 51 35 35 GLN GLN C . n C 1 52 GLY 52 36 36 GLY GLY C . n C 1 53 HIS 53 37 37 HIS HIS C . n C 1 54 LEU 54 38 38 LEU LEU C . n C 1 55 VAL 55 39 39 VAL VAL C . n C 1 56 MET 56 40 40 MET MET C . n C 1 57 HIS 57 41 41 HIS HIS C . n C 1 58 LEU 58 42 42 LEU LEU C . n C 1 59 TYR 59 43 43 TYR TYR C . n C 1 60 LYS 60 44 44 LYS LYS C . n C 1 61 HIS 61 45 45 HIS HIS C . n C 1 62 PRO 62 46 46 PRO PRO C . n C 1 63 ASP 63 47 47 ASP ASP C . n C 1 64 LYS 64 48 48 LYS LYS C . n C 1 65 ASP 65 49 49 ASP ASP C . n C 1 66 MET 66 50 50 MET MET C . n C 1 67 SER 67 51 51 SER SER C . n C 1 68 ILE 68 52 52 ILE ILE C . n C 1 69 LYS 69 53 53 LYS LYS C . n C 1 70 ASP 70 54 54 ASP ASP C . n C 1 71 ALA 71 55 55 ALA ALA C . n C 1 72 GLU 72 56 56 GLU GLU C . n C 1 73 GLU 73 57 57 GLU GLU C . n C 1 74 ILE 74 58 58 ILE ILE C . n C 1 75 LEU 75 59 59 LEU LEU C . n C 1 76 HIS 76 60 60 HIS HIS C . n C 1 77 ILE 77 61 61 ILE ILE C . n C 1 78 SER 78 62 62 SER SER C . n C 1 79 LYS 79 63 63 LYS LYS C . n C 1 80 SER 80 64 64 SER SER C . n C 1 81 VAL 81 65 65 VAL VAL C . n C 1 82 ALA 82 66 66 ALA ALA C . n C 1 83 SER 83 67 67 SER SER C . n C 1 84 ASN 84 68 68 ASN ASN C . n C 1 85 LEU 85 69 69 LEU LEU C . n C 1 86 VAL 86 70 70 VAL VAL C . n C 1 87 LYS 87 71 71 LYS LYS C . n C 1 88 ARG 88 72 72 ARG ARG C . n C 1 89 MET 89 73 73 MET MET C . n C 1 90 GLU 90 74 74 GLU GLU C . n C 1 91 LYS 91 75 75 LYS LYS C . n C 1 92 ASN 92 76 76 ASN ASN C . n C 1 93 GLY 93 77 77 GLY GLY C . n C 1 94 PHE 94 78 78 PHE PHE C . n C 1 95 ILE 95 79 79 ILE ILE C . n C 1 96 ALA 96 80 80 ALA ALA C . n C 1 97 ILE 97 81 81 ILE ILE C . n C 1 98 VAL 98 82 82 VAL VAL C . n C 1 99 PRO 99 83 83 PRO PRO C . n C 1 100 SER 100 84 84 SER SER C . n C 1 101 LYS 101 85 85 LYS LYS C . n C 1 102 THR 102 86 86 THR THR C . n C 1 103 ASP 103 87 87 ASP ASP C . n C 1 104 LYS 104 88 88 LYS LYS C . n C 1 105 ARG 105 89 89 ARG ARG C . n C 1 106 VAL 106 90 90 VAL VAL C . n C 1 107 LYS 107 91 91 LYS LYS C . n C 1 108 TYR 108 92 92 TYR TYR C . n C 1 109 LEU 109 93 93 LEU LEU C . n C 1 110 TYR 110 94 94 TYR TYR C . n C 1 111 LEU 111 95 95 LEU LEU C . n C 1 112 THR 112 96 96 THR THR C . n C 1 113 HIS 113 97 97 HIS HIS C . n C 1 114 LEU 114 98 98 LEU LEU C . n C 1 115 GLY 115 99 99 GLY GLY C . n C 1 116 LYS 116 100 100 LYS LYS C . n C 1 117 GLN 117 101 101 GLN GLN C . n C 1 118 LYS 118 102 102 LYS LYS C . n C 1 119 ALA 119 103 103 ALA ALA C . n C 1 120 THR 120 104 104 THR THR C . n C 1 121 GLN 121 105 105 GLN GLN C . n C 1 122 PHE 122 106 106 PHE PHE C . n C 1 123 GLU 123 107 107 GLU GLU C . n C 1 124 ILE 124 108 108 ILE ILE C . n C 1 125 PHE 125 109 109 PHE PHE C . n C 1 126 LEU 126 110 110 LEU LEU C . n C 1 127 GLU 127 111 111 GLU GLU C . n C 1 128 LYS 128 112 112 LYS LYS C . n C 1 129 LEU 129 113 113 LEU LEU C . n C 1 130 HIS 130 114 114 HIS HIS C . n C 1 131 SER 131 115 115 SER SER C . n C 1 132 THR 132 116 116 THR THR C . n C 1 133 MET 133 117 117 MET MET C . n C 1 134 LEU 134 118 118 LEU LEU C . n C 1 135 ALA 135 119 ? ? ? C . n C 1 136 GLY 136 120 ? ? ? C . n C 1 137 ILE 137 121 ? ? ? C . n C 1 138 THR 138 122 ? ? ? C . n C 1 139 LYS 139 123 ? ? ? C . n C 1 140 GLU 140 124 ? ? ? C . n C 1 141 GLU 141 125 ? ? ? C . n C 1 142 ILE 142 126 ? ? ? C . n C 1 143 ARG 143 127 ? ? ? C . n C 1 144 THR 144 128 ? ? ? C . n C 1 145 THR 145 129 ? ? ? C . n C 1 146 LYS 146 130 ? ? ? C . n C 1 147 LYS 147 131 ? ? ? C . n C 1 148 VAL 148 132 ? ? ? C . n C 1 149 ILE 149 133 ? ? ? C . n C 1 150 ARG 150 134 ? ? ? C . n C 1 151 THR 151 135 ? ? ? C . n C 1 152 LEU 152 136 ? ? ? C . n C 1 153 ALA 153 137 ? ? ? C . n C 1 154 LYS 154 138 ? ? ? C . n C 1 155 ASN 155 139 ? ? ? C . n C 1 156 MET 156 140 ? ? ? C . n C 1 157 ALA 157 141 ? ? ? C . n C 1 158 MET 158 142 ? ? ? C . n C 1 159 GLU 159 143 ? ? ? C . n C 1 160 ASP 160 144 ? ? ? C . n C 1 161 PHE 161 145 ? ? ? C . n C 1 162 ASP 162 146 ? ? ? C . n D 1 1 HIS 1 -15 ? ? ? D . n D 1 2 HIS 2 -14 ? ? ? D . n D 1 3 HIS 3 -13 ? ? ? D . n D 1 4 HIS 4 -12 ? ? ? D . n D 1 5 HIS 5 -11 ? ? ? D . n D 1 6 HIS 6 -10 ? ? ? D . n D 1 7 SER 7 -9 ? ? ? D . n D 1 8 SER 8 -8 ? ? ? D . n D 1 9 GLY 9 -7 ? ? ? D . n D 1 10 LEU 10 -6 ? ? ? D . n D 1 11 VAL 11 -5 ? ? ? D . n D 1 12 PRO 12 -4 ? ? ? D . n D 1 13 ARG 13 -3 ? ? ? D . n D 1 14 GLY 14 -2 ? ? ? D . n D 1 15 SER 15 -1 ? ? ? D . n D 1 16 HIS 16 0 ? ? ? D . n D 1 17 MET 17 1 ? ? ? D . n D 1 18 GLU 18 2 ? ? ? D . n D 1 19 ASN 19 3 ? ? ? D . n D 1 20 PRO 20 4 4 PRO PRO D . n D 1 21 LEU 21 5 5 LEU LEU D . n D 1 22 GLN 22 6 6 GLN GLN D . n D 1 23 LYS 23 7 7 LYS LYS D . n D 1 24 ALA 24 8 8 ALA ALA D . n D 1 25 ARG 25 9 9 ARG ARG D . n D 1 26 ILE 26 10 10 ILE ILE D . n D 1 27 LEU 27 11 11 LEU LEU D . n D 1 28 VAL 28 12 12 VAL VAL D . n D 1 29 ASN 29 13 13 ASN ASN D . n D 1 30 GLN 30 14 14 GLN