data_7DWH # _entry.id 7DWH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DWH pdb_00007dwh 10.2210/pdb7dwh/pdb WWPDB D_1300020340 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DWH _pdbx_database_status.recvd_initial_deposition_date 2021-01-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jiang, H.Y.' 1 0000-0003-2884-2296 'Gao, Y.Q.' 2 0000-0002-0989-0631 'Chen, D.R.' 3 0000-0001-5145-3163 'Murchie, A.' 4 0000-0002-6746-6054 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Catal' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2520-1158 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 872 _citation.page_last 881 _citation.title 'The identification and characterization of a selected SAM-dependent methyltransferase ribozyme that is present in natural sequences' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41929-021-00685-z _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, H.Y.' 1 ? primary 'Gao, Y.Q.' 2 ? primary 'Zhang, L.' 3 ? primary 'Chen, D.R.' 4 ? primary 'Gan, J.H.' 5 ? primary 'Murchie, A.I.H.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 93.240 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7DWH _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.923 _cell.length_a_esd ? _cell.length_b 77.305 _cell.length_b_esd ? _cell.length_c 101.469 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DWH _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'U1 small nuclear ribonucleoprotein A' 11740.739 4 ? ? ? ? 2 polymer syn 'RNA (45-MER)' 14462.654 2 ? ? ? ? 3 non-polymer syn 'COPPER (II) ION' 63.546 2 ? ? ? ? 4 non-polymer syn S-ADENOSYLMETHIONINE 398.437 2 ? ? ? ? 5 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name U1A # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK PMRIQYAKTDSDIIAKMKGTFV ; ;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK PMRIQYAKTDSDIIAKMKGTFV ; A,B,C,D ? 2 polyribonucleotide no no GGACCUACUACGAGCGCCAUUGCACUCCGGCGCCACGGGGGGUCC GGACCUACUACGAGCGCCAUUGCACUCCGGCGCCACGGGGGGUCC X,Y ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 VAL n 1 4 PRO n 1 5 GLU n 1 6 THR n 1 7 ARG n 1 8 PRO n 1 9 ASN n 1 10 HIS n 1 11 THR n 1 12 ILE n 1 13 TYR n 1 14 ILE n 1 15 ASN n 1 16 ASN n 1 17 LEU n 1 18 ASN n 1 19 GLU n 1 20 LYS n 1 21 ILE n 1 22 LYS n 1 23 LYS n 1 24 ASP n 1 25 GLU n 1 26 LEU n 1 27 LYS n 1 28 LYS n 1 29 SER n 1 30 LEU n 1 31 TYR n 1 32 ALA n 1 33 ILE n 1 34 PHE n 1 35 SER n 1 36 GLN n 1 37 PHE n 1 38 GLY n 1 39 GLN n 1 40 ILE n 1 41 LEU n 1 42 ASP n 1 43 ILE n 1 44 LEU n 1 45 VAL n 1 46 SER n 1 47 ARG n 1 48 SER n 1 49 LEU n 1 50 LYS n 1 51 MET n 1 52 ARG n 1 53 GLY n 1 54 GLN n 1 55 ALA n 1 56 PHE n 1 57 VAL n 1 58 ILE n 1 59 PHE n 1 60 LYS n 1 61 GLU n 1 62 VAL n 1 63 SER n 1 64 SER n 1 65 ALA n 1 66 THR n 1 67 ASN n 1 68 ALA n 1 69 LEU n 1 70 ARG n 1 71 SER n 1 72 MET n 1 73 GLN n 1 74 GLY n 1 75 PHE n 1 76 PRO n 1 77 PHE n 1 78 TYR n 1 79 ASP n 1 80 LYS n 1 81 PRO n 1 82 MET n 1 83 ARG n 1 84 ILE n 1 85 GLN n 1 86 TYR n 1 87 ALA n 1 88 LYS n 1 89 THR n 1 90 ASP n 1 91 SER n 1 92 ASP n 1 93 ILE n 1 94 ILE n 1 95 ALA n 1 96 LYS n 1 97 MET n 1 98 LYS n 1 99 GLY n 1 100 THR n 1 101 PHE n 1 102 VAL n 2 1 G n 2 2 G n 2 3 A n 2 4 C n 2 5 C n 2 6 U n 2 7 A n 2 8 C n 2 9 U n 2 10 A n 2 11 C n 2 12 G n 2 13 A n 2 14 G n 2 15 C n 2 16 G n 2 17 C n 2 18 C n 2 19 A n 2 20 U n 2 21 U n 2 22 G n 2 23 C n 2 24 A n 2 25 C n 2 26 U n 2 27 C n 2 28 C n 2 29 G n 2 30 G n 2 31 C n 2 32 G n 2 33 C n 2 34 C n 2 35 A n 2 36 C n 2 37 G n 2 38 G n 2 39 G n 2 40 G n 2 41 G n 2 42 G n 2 43 U n 2 44 C n 2 45 C n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 102 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SNRPA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 45 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SNRPA_HUMAN P09012 ? 