GLN D . n D 1 31 LEU 31 15 15 LEU LEU D . n D 1 32 GLU 32 16 16 GLU GLU D . n D 1 33 LYS 33 17 17 LYS LYS D . n D 1 34 TYR 34 18 18 TYR TYR D . n D 1 35 LEU 35 19 19 LEU LEU D . n D 1 36 ASP 36 20 20 ASP ASP D . n D 1 37 ARG 37 21 21 ARG ARG D . n D 1 38 TYR 38 22 22 TYR TYR D . n D 1 39 ALA 39 23 23 ALA ALA D . n D 1 40 LYS 40 24 24 LYS LYS D . n D 1 41 GLU 41 25 25 GLU GLU D . n D 1 42 TYR 42 26 26 TYR TYR D . n D 1 43 ASP 43 27 27 ASP ASP D . n D 1 44 VAL 44 28 28 VAL VAL D . n D 1 45 GLU 45 29 29 GLU GLU D . n D 1 46 HIS 46 30 30 HIS HIS D . n D 1 47 LEU 47 31 31 LEU LEU D . n D 1 48 ALA 48 32 32 ALA ALA D . n D 1 49 GLY 49 33 33 GLY GLY D . n D 1 50 PRO 50 34 34 PRO PRO D . n D 1 51 GLN 51 35 35 GLN GLN D . n D 1 52 GLY 52 36 36 GLY GLY D . n D 1 53 HIS 53 37 37 HIS HIS D . n D 1 54 LEU 54 38 38 LEU LEU D . n D 1 55 VAL 55 39 39 VAL VAL D . n D 1 56 MET 56 40 40 MET MET D . n D 1 57 HIS 57 41 41 HIS HIS D . n D 1 58 LEU 58 42 42 LEU LEU D . n D 1 59 TYR 59 43 43 TYR TYR D . n D 1 60 LYS 60 44 ? ? ? D . n D 1 61 HIS 61 45 ? ? ? D . n D 1 62 PRO 62 46 ? ? ? D . n D 1 63 ASP 63 47 47 ASP ASP D . n D 1 64 LYS 64 48 48 LYS LYS D . n D 1 65 ASP 65 49 49 ASP ASP D . n D 1 66 MET 66 50 50 MET MET D . n D 1 67 SER 67 51 51 SER SER D . n D 1 68 ILE 68 52 52 ILE ILE D . n D 1 69 LYS 69 53 53 LYS LYS D . n D 1 70 ASP 70 54 54 ASP ASP D . n D 1 71 ALA 71 55 55 ALA ALA D . n D 1 72 GLU 72 56 56 GLU GLU D . n D 1 73 GLU 73 57 57 GLU GLU D . n D 1 74 ILE 74 58 58 ILE ILE D . n D 1 75 LEU 75 59 59 LEU LEU D . n D 1 76 HIS 76 60 60 HIS HIS D . n D 1 77 ILE 77 61 61 ILE ILE D . n D 1 78 SER 78 62 62 SER SER D . n D 1 79 LYS 79 63 63 LYS LYS D . n D 1 80 SER 80 64 64 SER SER D . n D 1 81 VAL 81 65 65 VAL VAL D . n D 1 82 ALA 82 66 66 ALA ALA D . n D 1 83 SER 83 67 67 SER SER D . n D 1 84 ASN 84 68 68 ASN ASN D . n D 1 85 LEU 85 69 69 LEU LEU D . n D 1 86 VAL 86 70 70 VAL VAL D . n D 1 87 LYS 87 71 71 LYS LYS D . n D 1 88 ARG 88 72 72 ARG ARG D . n D 1 89 MET 89 73 73 MET MET D . n D 1 90 GLU 90 74 74 GLU GLU D . n D 1 91 LYS 91 75 75 LYS LYS D . n D 1 92 ASN 92 76 76 ASN ASN D . n D 1 93 GLY 93 77 77 GLY GLY D . n D 1 94 PHE 94 78 78 PHE PHE D . n D 1 95 ILE 95 79 79 ILE ILE D . n D 1 96 ALA 96 80 80 ALA ALA D . n D 1 97 ILE 97 81 81 ILE ILE D . n D 1 98 VAL 98 82 82 VAL VAL D . n D 1 99 PRO 99 83 83 PRO PRO D . n D 1 100 SER 100 84 84 SER SER D . n D 1 101 LYS 101 85 85 LYS LYS D . n D 1 102 THR 102 86 86 THR THR D . n D 1 103 ASP 103 87 87 ASP ASP D . n D 1 104 LYS 104 88 88 LYS LYS D . n D 1 105 ARG 105 89 89 ARG ARG D . n D 1 106 VAL 106 90 90 VAL VAL D . n D 1 107 LYS 107 91 91 LYS LYS D . n D 1 108 TYR 108 92 92 TYR TYR D . n D 1 109 LEU 109 93 93 LEU LEU D . n D 1 110 TYR 110 94 94 TYR TYR D . n D 1 111 LEU 111 95 95 LEU LEU D . n D 1 112 THR 112 96 96 THR THR D . n D 1 113 HIS 113 97 97 HIS HIS D . n D 1 114 LEU 114 98 98 LEU LEU D . n D 1 115 GLY 115 99 99 GLY GLY D . n D 1 116 LYS 116 100 100 LYS LYS D . n D 1 117 GLN 117 101 ? ? ? D . n D 1 118 LYS 118 102 ? ? ? D . n D 1 119 ALA 119 103 ? ? ? D . n D 1 120 THR 120 104 ? ? ? D . n D 1 121 GLN 121 105 ? ? ? D . n D 1 122 PHE 122 106 ? ? ? D . n D 1 123 GLU 123 107 ? ? ? D . n D 1 124 ILE 124 108 ? ? ? D . n D 1 125 PHE 125 109 ? ? ? D . n D 1 126 LEU 126 110 ? ? ? D . n D 1 127 GLU 127 111 ? ? ? D . n D 1 128 LYS 128 112 ? ? ? D . n D 1 129 LEU 129 113 ? ? ? D . n D 1 130 HIS 130 114 ? ? ? D . n D 1 131 SER 131 115 ? ? ? D . n D 1 132 THR 132 116 ? ? ? D . n D 1 133 MET 133 117 ? ? ? D . n D 1 134 LEU 134 118 ? ? ? D . n D 1 135 ALA 135 119 ? ? ? D . n D 1 136 GLY 136 120 ? ? ? D . n D 1 137 ILE 137 121 ? ? ? D . n D 1 138 THR 138 122 ? ? ? D . n D 1 139 LYS 139 123 ? ? ? D . n D 1 140 GLU 140 124 ? ? ? D . n D 1 141 GLU 141 125 ? ? ? D . n D 1 142 ILE 142 126 ? ? ? D . n D 1 143 ARG 143 127 127 ARG ARG D . n D 1 144 THR 144 128 128 THR THR D . n D 1 145 THR 145 129 129 THR THR D . n D 1 146 LYS 146 130 130 LYS LYS D . n D 1 147 LYS 147 131 131 LYS LYS D . n D 1 148 VAL 148 132 132 VAL VAL D . n D 1 149 ILE 149 133 133 ILE ILE D . n D 1 150 ARG 150 134 134 ARG ARG D . n D 1 151 THR 151 135 135 THR THR D . n D 1 152 LEU 152 136 136 LEU LEU D . n D 1 153 ALA 153 137 137 ALA ALA D . n D 1 154 LYS 154 138 138 LYS LYS D . n D 1 155 ASN 155 139 139 ASN ASN D . n D 1 156 MET 156 140 140 MET MET D . n D 1 157 ALA 157 141 141 ALA ALA D . n D 1 158 MET 158 142 ? ? ? D . n D 1 159 GLU 159 143 ? ? ? D . n D 1 160 ASP 160 144 ? ? ? D . n D 1 161 PHE 161 145 ? ? ? D . n D 1 162 ASP 162 146 ? ? ? D . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1 C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2810 ? 1 MORE -28 ? 1 'SSA (A^2)' 16150 ? 2 'ABSA (A^2)' 1160 ? 2 MORE -14 ? 2 'SSA (A^2)' 13930 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-29 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 134.892398989 1.28183265907 187.030278804 0.658533248854 ? -0.174041134635 ? -0.0420276820757 ? 0.548946831553 ? -0.018978382598 ? 0.778467456758 ? 3.55390323952 ? 0.0878643915338 ? 1.86787156555 ? 4.54576762087 ? -1.92274261432 ? 2.29763886384 ? -0.687106297906 ? -0.190401832528 ? 0.386821539337 ? 0.0832212671622 ? 0.141109030615 ? -0.119571014703 ? -1.82920508454 ? 1.50660612087 ? 0.439447996946 ? 2 'X-RAY DIFFRACTION' ? refined 116.391607763 -3.58009560387 171.478701717 0.880508856194 ? -0.237463267464 ? 0.029845194554 ? 0.751207855471 ? -0.0874638873113 ? 0.769912178769 ? 3.60129746068 ? -3.20953676988 ? 0.868372043445 ? 2.97524318705 ? -1.76629503775 ? 4.23955625276 ? -0.430693667087 ? 0.354252456319 ? -0.702132184587 ? -0.506546958933 ? 0.533593958265 ? 0.280521486752 ? 0.95277492433 ? -0.687447470666 ? -0.0840099986387 ? 3 'X-RAY DIFFRACTION' ? refined 106.986593795 2.46465843198 172.871263712 0.750351831733 ? -0.401275391832 ? -0.122950934177 ? 0.90779088886 ? 0.179811898105 ? 0.843100448551 ? 1.85823218121 ? -2.49276186705 ? -0.63978174386 ? 4.4449231465 ? -0.409529380512 ? 6.46858175145 ? -0.318505809524 ? 0.550916684596 ? 0.45102104379 ? -0.234463048613 ? 0.417283184724 ? 0.254858741741 ? -0.698072649427 ? -0.175676177067 ? -0.150765969432 ? 4 'X-RAY DIFFRACTION' ? refined 126.189445213 -4.92808777336 170.573469381 0.918152394329 ? -0.405349554478 ? 0.0989932812092 ? 0.899358358516 ? 0.0583161202701 ? 0.796367435641 ? 4.39019129081 ? -1.16267593944 ? 2.52099869752 ? 2.77236509109 ? 1.89913753222 ? 6.9696873377 ? -0.403930457305 ? 1.7968288766 ? -0.351338642356 ? -0.65372543378 ? 0.0155168606835 ? 0.037148177159 ? 1.12445169504 ? 0.314334332281 ? 0.354744832228 ? 5 'X-RAY DIFFRACTION' ? refined 123.879458818 -7.95012149206 192.696389645 0.747270385756 ? -0.037182435657 ? 0.00439439319443 ? 0.657965985183 ? -0.0707511924657 ? 0.823501256927 ? 3.82130743184 ? -0.193458098029 ? -4.22262571351 ? 3.0600268001 ? -3.2907865803 ? 9.02027068135 ? -0.765781502999 ? -0.514245067953 ? 0.347700863895 ? -0.316151695458 ? 0.681528391685 ? -0.211189423997 ? 0.971148050812 ? 0.112706930649 ? -0.0164709215937 ? 6 'X-RAY DIFFRACTION' ? refined 125.378159157 4.21406727778 203.247349486 0.843987554951 ? 0.0758077616541 ? -0.063516468842 ? 0.713562056926 ? -0.0303144000436 ? 0.947466894103 ? 2.95108298432 ? -0.488350886324 ? 1.71492632745 ? 1.68282161826 ? -2.7026708358 ? 3.94361362489 ? -0.0299718314853 ? -0.200654546798 ? 0.902575343612 ? 0.0831662444787 ? 0.262714881348 ? -0.0337084891919 ? -2.59492575114 ? -1.57036856361 ? -0.530641083547 ? 7 'X-RAY DIFFRACTION' ? refined 140.482726696 -8.58281470434 216.871133414 0.753222318888 ? 0.106935011561 ? -0.112668032928 ? 0.925942036062 ? -0.0846007903805 ? 0.824584053616 ? 7.62613984256 ? -2.15480281339 ? -1.23011475679 ? 8.86700006813 ? -2.82271743866 ? 5.76135934862 ? 0.671040717376 ? 1.15023563622 ? -0.468085985122 ? -1.02512736852 ? -0.805559391284 ? 1.11017459717 ? 0.510917003181 ? 0.0384811019693 ? 0.0183164823558 ? 8 'X-RAY DIFFRACTION' ? refined 150.649294048 -4.33036895065 220.031166788 0.791498392777 ? 0.0935998942701 ? 0.0327638103872 ? 0.745766716108 ? 0.108653910982 ? 0.776912683312 ? 3.93232631137 ? -3.27932281894 ? -0.76642307119 ? 6.57006345065 ? 1.37382066167 ? 6.49595683014 ? 0.53269060278 ? 0.618261093266 ? 0.0466574058577 ? -1.13557427058 ? -0.655295943881 ? -1.16360949814 ? -0.720104466778 ? -0.0205917808356 ? 0.0965428610283 ? 9 'X-RAY DIFFRACTION' ? refined 131.105495417 -5.96242111299 218.813206968 0.609028698392 ? 0.163378066769 ? -0.00933538995009 ? 0.778410313756 ? -0.0394329477687 ? 0.78558305865 ? 6.26677775118 ? 0.831595793853 ? 1.34308698214 ? -0.696366906954 ? -0.321466625185 ? 6.20599666258 ? -0.407517825389 ? -0.696730224502 ? 0.0333178318541 ? 0.0211101668094 ? 0.256625983942 ? 0.221019251783 ? 0.0836545535356 ? -1.12703290404 ? 0.176491743836 ? 10 'X-RAY DIFFRACTION' ? refined 131.077896189 -11.3272032487 194.719627672 1.01030009315 ? 0.0326079951608 ? 0.102432084916 ? 0.66361294592 ? 0.0438291720569 ? 0.806440950733 ? 2.86389346743 ? -0.751843322923 ? -4.30826626028 ? 8.17803555027 ? 0.961603889222 ? 8.40732467957 ? -0.873300857873 ? -0.522090516056 ? -2.3459386224 ? -0.034335910322 ? -0.426794623524 ? -0.111593675562 ? 1.3087869481 ? 0.963079002327 ? 1.04949878303 ? 11 'X-RAY DIFFRACTION' ? refined 136.577672123 -7.30671273444 153.323675467 1.24454147178 ? -0.244141263026 ? -0.0336135374301 ? 1.61289069805 ? 0.263346376676 ? 0.824517956319 ? 2.92741127762 ? 2.35516168398 ? -2.44357217328 ? 2.99659154137 ? 1.01783345745 ? 9.54414888627 ? 0.676702886661 ? 0.0574250569084 ? 0.24768689917 ? 