1 ;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK PMRIQYAKTDSDIIAKMKGTFV ; 1 2 PDB 7DWH 7DWH ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7DWH A 1 ? 102 ? P09012 1 ? 102 ? 1 102 2 1 7DWH B 1 ? 102 ? P09012 1 ? 102 ? 1 102 3 1 7DWH C 1 ? 102 ? P09012 1 ? 102 ? 1 102 4 1 7DWH D 1 ? 102 ? P09012 1 ? 102 ? 1 102 5 2 7DWH X 1 ? 45 ? 7DWH 1 ? 45 ? 1 45 6 2 7DWH Y 1 ? 45 ? 7DWH 1 ? 45 ? 1 45 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAM non-polymer . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DWH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'sodium phosphate monobasic monohydrate, polyethylene glycol 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-12-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97928 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NFPSS BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97928 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site NFPSS # _reflns.B_iso_Wilson_estimate 62.500 _reflns.entry_id 7DWH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.100 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17380 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.700 _reflns.pdbx_Rmerge_I_obs 0.097 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.963 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.108 _reflns.pdbx_Rpim_I_all 0.045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 81837 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 3.100 3.210 ? ? ? ? ? ? 1595 90.900 ? ? ? ? 0.236 ? ? ? ? ? ? ? ? 2.900 ? 0.822 ? ? 0.278 0.143 ? 1 1 0.937 ? ? 3.210 3.340 ? ? ? ? ? ? 1696 95.300 ? ? ? ? 0.244 ? ? ? ? ? ? ? ? 3.400 ? 0.949 ? ? 0.283 0.140 ? 2 1 0.946 ? ? 3.340 3.490 ? ? ? ? ? ? 1708 97.000 ? ? ? ? 0.225 ? ? ? ? ? ? ? ? 3.800 ? 0.870 ? ? 0.259 0.125 ? 3 1 0.955 ? ? 3.490 3.670 ? ? ? ? ? ? 1719 98.000 ? ? ? ? 0.198 ? ? ? ? ? ? ? ? 4.300 ? 0.929 ? ? 0.223 0.102 ? 4 1 0.973 ? ? 3.670 3.900 ? ? ? ? ? ? 1748 98.800 ? ? ? ? 0.148 ? ? ? ? ? ? ? ? 4.600 ? 0.958 ? ? 0.167 0.074 ? 5 1 0.986 ? ? 3.900 4.210 ? ? ? ? ? ? 1757 98.600 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 4.700 ? 0.969 ? ? 0.124 0.054 ? 6 1 0.993 ? ? 4.210 4.630 ? ? ? ? ? ? 1768 99.600 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 5.600 ? 1.005 ? ? 0.112 0.045 ? 7 1 0.995 ? ? 4.630 5.290 ? ? ? ? ? ? 1779 99.600 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 5.700 ? 0.998 ? ? 0.097 0.039 ? 8 1 0.995 ? ? 5.290 6.660 ? ? ? ? ? ? 1777 99.300 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 5.600 ? 0.967 ? ? 0.090 0.037 ? 9 1 0.992 ? ? 6.660 30.000 ? ? ? ? ? ? 1833 99.700 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 6.300 ? 1.008 ? ? 0.081 0.032 ? 10 1 0.996 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 192.190 _refine.B_iso_mean 72.2129 _refine.B_iso_min 18.820 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DWH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.1000 _refine.ls_d_res_low 29.5340 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14925 _refine.ls_number_reflns_R_free 728 _refine.ls_number_reflns_R_work 14197 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 83.7500 _refine.ls_percent_reflns_R_free 4.8800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2114 _refine.ls_R_factor_R_free 0.2584 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2089 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.500 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7DLZ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.3800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.1000 _refine_hist.d_res_low 29.5340 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 4902 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 464 _refine_hist.pdbx_B_iso_mean_ligand 90.68 _refine_hist.pdbx_B_iso_mean_solvent 27.73 _refine_hist.pdbx_number_atoms_protein 2929 _refine_hist.pdbx_number_atoms_nucleic_acid 1920 _refine_hist.pdbx_number_atoms_ligand 47 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 5176 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.667 ? 