0.0229470912755 ? -0.484595999389 ? -0.156111325947 ? -0.612401107763 ? -0.00155675290822 ? -0.354756256839 ? 12 'X-RAY DIFFRACTION' ? refined 138.613407632 -30.3170603297 165.610579435 0.906531368435 ? -0.239648819062 ? 0.107746831821 ? 0.84209418761 ? -0.116436987013 ? 0.755333670719 ? 6.3299333751 ? 1.69798638346 ? 0.282821525514 ? 6.7623854393 ? 0.653160521289 ? 6.86961653864 ? -0.545909708274 ? 0.969902475777 ? -0.563004127159 ? -0.965803604734 ? 0.674231863072 ? -0.225438154447 ? 0.247305736852 ? -0.373316637976 ? -0.210429409185 ? 13 'X-RAY DIFFRACTION' ? refined 130.524920547 -13.5638847731 164.496229922 1.00313861274 ? -0.0798564079043 ? -0.000180450315506 ? 0.601822915779 ? 0.00908280964759 ? 0.759739828201 ? 6.09040631659 ? -4.10810296958 ? -1.59122868817 ? 4.7025089101 ? -0.529642468775 ? 2.98320321256 ? 0.0405118884892 ? 0.249300089595 ? 0.373799529269 ? 0.67498540321 ? 0.744813375835 ? -0.411320879411 ? -0.574349760503 ? -0.450791863109 ? -0.884105729774 ? 14 'X-RAY DIFFRACTION' ? refined 143.207512768 -12.5335820406 133.299538263 1.59582280074 ? 0.202077371135 ? 0.0994904755945 ? 1.68663536226 ? 0.360022988703 ? 1.08589013234 ? 2.8211764331 ? -0.0566312353458 ? -1.49933366488 ? 6.90890867058 ? 0.539254791942 ? 0.887550452297 ? 0.540542680728 ? -0.141341356218 ? -0.847043700609 ? -0.476738524566 ? 0.115383686332 ? -0.119294254729 ? -0.671820106268 ? 1.11811539386 ? -0.828666788389 ? 15 'X-RAY DIFFRACTION' ? refined 128.583353253 -5.4178147986 119.368185332 1.70696217518 ? 0.894895311156 ? -0.172486931989 ? 2.54838592159 ? 0.268642397106 ? 0.414372027137 ? 4.94002522651 ? 2.23171188177 ? 1.72897291617 ? 2.48066006294 ? 3.5128101707 ? 5.69753734423 ? -0.848447779345 ? -2.53642662199 ? 0.586528611091 ? 0.328524204737 ? -0.323820260573 ? 0.487795171379 ? 1.42887694768 ? -0.115148263353 ? -0.32703607347 ? 16 'X-RAY DIFFRACTION' ? refined 126.15094925 3.37314587959 124.538852744 1.46283332539 ? 0.308389868577 ? -0.162549986269 ? 2.66978273078 ? -0.407310793855 ? 1.02060084697 ? 1.11352880874 ? 1.9320296812 ? -1.43717378129 ? 3.8788287898 ? -1.92450739941 ? 1.72149268228 ? -0.141469627342 ? -1.81467280256 ? 0.151101086016 ? 0.361107365533 ? 0.577306867157 ? -0.106866644131 ? 0.0160768367918 ? -0.159398618987 ? -0.474638960186 ? 17 'X-RAY DIFFRACTION' ? refined 124.149760144 -1.6305502896 124.471530672 1.12794166733 ? 0.261188131846 ? -0.0826927057423 ? 1.68195596605 ? -0.195453519114 ? 0.812018728144 ? 0.962921661514 ? 0.828086233834 ? -0.227795312839 ? 0.764976575785 ? 1.24305881037 ? 5.41091501934 ? 0.309288069553 ? 0.0535254509493 ? 0.118894693892 ? 0.016119351948 ? -0.824882429922 ? 0.236598055632 ? 1.07662846754 ? 0.0984552909022 ? 0.308704629304 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3 through 26 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 27 through 51 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 52 through 96 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 97 through 115 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 116 through 140 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 3 through 26 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 27 through 62 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 63 through 90 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 91 through 122 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 123 through 140 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 3 through 33 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 34 through 96 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 97 through 118 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 4 through 26 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 27 through 51 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 52 through 76 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 77 through 141 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 116 ? ? -108.69 -78.06 2 1 VAL C 28 ? ? -146.57 47.98 3 1 ALA C 32 ? ? -62.37 51.32 4 1 THR C 116 ? ? -136.14 -93.83 5 1 ASP D 27 ? ? 59.09 71.34 6 1 GLU D 29 ? ? -47.05 -73.28 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 48 ? CG ? A LYS 64 CG 2 1 Y 1 A LYS 48 ? CD ? A LYS 64 CD 3 1 Y 1 A LYS 48 ? CE ? A LYS 64 CE 4 1 Y 1 A LYS 48 ? NZ ? A LYS 64 NZ 5 1 Y 1 A LYS 53 ? CG ? A LYS 69 CG 6 1 Y 1 A LYS 53 ? CD ? A LYS 69 CD 7 1 Y 1 A LYS 53 ? CE ? A LYS 69 CE 8 1 Y 1 A LYS 53 ? NZ ? A LYS 69 NZ 9 1 Y 1 A LYS 63 ? CG ? A LYS 79 CG 10 1 Y 1 A LYS 63 ? CD ? A LYS 79 CD 11 1 Y 1 A LYS 63 ? CE ? A LYS 79 CE 12 1 Y 1 A LYS 63 ? NZ ? A LYS 79 NZ 13 1 Y 1 A LYS 71 ? CG ? A LYS 87 CG 14 1 Y 1 A LYS 71 ? CD ? A LYS 87 CD 15 1 Y 1 A LYS 71 ? CE ? A LYS 87 CE 16 1 Y 1 A LYS 71 ? NZ ? A LYS 87 NZ 17 1 Y 1 A LYS 75 ? CG ? A LYS 91 CG 18 1 Y 1 A LYS 75 ? CD ? A LYS 91 CD 19 1 Y 1 A LYS 75 ? CE ? A LYS 91 CE 20 1 Y 1 A LYS 75 ? NZ ? A LYS 91 NZ 21 1 Y 1 A LYS 85 ? CG ? A LYS 101 CG 22 1 Y 1 A LYS 85 ? CD ? A LYS 101 CD 23 1 Y 1 A LYS 85 ? CE ? A LYS 101 CE 24 1 Y 1 A LYS 85 ? NZ ? A LYS 101 NZ 25 1 Y 1 A LYS 88 ? CG ? A LYS 104 CG 26 1 Y 1 A LYS 88 ? CD ? A LYS 104 CD 27 1 Y 1 A LYS 88 ? CE ? A LYS 104 CE 28 1 Y 1 A LYS 88 ? NZ ? A LYS 104 NZ 29 1 Y 1 A LYS 100 ? CE ? A LYS 116 CE 30 1 Y 1 A LYS 100 ? NZ ? A LYS 116 NZ 31 1 Y 1 A GLN 101 ? CG ? A GLN 117 CG 32 1 Y 1 A GLN 101 ? CD ? A GLN 117 CD 33 1 Y 1 A GLN 101 ? OE1 ? A GLN 117 OE1 34 1 Y 1 A GLN 101 ? NE2 ? A GLN 117 NE2 35 1 Y 1 A LYS 112 ? CG ? A LYS 128 CG 36 1 Y 1 A LYS 112 ? CD ? A LYS 128 CD 37 1 Y 1 A LYS 112 ? CE ? A LYS 128 CE 38 1 Y 1 A LYS 112 ? NZ ? A LYS 128 NZ 39 1 Y 1 A LYS 123 ? CG ? A LYS 139 CG 40 1 Y 1 A LYS 123 ? CD ? A LYS 139 CD 41 1 Y 1 A LYS 123 ? CE ? A LYS 139 CE 42 1 Y 1 A LYS 123 ? NZ ? A LYS 139 NZ 43 1 Y 1 A GLU 124 ? CG ? A GLU 140 CG 44 1 Y 1 A GLU 124 ? CD ? A GLU 140 CD 45 1 Y 1 A GLU 124 ? OE1 ? A GLU 140 OE1 46 1 Y 1 A GLU 124 ? OE2 ? A GLU 140 OE2 47 1 Y 1 A ARG 127 ? CG ? A ARG 143 CG 48 1 Y 1 A ARG 127 ? CD ? A ARG 143 CD 49 1 Y 1 A ARG 127 ? NE ? A ARG 143 NE 50 1 Y 1 A ARG 127 ? CZ ? A ARG 143 CZ 51 1 Y 1 A ARG 127 ? NH1 ? A ARG 143 NH1 52 1 Y 1 A ARG 127 ? NH2 ? A ARG 143 NH2 53 1 Y 1 A LYS 131 ? CG ? A LYS 147 CG 54 1 Y 1 A LYS 131 ? CD ? A LYS 147 CD 55 1 Y 1 A LYS 131 ? CE ? A LYS 147 CE 56 1 Y 1 A LYS 131 ? NZ ? A LYS 147 NZ 57 1 Y 1 A ARG 134 ? CG ? A ARG 150 CG 58 1 Y 1 A ARG 134 ? CD ? A ARG 150 CD 59 1 Y 1 A ARG 134 ? NE ? A ARG 150 NE 60 1 Y 1 A ARG 134 ? CZ ? A ARG 150 CZ 61 1 Y 1 A ARG 134 ? NH1 ? A ARG 150 NH1 62 1 Y 1 A ARG 134 ? NH2 ? A ARG 150 NH2 63 1 Y 1 A LYS 138 ? CE ? A LYS 154 CE 64 1 Y 1 A LYS 138 ? NZ ? A LYS 154 NZ 65 1 Y 1 B LYS 17 ? CG ? B LYS 33 CG 66 1 Y 1 B LYS 17 ? CD ? B LYS 33 CD 67 1 Y 1 B LYS 17 ? CE ? B LYS 33 CE 68 1 Y 1 B LYS 17 ? NZ ? B LYS 33 NZ 69 1 Y 1 B HIS 30 ? CG ? B HIS 46 CG 70 1 Y 1 B HIS 30 ? ND1 ? B HIS 46 ND1 71 1 Y 1 B HIS 30 ? CD2 ? B HIS 46 CD2 72 1 Y 1 B HIS 30 ? CE1 ? B HIS 46 CE1 73 1 Y 1 B HIS 30 ? NE2 ? B HIS 46 NE2 74 1 Y 1 B LYS 53 ? CG ? B LYS 69 CG 75 1 Y 1 B LYS 53 ? CD ? B LYS 69 CD 76 1 Y 1 B LYS 53 ? CE ? B LYS 69 CE 77 1 Y 1 B LYS 53 ? NZ ? B LYS 69 NZ 78 1 Y 1 B GLU 57 ? CG ? B GLU 73 CG 79 1 Y 1 B GLU 57 ? CD ? B GLU 73 CD 80 1 Y 1 B GLU 57 ? OE1 ? B GLU 73 OE1 81 1 Y 1 B GLU 57 ? OE2 ? B GLU 73 OE2 82 1 Y 1 B LYS 63 ? CG ? B LYS 79 CG 83 1 Y 1 B LYS 63 ? CD ? B LYS 79 CD 84 1 Y 1 B LYS 63 ? CE ? B LYS 79 CE 85 1 Y 1 B LYS 63 ? NZ ? B LYS 79 NZ 86 1 Y 1 B LYS 71 ? CG ? B LYS 87 CG 87 1 Y 1 B LYS 71 ? CD ? B LYS 87 CD 88 1 Y 1 B LYS 71 ? CE ? B LYS 87 CE 89 1 Y 1 B LYS 71 ? NZ ? B LYS 87 NZ 90 1 Y 1 B ARG 72 ? CG ? B ARG 88 CG 91 1 Y 1 B ARG 72 ? CD ? B ARG 88 CD 92 1 Y 1 B ARG 72 ? NE ? B ARG 88 NE 93 1 Y 1 B ARG 72 ? CZ ? B ARG 88 CZ 94 1 Y 1 B ARG 72 ? NH1 ? B ARG 88 NH1 95 1 Y 1 B ARG 72 ? NH2 ? B ARG 88 NH2 96 1 Y 1 B LYS 88 ? CG ? B LYS 104 CG 97 1 Y 1 B LYS 88 ? CD ? B LYS 104 CD 98 1 Y 1 B LYS 88 ? CE ? B LYS 104 CE 99 1 Y 1 B LYS 88 ? NZ ? B LYS 104 NZ 100 1 Y 1 B ARG 89 ? CG ? B ARG 105 CG 101 1 Y 1 B ARG 89 ? CD ? B ARG 105 CD 102 1 Y 1 B ARG 89 ? NE ? B ARG 105 NE 103 1 Y 1 B ARG 89 ? CZ ? B ARG 105 CZ 104 1 Y 1 B ARG 89 ? NH1 ? B ARG 105 NH1 105 1 Y 1 B ARG 89 ? NH2 ? B ARG 105 NH2 106 1 Y 1 B LYS 123 ? CG ? B LYS 139 CG 107 1 Y 1 B LYS 123 ? CD ? B LYS 139 CD 108 1 Y 1 B LYS 123 ? CE ? B LYS 139 CE 109 1 Y 1 B LYS 123 ? NZ ? B LYS 139 NZ 110 1 Y 1 B GLU 124 ? CG ? B GLU 140 CG 111 1 Y 1 B GLU 124 ? CD ? B GLU 140 CD 112 1 Y 1 B GLU 124 ? OE1 ? B GLU 140 OE1 113 1 Y 1 B GLU 124 ? OE2 ? B GLU 140 OE2 114 1 Y 1 B ARG 127 ? CG ? B ARG 143 CG 115 1 Y 1 B ARG 127 ? CD ? B ARG 143 CD 116 1 Y 1 B ARG 127 ? NE ? B ARG 143 NE 117 1 Y 1 B ARG 127 ? CZ ? B ARG 143 CZ 118 1 Y 1 B ARG 127 ? NH1 ? B ARG 143 NH1 119 1 Y 1 B ARG 127 ? NH2 ? B ARG 143 NH2 120 1 Y 1 B ARG 134 ? CG ? B ARG 150 CG 121 1 Y 1 B ARG 134 ? CD ? B ARG 150 CD 122 1 Y 1 B ARG 134 ? NE ? B ARG 150 NE 123 1 Y 1 B ARG 134 ? CZ ? B ARG 150 CZ 124 1 Y 1 B ARG 134 ? NH1 ? B ARG 150 NH1 125 1 Y 1 B ARG 134 ? NH2 ? B ARG 150 NH2 126 1 Y 1 B LYS 138 ? CG ? B LYS 154 CG 127 1 Y 1 B LYS 138 ? CD ? B LYS 154 CD 128 1 Y 1 B LYS 138 ? CE ? B LYS 154 CE 129 1 Y 1 B LYS 138 ? NZ ? B LYS 154 NZ 130 1 Y 1 C GLN 6 ? CG ? C GLN 22 CG 131 1 Y 1 C GLN 6 ? CD ? C GLN 22 CD 132 1 Y 1 C GLN 6 ? OE1 ? C GLN 22 OE1 133 1 Y 1 C GLN 6 ? NE2 ? C GLN 22 NE2 134 1 Y 1 C LYS 7 ? CG ? C LYS 23 CG 135 1 Y 1 C LYS 7 ? CD ? C LYS 23 CD 136 1 Y 1 C LYS 7 ? CE ? C LYS 23 CE 137 1 Y 1 C LYS 7 ? NZ ? C LYS 23 NZ 138 1 Y 1 C ARG 9 ? NE ? C ARG 25 NE 139 1 Y 1 C ARG 9 ? CZ ? C