7426 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.040 ? 911 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 604 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.391 ? 2923 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? X 1074 12.191 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? Y 1074 12.191 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 3 TORSIONAL ? A 1562 12.191 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 4 TORSIONAL ? B 1562 12.191 ? 2 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 5 TORSIONAL ? C 1562 12.191 ? 2 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 6 TORSIONAL ? D 1562 12.191 ? 2 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.1 3.3389 . . 76 1495 44.0000 . . . 0.3925 0.0000 0.2772 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3389 3.6743 . . 120 2637 78.0000 . . . 0.3290 0.0000 0.2582 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6743 4.2047 . . 189 3255 97.0000 . . . 0.2703 0.0000 0.2029 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2047 5.2925 . . 180 3366 100.0000 . . . 0.2272 0.0000 0.1975 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.2925 29.53 . . 163 3444 99.0000 . . . 0.2281 0.0000 0.1916 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 'chain X' 1 2 'chain Y' 2 1 ;(chain A and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 2 ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 3 ;(chain C and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 4 ;(chain D and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 92)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 E G 1 . E C 45 . X G 1 X C 45 ? 'chain X' 1 2 1 F G 1 . F C 45 . Y G 1 Y C 45 ? 'chain Y' 2 1 1 A PRO 8 . A PRO 8 . A PRO 8 A PRO 8 ? ;(chain A and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 1 2 A ASN 9 . A ASN 9 . A ASN 9 A ASN 9 ? ;(chain A and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 1 3 A THR 6 . A THR 100 . A THR 6 A THR 100 ? ;(chain A and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 1 4 A THR 6 . A THR 100 . A THR 6 A THR 100 ? ;(chain A and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 1 5 A THR 6 . A THR 100 . A THR 6 A THR 100 ? ;(chain A and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 1 6 A THR 6 . A THR 100 . A THR 6 A THR 100 ? ;(chain A and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 2 1 B PRO 8 . B ILE 21 . B PRO 8 B ILE 21 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 2 2 B LYS 22 . B LYS 23 . B LYS 22 B LYS 23 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 2 3 B PRO 8 . B ASP 92 . B PRO 8 B ASP 92 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 2 4 B PRO 8 . B ASP 92 . B PRO 8 B ASP 92 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 2 5 B PRO 8 . B ASP 92 . B PRO 8 B ASP 92 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 2 6 B PRO 8 . B ASP 92 . B PRO 8 B ASP 92 ? ;(chain B and (resid 8 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB )) or resid 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 3 1 C PRO 8 . C PRO 8 . C PRO 8 C PRO 8 ? ;(chain C and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 3 2 C ASN 9 . C ASN 9 . C ASN 9 C ASN 9 ? ;(chain C and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 3 3 C THR 6 . C VAL 102 . C THR 6 C VAL 102 ? ;(chain C and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 3 4 C THR 6 . C VAL 102 . C THR 6 C VAL 102 ? ;(chain C and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 3 5 C THR 6 . C VAL 102 . C THR 6 C VAL 102 ? ;(chain C and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 3 6 C THR 6 . C VAL 102 . C THR 6 C VAL 102 ? ;(chain C and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 21 or (resid 22 through 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 48 or (resid 49 through 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB )) or resid 89 through 92)) ; 2 4 1 D PRO 8 . D PRO 8 . D PRO 8 D PRO 8 ? ;(chain D and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 92)) ; 2 4 2 D ASN 9 . D ASN 9 . D ASN 9 D ASN 9 ? ;(chain D and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 92)) ; 2 4 3 D GLU 5 . D PHE 101 . D GLU 5 D PHE 101 ? ;(chain D and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 92)) ; 2 4 4 D GLU 5 . D PHE 101 . D GLU 5 D PHE 101 ? ;(chain D and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 92)) ; 2 4 5 D GLU 5 . D PHE 101 . D GLU 5 D PHE 101 ? ;(chain D and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 92)) ; 2 4 6 D GLU 5 . D PHE 101 . D GLU 5 D PHE 101 ? ;(chain D and (resid 8 or (resid 9 and (name N or name CA or name C or name O or name CB )) or resid 10 through 22 or (resid 23 and (name N or name CA or name C or name O or name CB )) or resid 24 through 92)) ; # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 7DWH _struct.title 'Complex structure of SAM-dependent methyltransferase ribozyme' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DWH _struct_keywords.text 'Ribozyme, methyltransferase, complex, RNA, TRANSFERASE-RNA complex' _struct_keywords.pdbx_keywords TRANSFERASE/RNA # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 4 ? I N N 3 ? J N N 4 ? K N N 5 ? L N N 5 ? M N N 5 ? N N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 22 ? SER A 35 ? LYS A 22 SER A 35 1 ? 14 HELX_P HELX_P2 AA2 GLN A 36 ? GLY A 38 ? GLN A 36 GLY A 38 5 ? 3 HELX_P HELX_P3 AA3 GLU A 61 ? GLN A 73 ? GLU A 61 GLN A 73 1 ? 13 HELX_P HELX_P4 AA4 SER A 91 ? GLY A 99 ? SER A 91 GLY A 99 1 ? 9 HELX_P HELX_P5 AA5 LYS B 22 ? SER B 35 ? LYS B 22 SER B 35 1 ? 14 HELX_P HELX_P6 AA6 GLN B 36 ? GLY B 38 ? GLN B 36 GLY B 38 5 ? 3 HELX_P HELX_P7 AA7 GLU B 61 ? GLN B 73 ? GLU B 61 GLN B 73 1 ? 13 HELX_P HELX_P8 AA8 LYS C 22 ? SER C 35 ? LYS C 22 SER C 35 1 ? 14 HELX_P HELX_P9 AA9 GLN C 36 ? GLY C 38 ? GLN C 36 GLY C 38 5 ? 3 HELX_P HELX_P10 AB1 GLU C 61 ? GLN C 73 ? GLU C 61 GLN C 73 1 ? 13 HELX_P HELX_P11 AB2 ASP C 90 ? LYS C 98 ? ASP C 90 LYS C 98 1 ? 9 HELX_P HELX_P12 AB3 LYS D 22 ? SER D 35 ? LYS D 22 SER D 35 1 ? 14 HELX_P HELX_P13 AB4 GLN D 36 ? GLY D 38 ? GLN D 36 GLY D 38 5 ? 3 HELX_P HELX_P14 AB5 GLU D 61 ? MET D 72 ? GLU D 61 MET D 72 1 ? 12 HELX_P HELX_P15 AB6 ASP D 90 ? LYS D 98 ? ASP D 90 LYS D 98 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? E G 40 N7 ? ? ? 1_555 G CU . CU ? ? X G 40 X CU 101 1_555 ? ? ? ? ? ? ? 2.267 ? ? metalc2 metalc ? ? G CU . CU ? ? ? 1_555 H SAM . N ? ? X CU 101 X SAM 102 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc3 metalc ? ? G CU . CU ? ? ? 1_555 H SAM . O ? ? X CU 101 X SAM 102 1_555 ? ? ? ? ? ? ? 2.381 ? ? metalc4 metalc ? ? F G 40 O6 ? ? ? 1_555 I CU . CU ? ? Y G 40 Y CU 101 1_555 ? ? ? ? ? ? ? 2.354 ? ? hydrog1 hydrog ? ? E G 1 N1 ? ? ? 1_555 E C 45 N3 ? ? X G 1 X C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? E G 1 N2 ? ? ? 1_555 E C 45 O2 ? ? X G 1 X C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? E G 1 O6 ? ? ? 1_555 E C 45 N4 ? ? X G 1 X C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? E G 2 N1 ? ? ? 1_555 E C 44 N3 ? ? X G 2 X C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? E G 2 N2 ? ? ? 1_555 E C 44 O2 ? ? X G 2 X C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? E G 2 O6 ? ? ? 1_555 E C 44 N4 ? ? X G 2 X C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? E A 3 N1 ? ? ? 1_555 E U 43 N3 ? ? X A 3 X U 43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? E A 3 N6 ? ? ? 1_555 E U 43 O4 ? ? X A 3 X U 43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? E C 4 N4 ? ? ? 