ARG 25 CZ 140 1 Y 1 C ARG 9 ? NH1 ? C ARG 25 NH1 141 1 Y 1 C ARG 9 ? NH2 ? C ARG 25 NH2 142 1 Y 1 C ILE 10 ? CG1 ? C ILE 26 CG1 143 1 Y 1 C ILE 10 ? CG2 ? C ILE 26 CG2 144 1 Y 1 C ILE 10 ? CD1 ? C ILE 26 CD1 145 1 Y 1 C ASN 13 ? CG ? C ASN 29 CG 146 1 Y 1 C ASN 13 ? OD1 ? C ASN 29 OD1 147 1 Y 1 C ASN 13 ? ND2 ? C ASN 29 ND2 148 1 Y 1 C GLN 14 ? CG ? C GLN 30 CG 149 1 Y 1 C GLN 14 ? CD ? C GLN 30 CD 150 1 Y 1 C GLN 14 ? OE1 ? C GLN 30 OE1 151 1 Y 1 C GLN 14 ? NE2 ? C GLN 30 NE2 152 1 Y 1 C GLU 16 ? CG ? C GLU 32 CG 153 1 Y 1 C GLU 16 ? CD ? C GLU 32 CD 154 1 Y 1 C GLU 16 ? OE1 ? C GLU 32 OE1 155 1 Y 1 C GLU 16 ? OE2 ? C GLU 32 OE2 156 1 Y 1 C LYS 17 ? CG ? C LYS 33 CG 157 1 Y 1 C LYS 17 ? CD ? C LYS 33 CD 158 1 Y 1 C LYS 17 ? CE ? C LYS 33 CE 159 1 Y 1 C LYS 17 ? NZ ? C LYS 33 NZ 160 1 Y 1 C LYS 24 ? CG ? C LYS 40 CG 161 1 Y 1 C LYS 24 ? CD ? C LYS 40 CD 162 1 Y 1 C LYS 24 ? CE ? C LYS 40 CE 163 1 Y 1 C LYS 24 ? NZ ? C LYS 40 NZ 164 1 Y 1 C LYS 48 ? CG ? C LYS 64 CG 165 1 Y 1 C LYS 48 ? CD ? C LYS 64 CD 166 1 Y 1 C LYS 48 ? CE ? C LYS 64 CE 167 1 Y 1 C LYS 48 ? NZ ? C LYS 64 NZ 168 1 Y 1 C LYS 53 ? CG ? C LYS 69 CG 169 1 Y 1 C LYS 53 ? CD ? C LYS 69 CD 170 1 Y 1 C LYS 53 ? CE ? C LYS 69 CE 171 1 Y 1 C LYS 53 ? NZ ? C LYS 69 NZ 172 1 Y 1 C GLU 57 ? CG ? C GLU 73 CG 173 1 Y 1 C GLU 57 ? CD ? C GLU 73 CD 174 1 Y 1 C GLU 57 ? OE1 ? C GLU 73 OE1 175 1 Y 1 C GLU 57 ? OE2 ? C GLU 73 OE2 176 1 Y 1 C LYS 63 ? CG ? C LYS 79 CG 177 1 Y 1 C LYS 63 ? CD ? C LYS 79 CD 178 1 Y 1 C LYS 63 ? CE ? C LYS 79 CE 179 1 Y 1 C LYS 63 ? NZ ? C LYS 79 NZ 180 1 Y 1 C LYS 71 ? CG ? C LYS 87 CG 181 1 Y 1 C LYS 71 ? CD ? C LYS 87 CD 182 1 Y 1 C LYS 71 ? CE ? C LYS 87 CE 183 1 Y 1 C LYS 71 ? NZ ? C LYS 87 NZ 184 1 Y 1 C LYS 85 ? CE ? C LYS 101 CE 185 1 Y 1 C LYS 85 ? NZ ? C LYS 101 NZ 186 1 Y 1 C ARG 89 ? CG ? C ARG 105 CG 187 1 Y 1 C ARG 89 ? CD ? C ARG 105 CD 188 1 Y 1 C ARG 89 ? NE ? C ARG 105 NE 189 1 Y 1 C ARG 89 ? CZ ? C ARG 105 CZ 190 1 Y 1 C ARG 89 ? NH1 ? C ARG 105 NH1 191 1 Y 1 C ARG 89 ? NH2 ? C ARG 105 NH2 192 1 Y 1 D PRO 4 ? CG ? D PRO 20 CG 193 1 Y 1 D PRO 4 ? CD ? D PRO 20 CD 194 1 Y 1 D LEU 5 ? CG ? D LEU 21 CG 195 1 Y 1 D LEU 5 ? CD1 ? D LEU 21 CD1 196 1 Y 1 D LEU 5 ? CD2 ? D LEU 21 CD2 197 1 Y 1 D GLN 6 ? CG ? D GLN 22 CG 198 1 Y 1 D GLN 6 ? CD ? D GLN 22 CD 199 1 Y 1 D GLN 6 ? OE1 ? D GLN 22 OE1 200 1 Y 1 D GLN 6 ? NE2 ? D GLN 22 NE2 201 1 Y 1 D LYS 7 ? CG ? D LYS 23 CG 202 1 Y 1 D LYS 7 ? CD ? D LYS 23 CD 203 1 Y 1 D LYS 7 ? CE ? D LYS 23 CE 204 1 Y 1 D LYS 7 ? NZ ? D LYS 23 NZ 205 1 Y 1 D ARG 9 ? CG ? D ARG 25 CG 206 1 Y 1 D ARG 9 ? CD ? D ARG 25 CD 207 1 Y 1 D ARG 9 ? NE ? D ARG 25 NE 208 1 Y 1 D ARG 9 ? CZ ? D ARG 25 CZ 209 1 Y 1 D ARG 9 ? NH1 ? D ARG 25 NH1 210 1 Y 1 D ARG 9 ? NH2 ? D ARG 25 NH2 211 1 Y 1 D ILE 10 ? CG1 ? D ILE 26 CG1 212 1 Y 1 D ILE 10 ? CG2 ? D ILE 26 CG2 213 1 Y 1 D ILE 10 ? CD1 ? D ILE 26 CD1 214 1 Y 1 D VAL 12 ? CG1 ? D VAL 28 CG1 215 1 Y 1 D VAL 12 ? CG2 ? D VAL 28 CG2 216 1 Y 1 D ASN 13 ? CG ? D ASN 29 CG 217 1 Y 1 D ASN 13 ? OD1 ? D ASN 29 OD1 218 1 Y 1 D ASN 13 ? ND2 ? D ASN 29 ND2 219 1 Y 1 D GLN 14 ? CG ? D GLN 30 CG 220 1 Y 1 D GLN 14 ? CD ? D GLN 30 CD 221 1 Y 1 D GLN 14 ? OE1 ? D GLN 30 OE1 222 1 Y 1 D GLN 14 ? NE2 ? D GLN 30 NE2 223 1 Y 1 D LEU 15 ? CG ? D LEU 31 CG 224 1 Y 1 D LEU 15 ? CD1 ? D LEU 31 CD1 225 1 Y 1 D LEU 15 ? CD2 ? D LEU 31 CD2 226 1 Y 1 D GLU 16 ? CG ? D GLU 32 CG 227 1 Y 1 D GLU 16 ? CD ? D GLU 32 CD 228 1 Y 1 D GLU 16 ? OE1 ? D GLU 32 OE1 229 1 Y 1 D GLU 16 ? OE2 ? D GLU 32 OE2 230 1 Y 1 D LYS 17 ? CG ? D LYS 33 CG 231 1 Y 1 D LYS 17 ? CD ? D LYS 33 CD 232 1 Y 1 D LYS 17 ? CE ? D LYS 33 CE 233 1 Y 1 D LYS 17 ? NZ ? D LYS 33 NZ 234 1 Y 1 D TYR 18 ? CG ? D TYR 34 CG 235 1 Y 1 D TYR 18 ? CD1 ? D TYR 34 CD1 236 1 Y 1 D TYR 18 ? CD2 ? D TYR 34 CD2 237 1 Y 1 D TYR 18 ? CE1 ? D TYR 34 CE1 238 1 Y 1 D TYR 18 ? CE2 ? D TYR 34 CE2 239 1 Y 1 D TYR 18 ? CZ ? D TYR 34 CZ 240 1 Y 1 D TYR 18 ? OH ? D TYR 34 OH 241 1 Y 1 D ARG 21 ? CG ? D ARG 37 CG 242 1 Y 1 D ARG 21 ? CD ? D ARG 37 CD 243 1 Y 1 D ARG 21 ? NE ? D ARG 37 NE 244 1 Y 1 D ARG 21 ? CZ ? D ARG 37 CZ 245 1 Y 1 D ARG 21 ? NH1 ? D ARG 37 NH1 246 1 Y 1 D ARG 21 ? NH2 ? D ARG 37 NH2 247 1 Y 1 D TYR 22 ? CG ? D TYR 38 CG 248 1 Y 1 D TYR 22 ? CD1 ? D TYR 38 CD1 249 1 Y 1 D TYR 22 ? CD2 ? D TYR 38 CD2 250 1 Y 1 D TYR 22 ? CE1 ? D TYR 38 CE1 251 1 Y 1 D TYR 22 ? CE2 ? D TYR 38 CE2 252 1 Y 1 D TYR 22 ? CZ ? D TYR 38 CZ 253 1 Y 1 D TYR 22 ? OH ? D TYR 38 OH 254 1 Y 1 D LYS 24 ? CG ? D LYS 40 CG 255 1 Y 1 D LYS 24 ? CD ? D LYS 40 CD 256 1 Y 1 D LYS 24 ? CE ? D LYS 40 CE 257 1 Y 1 D LYS 24 ? NZ ? D LYS 40 NZ 258 1 Y 1 D GLU 25 ? CG ? D GLU 41 CG 259 1 Y 1 D GLU 25 ? CD ? D GLU 41 CD 260 1 Y 1 D GLU 25 ? OE1 ? D GLU 41 OE1 261 1 Y 1 D GLU 25 ? OE2 ? D GLU 41 OE2 262 1 Y 1 D