1_555 E G 42 O6 ? ? X C 4 X G 42 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? ? hydrog10 hydrog ? ? E C 5 N3 ? ? ? 1_555 E G 41 N1 ? ? X C 5 X G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? E C 5 N4 ? ? ? 1_555 E G 41 O6 ? ? X C 5 X G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog12 hydrog ? ? E C 5 O2 ? ? ? 1_555 E G 41 N2 ? ? X C 5 X G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog13 hydrog ? ? E U 6 N3 ? ? ? 1_555 E G 40 O6 ? ? X U 6 X G 40 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog14 hydrog ? ? E U 6 O2 ? ? ? 1_555 E G 40 N1 ? ? X U 6 X G 40 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog15 hydrog ? ? E C 8 N3 ? ? ? 1_555 E G 39 N1 ? ? X C 8 X G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? E C 8 N4 ? ? ? 1_555 E G 39 O6 ? ? X C 8 X G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? E C 8 O2 ? ? ? 1_555 E G 39 N2 ? ? X C 8 X G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? E U 9 N3 ? ? ? 1_555 E G 38 O6 ? ? X U 9 X G 38 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog19 hydrog ? ? E U 9 O2 ? ? ? 1_555 E G 38 N1 ? ? X U 9 X G 38 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog20 hydrog ? ? E C 11 N3 ? ? ? 1_555 E G 37 N1 ? ? X C 11 X G 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog21 hydrog ? ? E C 11 N4 ? ? ? 1_555 E G 37 O6 ? ? X C 11 X G 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog22 hydrog ? ? E C 11 O2 ? ? ? 1_555 E G 37 N2 ? ? X C 11 X G 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog23 hydrog ? ? E G 12 O6 ? ? ? 1_555 E C 36 N4 ? ? X G 12 X C 36 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? ? hydrog24 hydrog ? ? E A 13 N6 ? ? ? 1_555 E C 34 N3 ? ? X A 13 X C 34 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? ? hydrog25 hydrog ? ? E G 14 N1 ? ? ? 1_555 E C 33 N3 ? ? X G 14 X C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? E G 14 N2 ? ? ? 1_555 E C 33 O2 ? ? X G 14 X C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? E G 14 O6 ? ? ? 1_555 E C 33 N4 ? ? X G 14 X C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? E C 15 N3 ? ? ? 1_555 E G 32 N1 ? ? X C 15 X G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? E C 15 N4 ? ? ? 1_555 E G 32 O6 ? ? X C 15 X G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog30 hydrog ? ? E C 15 O2 ? ? ? 1_555 E G 32 N2 ? ? X C 15 X G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog31 hydrog ? ? E G 16 N1 ? ? ? 1_555 E C 31 N3 ? ? X G 16 X C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? E G 16 N2 ? ? ? 1_555 E C 31 O2 ? ? X G 16 X C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog33 hydrog ? ? E G 16 O6 ? ? ? 1_555 E C 31 N4 ? ? X G 16 X C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog34 hydrog ? ? E C 17 N3 ? ? ? 1_555 E G 30 N1 ? ? X C 17 X G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog35 hydrog ? ? E C 17 N4 ? ? ? 1_555 E G 30 O6 ? ? X C 17 X G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog36 hydrog ? ? E C 17 O2 ? ? ? 1_555 E G 30 N2 ? ? X C 17 X G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog37 hydrog ? ? E C 18 N3 ? ? ? 1_555 E G 29 N1 ? ? X C 18 X G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog38 hydrog ? ? E C 18 N4 ? ? ? 1_555 E G 29 O6 ? ? X C 18 X G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog39 hydrog ? ? E C 18 O2 ? ? ? 1_555 E G 29 N2 ? ? X C 18 X G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog40 hydrog ? ? F G 1 N1 ? ? ? 1_555 F C 45 N3 ? ? Y G 1 Y C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog41 hydrog ? ? F G 1 N2 ? ? ? 1_555 F C 45 O2 ? ? Y G 1 Y C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog42 hydrog ? ? F G 1 O6 ? ? ? 1_555 F C 45 N4 ? ? Y G 1 Y C 45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog43 hydrog ? ? F G 2 N1 ? ? ? 