GLU 29 ? CG ? D GLU 45 CG 263 1 Y 1 D GLU 29 ? CD ? D GLU 45 CD 264 1 Y 1 D GLU 29 ? OE1 ? D GLU 45 OE1 265 1 Y 1 D GLU 29 ? OE2 ? D GLU 45 OE2 266 1 Y 1 D HIS 30 ? CG ? D HIS 46 CG 267 1 Y 1 D HIS 30 ? ND1 ? D HIS 46 ND1 268 1 Y 1 D HIS 30 ? CD2 ? D HIS 46 CD2 269 1 Y 1 D HIS 30 ? CE1 ? D HIS 46 CE1 270 1 Y 1 D HIS 30 ? NE2 ? D HIS 46 NE2 271 1 Y 1 D HIS 37 ? CG ? D HIS 53 CG 272 1 Y 1 D HIS 37 ? ND1 ? D HIS 53 ND1 273 1 Y 1 D HIS 37 ? CD2 ? D HIS 53 CD2 274 1 Y 1 D HIS 37 ? CE1 ? D HIS 53 CE1 275 1 Y 1 D HIS 37 ? NE2 ? D HIS 53 NE2 276 1 Y 1 D MET 40 ? CG ? D MET 56 CG 277 1 Y 1 D MET 40 ? SD ? D MET 56 SD 278 1 Y 1 D MET 40 ? CE ? D MET 56 CE 279 1 Y 1 D ASP 47 ? CG ? D ASP 63 CG 280 1 Y 1 D ASP 47 ? OD1 ? D ASP 63 OD1 281 1 Y 1 D ASP 47 ? OD2 ? D ASP 63 OD2 282 1 Y 1 D LYS 48 ? CG ? D LYS 64 CG 283 1 Y 1 D LYS 48 ? CD ? D LYS 64 CD 284 1 Y 1 D LYS 48 ? CE ? D LYS 64 CE 285 1 Y 1 D LYS 48 ? NZ ? D LYS 64 NZ 286 1 Y 1 D SER 51 ? OG ? D SER 67 OG 287 1 Y 1 D LYS 53 ? CG ? D LYS 69 CG 288 1 Y 1 D LYS 53 ? CD ? D LYS 69 CD 289 1 Y 1 D LYS 53 ? CE ? D LYS 69 CE 290 1 Y 1 D LYS 53 ? NZ ? D LYS 69 NZ 291 1 Y 1 D ASP 54 ? CG ? D ASP 70 CG 292 1 Y 1 D ASP 54 ? OD1 ? D ASP 70 OD1 293 1 Y 1 D ASP 54 ? OD2 ? D ASP 70 OD2 294 1 Y 1 D GLU 56 ? CG ? D GLU 72 CG 295 1 Y 1 D GLU 56 ? CD ? D GLU 72 CD 296 1 Y 1 D GLU 56 ? OE1 ? D GLU 72 OE1 297 1 Y 1 D GLU 56 ? OE2 ? D GLU 72 OE2 298 1 Y 1 D GLU 57 ? CG ? D GLU 73 CG 299 1 Y 1 D GLU 57 ? CD ? D GLU 73 CD 300 1 Y 1 D GLU 57 ? OE1 ? D GLU 73 OE1 301 1 Y 1 D GLU 57 ? OE2 ? D GLU 73 OE2 302 1 Y 1 D ILE 58 ? CG1 ? D ILE 74 CG1 303 1 Y 1 D ILE 58 ? CG2 ? D ILE 74 CG2 304 1 Y 1 D ILE 58 ? CD1 ? D ILE 74 CD1 305 1 Y 1 D LEU 59 ? CG ? D LEU 75 CG 306 1 Y 1 D LEU 59 ? CD1 ? D LEU 75 CD1 307 1 Y 1 D LEU 59 ? CD2 ? D LEU 75 CD2 308 1 Y 1 D ILE 61 ? CG1 ? D ILE 77 CG1 309 1 Y 1 D ILE 61 ? CG2 ? D ILE 77 CG2 310 1 Y 1 D ILE 61 ? CD1 ? D ILE 77 CD1 311 1 Y 1 D SER 62 ? OG ? D SER 78 OG 312 1 Y 1 D LYS 63 ? CG ? D LYS 79 CG 313 1 Y 1 D LYS 63 ? CD ? D LYS 79 CD 314 1 Y 1 D LYS 63 ? CE ? D LYS 79 CE 315 1 Y 1 D LYS 63 ? NZ ? D LYS 79 NZ 316 1 Y 1 D SER 64 ? OG ? D SER 80 OG 317 1 Y 1 D VAL 65 ? CG1 ? D VAL 81 CG1 318 1 Y 1 D VAL 65 ? CG2 ? D VAL 81 CG2 319 1 Y 1 D SER 67 ? OG ? D SER 83 OG 320 1 Y 1 D LYS 71 ? CG ? D LYS 87 CG 321 1 Y 1 D LYS 71 ? CD ? D LYS 87 CD 322 1 Y 1 D LYS 71 ? CE ? D LYS 87 CE 323 1 Y 1 D LYS 71 ? NZ ? D LYS 87 NZ 324 1 Y 1 D GLU 74 ? CG ? D GLU 90 CG 325 1 Y 1 D GLU 74 ? CD ? D GLU 90 CD 326 1 Y 1 D GLU 74 ? OE1 ? D GLU 90 OE1 327 1 Y 1 D GLU 74 ? OE2 ? D GLU 90 OE2 328 1 Y 1 D LYS 75 ? CG ? D LYS 91 CG 329 1 Y 1 D LYS 75 ? CD ? D LYS 91 CD 330 1 Y 1 D LYS 75 ? CE ? D LYS 91 CE 331 1 Y 1 D LYS 75 ? NZ ? D LYS 91 NZ 332 1 Y 1 D ILE 79 ? CG1 ? D ILE 95 CG1 333 1 Y 1 D ILE 79 ? CG2 ? D ILE 95 CG2 334 1 Y 1 D ILE 79 ? CD1 ? D ILE 95 CD1 335 1 Y 1 D ILE 81 ? CG1 ? D ILE 97 CG1 336 1 Y 1 D ILE 81 ? CG2 ? D ILE 97 CG2 337 1 Y 1 D ILE 81 ? CD1 ? D ILE 97 CD1 338 1 Y 1 D VAL 82 ? CG1 ? D VAL 98 CG1 339 1 Y 1 D VAL 82 ? CG2 ? D VAL 98 CG2 340 1 Y 1 D SER 84 ? OG ? D SER 100 OG 341 1 Y 1 D ASP 87 ? CG ? D ASP 103 CG 342 1 Y 1 D ASP 87 ? OD1 ? D ASP 103 OD1 343 1 Y 1 D ASP 87 ? OD2 ? D ASP 103 OD2 344 1 Y 1 D LYS 88 ? CG ? D LYS 104 CG 345 1 Y 1 D LYS 88 ? CD ? D LYS 104 CD 346 1 Y 1 D LYS 88 ? CE ? D LYS 104 CE 347 1 Y 1 D LYS 88 ? NZ ? D LYS 104 NZ 348 1 Y 1 D ARG 89 ? CG ? D ARG 105 CG 349 1 Y 1 D ARG 89 ? CD ? D ARG 105 CD 350 1 Y 1 D ARG 89 ? NE ? D ARG 105 NE 351 1 Y 1 D ARG 89 ? CZ ? D ARG 105 CZ 352 1 Y 1 D ARG 89 ? NH1 ? D ARG 105 NH1 353 1 Y 1 D ARG 89 ? NH2 ? D ARG 105 NH2 354 1 Y 1 D VAL 90 ? CG1 ? D VAL 106 CG1 355 1 Y 1 D VAL 90 ? CG2 ? D VAL 106 CG2 356 1 Y 1 D THR 96 ? OG1 ? D THR 112 OG1 357 1 Y 1 D THR 96 ? CG2 ? D THR 112 CG2 358 1 Y 1 D LYS 100 ? CG ? D LYS 116 CG 359 1 Y 1 D LYS 100 ? CD ? D LYS 116 CD 360 1 Y 1 D LYS 100 ? CE ? D LYS 116 CE 361 1 Y 1 D LYS 100 ? NZ ? D LYS 116 NZ 362 1 Y 1 D ARG 127 ? CG ? D ARG 143 CG 363 1 Y 1 D ARG 127 ? CD ? D ARG 143 CD 364 1 Y 1 D ARG 127 ? NE ? D ARG 143 NE 365 1 Y 1 D ARG 127 ? CZ ? D ARG 143 CZ 366 1 Y 1 D ARG 127 ? NH1 ? D ARG 143 NH1 367 1 Y 1 D ARG 127 ? NH2 ? D ARG 143 NH2 368 1 Y 1 D LYS 130 ? CG ? D LYS 146 CG 369 1 Y 1 D LYS 130 ? CD ? D LYS 146 CD 370 1 Y 1 D LYS 130 ? CE ? D LYS 146 CE 371 1 Y 1 D LYS 130 ? NZ ? D LYS 146 NZ 372 1 Y 1 D LYS 131 ? CG ? D LYS 147 CG 373 1 Y 1 D LYS 131 ? CD ? D LYS 147 CD 374 1 Y 1 D LYS 131 ? CE ? D LYS 147 CE 375 1 Y 1 D LYS 131 ? NZ ? D LYS 147 NZ 376 1 Y 1 D ARG 134 ? CG ? D ARG 150 CG 377 1 Y 1 D ARG 134 ? CD ? D ARG 150 CD 378 1 Y 1 D ARG 134 ? NE ? D ARG 150 NE 379 1 Y 1 D ARG 134 ? CZ ? D ARG 150 CZ 380 1 Y 1 D ARG 134 ? NH1 ? D ARG 150 NH1 381 1 Y 1 D ARG 134 ? NH2 ? D ARG 150 NH2 382 1 Y 1 D LYS 138 ? CG ? D LYS 154 CG 383 1 Y 1 D LYS 138 ? CD ? D LYS 154 CD 384 1 Y 1 D LYS 138 ? CE ? D LYS 154 CE 385 1 Y 1 D LYS 138 ? NZ ? D LYS 154 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS -15 ? A HIS 1 2 1 Y 1 A HIS -14 ? A HIS 2 3 1 Y 1 A HIS -13 ? A HIS 3 4 1 Y 1 A HIS -12 ? A HIS 4 5 1 Y 1 A HIS -11 ? A HIS 5 6 1 Y 1 A HIS -10 ? A HIS 6 7 1 Y 1 A SER -9 ? A SER 7 8 1 Y 1 A SER -8 ? A SER 8 9 1 Y 1 A GLY -7 ? A GLY 9 10 1 Y 1 A LEU -6 ? A LEU 10 11 1 Y 1 A VAL -5 ? A VAL 11 12 1 Y 1 A PRO -4 ? A PRO 12 13 1 Y 1 A ARG -3 ? A ARG 13 14 1 Y 1 A GLY -2 ? A GLY 14 15 1 Y 1 A SER -1 ? A SER 15 16 1 Y 1 A HIS 0 ? A HIS 16 17 1 Y 1 A MET 1 ? A MET 17 18 1 Y 1 A GLU 2 ? A GLU 18 19 1 Y 1 A MET 142 ? A MET 158 20 1 Y 1 A GLU 143 ? A GLU 159 21 1 Y 1 A ASP 144 ? A ASP 160 22 1 Y 1 A PHE 145 ? A PHE 161 23 1 Y 1 A ASP 146 ? A ASP 162 24 1 Y 1 B HIS -15 ? B HIS 1 25 1 Y 1 B HIS -14 ? B HIS 2 26 1 Y 1 B HIS -13 ? B HIS 3 27 1 Y 1 B HIS -12 ? B HIS 4 28 1 Y 1 B HIS -11 ? B HIS 5 29 1 Y 1 B HIS -10 ? B HIS 6 30 1 Y 1 B SER -9 ? B SER 7 31 1 Y 1 B SER -8 ? B SER 8 32 1 Y 1 B GLY -7 ? B GLY 9 33 1 Y 1 B LEU -6 ? B LEU 10 34 1 Y 1 B VAL -5 ? B VAL 11 35 1 Y 1 B PRO -4 ? B PRO 12 36 1 Y 1 B ARG -3 ? B ARG 13 37 1 Y 1 B GLY -2 ? B GLY 14 38 1 Y 1 B SER -1 ? B SER 15 39 1 Y 1 B HIS 0 ? B HIS 16 40 1 Y 1 B MET 1 ? B MET 17 41 1 Y 1 B GLU 2 ? B GLU 18 42 1 Y 1 B ALA 141 ? B ALA 157 43 1 Y 1 B MET 142 ? B MET 158 44 1 Y 1 B GLU 143 ? B GLU 159 45 1 Y 1 B ASP 144 ? B ASP 160 46 1 Y 1 B PHE 145 ? B PHE 161 47 1 Y 1 B ASP 146 ? B ASP 162 48 1 Y 1 C HIS -15 ? C HIS 1 49 1 Y 1 C HIS -14 ? C HIS 2 50 1 Y 1 C HIS -13 ? C HIS 3 51 1 Y 1 C HIS -12 ? C HIS 4 52 1 Y 1 C HIS -11 ? C HIS 5 53 1 Y 1 C HIS -10 ? C HIS 6 54 1 Y 1 C SER -9 ? C SER 7 55 1 Y 1 C SER -8 ? C SER 8 56 1 Y 1 C GLY -7 ? C GLY 9 57 1 Y 1 C LEU -6 ? C LEU 10 58 1 Y 1 C VAL -5 ? C VAL 11 59 1 Y 1 C PRO -4 ? C PRO 12 60 1 Y 1 C ARG -3 ? C ARG 13 61 1 Y 1 C GLY -2 ? C GLY 14 62 1 Y 1 C SER -1 ? C SER 15 63 1 Y 1 C HIS 0 ? C HIS 16 64 1 Y 1 C MET 1 ? C MET 17 65 1 Y 1 C GLU 2 ? C GLU 18 66 1 Y 1 C ALA 119 ? C ALA 135 67 1 Y 1 C GLY 120 ? C GLY 136 68 1 Y 1 C ILE 121 ? C ILE 137 69 1 Y 1 C THR 122 ? C THR 138 70 1 Y 1 C LYS 123 ? C LYS 139 71 1 Y 1 C GLU 124 ? C GLU 140 72 1 Y 1 C GLU 125 ? C GLU 141 73 1 Y 1 C ILE 126 ? C ILE 142 74 1 Y 1 C ARG 127 ? C ARG 143 75 1 Y 1 C THR 128 ? C THR 144 76 1 Y 1 C THR 129 ? C THR 145 77 1 Y 1 C LYS 130 ? C LYS 146 78 1 Y 1 C LYS 131 ? C LYS 147 79 1 Y 1 C VAL 132 ? C VAL 148 80 1 Y 1 C ILE 133 ? C ILE 149 81 1 Y 1 C ARG 134 ? C ARG 150 82 1 Y 1 C THR 135 ? C THR 151 83 1 Y 1 C LEU 136 ? C LEU 152 84 1 Y 1 C ALA 137 ? C ALA 153 85 1 Y 1 C LYS 138 ? C LYS 154 86 1 Y 1 C ASN 139 ? C ASN 155 87 1 Y 1 C MET 140 ? C MET 156 88 1 Y 1 C ALA 141 ? C ALA 157 89 1 Y 1 C MET 142 ? C MET 158 90 1 Y 1 C GLU 143 ? C GLU 159 91 1 Y 1 C ASP 144 ? C ASP 160 92 1 Y 1 C PHE 145 ? C PHE 161 93 1 Y 1 C ASP 146 ? C ASP 162 94 1 Y 1 D HIS -15 ? D HIS 1 95 1 Y 1 D HIS -14 ? D HIS 2 96 1 Y 1 D HIS -13 ? D HIS 3 97 1 Y 1 D HIS -12 ? D HIS 4 98 1 Y 1 D HIS -11 ? D HIS 5 99 1 Y 1 D HIS -10 ? D HIS 6 100 1 Y 1 D SER -9 ? D SER 7 101 1 Y 1 D SER -8 ? D SER 8 102 1 Y 1 D GLY -7 ? D GLY 9 103 1 Y 1 D LEU -6 ? D LEU 10 104 1 Y 1 D VAL -5 ? D VAL 11 105 1 Y 1 D PRO -4 ? D PRO 12 106 1 Y 1 D ARG -3 ? D ARG 13 107 1 Y 1 D GLY -2 ? D GLY 14 108 1 Y 1 D SER -1 ? D SER 15 109 1 Y 1 D HIS 0 ? D HIS 16 110 1 Y 1 D MET 1 ? D MET 17 111 1 Y 1 D GLU 2 ? D GLU 18 112 1 Y 1 D ASN 3 ? D ASN 19 113 1 Y 1 D LYS 44 ? D LYS 60 114 1 Y 1 D HIS 45 ? D HIS 61 115 1 Y 1 D PRO 46 ? D PRO 62 116 1 Y 1 D GLN 101 ? D GLN 117 117 1 Y 1 D LYS 102 ? D LYS 118 118 1 Y 1 D ALA 103 ? D ALA 119 119 1 Y 1 D THR 104 ? D THR 120 120 1 Y 1 D GLN 105 ? D GLN 121 121 1 Y 1 D PHE 106 ? D PHE 122 122 1 Y 1 D GLU 107 ? D GLU 123 123 1 Y 1 D ILE 108 ? D ILE 124 124 1 Y 1 D PHE 109 ? D PHE 125 125 1 Y 1 D LEU 110 ? D LEU 126 126 1 Y 1 D GLU 111 ? D GLU 127 127 1 Y 1 D LYS 112 ? D LYS 128 128 1 Y 1 D LEU 113 ? D LEU 129 129 1 Y 1 D HIS 114 ? D HIS 130 130 1 Y 1 D SER 115 ? D SER 131 131 1 Y 1 D THR 116 ? D THR 132 132 1 Y 1 D MET 117 ? D MET 133 133 1 Y 1 D LEU 118 ? D LEU 134 134 1 Y 1 D ALA 119 ? D ALA 135 135 1 Y 1 D GLY 120 ? D GLY 136 136 1 Y 1 D ILE 121 ? D ILE 137 137 1 Y 1 D THR 122 ? D THR 138 138 1 Y 1 D LYS 123 ? D LYS 139 139 1 Y 1 D GLU 124 ? D GLU 140 140 1 Y 1 D GLU 125 ? D GLU 141 141 1 Y 1 D ILE 126 ? D ILE 142 142 1 Y 1 D MET 142 ? D MET 158 143 1 Y 1 D GLU 143 ? D GLU 159 144 1 Y 1 D ASP 144 ? D ASP 160 145 1 Y 1 D PHE 145 ? D PHE 161 146 1 Y 1 D ASP 146 ? D ASP 162 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6LW6 _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 2 homology ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 #