1_555 F C 44 N3 ? ? Y G 2 Y C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog44 hydrog ? ? F G 2 N2 ? ? ? 1_555 F C 44 O2 ? ? Y G 2 Y C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog45 hydrog ? ? F G 2 O6 ? ? ? 1_555 F C 44 N4 ? ? Y G 2 Y C 44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog46 hydrog ? ? F A 3 N1 ? ? ? 1_555 F U 43 N3 ? ? Y A 3 Y U 43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog47 hydrog ? ? F A 3 N6 ? ? ? 1_555 F U 43 O4 ? ? Y A 3 Y U 43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog48 hydrog ? ? F C 4 N4 ? ? ? 1_555 F G 42 O6 ? ? Y C 4 Y G 42 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? ? hydrog49 hydrog ? ? F C 5 N3 ? ? ? 1_555 F G 41 N1 ? ? Y C 5 Y G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog50 hydrog ? ? F C 5 N4 ? ? ? 1_555 F G 41 O6 ? ? Y C 5 Y G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog51 hydrog ? ? F C 5 O2 ? ? ? 1_555 F G 41 N2 ? ? Y C 5 Y G 41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog52 hydrog ? ? F U 6 O2 ? ? ? 1_555 F G 40 N2 ? ? Y U 6 Y G 40 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? ? ? hydrog53 hydrog ? ? F C 8 N3 ? ? ? 1_555 F G 39 N1 ? ? Y C 8 Y G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog54 hydrog ? ? F C 8 N4 ? ? ? 1_555 F G 39 O6 ? ? Y C 8 Y G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog55 hydrog ? ? F C 8 O2 ? ? ? 1_555 F G 39 N2 ? ? Y C 8 Y G 39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog56 hydrog ? ? F U 9 N3 ? ? ? 1_555 F G 38 O6 ? ? Y U 9 Y G 38 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog57 hydrog ? ? F U 9 O2 ? ? ? 1_555 F G 38 N1 ? ? Y U 9 Y G 38 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog58 hydrog ? ? F C 11 N3 ? ? ? 1_555 F G 37 N1 ? ? Y C 11 Y G 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog59 hydrog ? ? F C 11 N4 ? ? ? 1_555 F G 37 O6 ? ? Y C 11 Y G 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog60 hydrog ? ? F C 11 O2 ? ? ? 1_555 F G 37 N2 ? ? Y C 11 Y G 37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog61 hydrog ? ? F G 12 O6 ? ? ? 1_555 F C 36 N4 ? ? Y G 12 Y C 36 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? ? hydrog62 hydrog ? ? F A 13 N6 ? ? ? 1_555 F C 34 N3 ? ? Y A 13 Y C 34 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? ? hydrog63 hydrog ? ? F A 13 N3 ? ? ? 1_555 F A 35 N6 ? ? Y A 13 Y A 35 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? ? ? hydrog64 hydrog ? ? F G 14 N1 ? ? ? 1_555 F C 33 N3 ? ? Y G 14 Y C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog65 hydrog ? ? F G 14 N2 ? ? ? 1_555 F C 33 O2 ? ? Y G 14 Y C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog66 hydrog ? ? F G 14 O6 ? ? ? 1_555 F C 33 N4 ? ? Y G 14 Y C 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog67 hydrog ? ? F C 15 N3 ? ? ? 1_555 F G 32 N1 ? ? Y C 15 Y G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog68 hydrog ? ? F C 15 N4 ? ? ? 1_555 F G 32 O6 ? ? Y C 15 Y G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog69 hydrog ? ? F C 15 O2 ? ? ? 1_555 F G 32 N2 ? ? Y C 15 Y G 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog70 hydrog ? ? F G 16 N1 ? ? ? 1_555 F C 31 N3 ? ? Y G 16 Y C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog71 hydrog ? ? F G 16 N2 ? ? ? 1_555 F C 31 O2 ? ? Y G 16 Y C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog72 hydrog ? ? F G 16 O6 ? ? ? 1_555 F C 31 N4 ? ? Y G 16 Y C 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog73 hydrog ? ? F C 17 N3 ? ? ? 1_555 F G 30 N1 ? ? Y C 17 Y G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog74 hydrog ? ? F C 17 N4 ? ? ? 1_555 F G 30 O6 ? ? Y C 17 Y G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog75 hydrog ? ? F C 17 O2 ? ? ? 1_555 F G 30 N2 ? ? Y C 17 Y G 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog76 hydrog ? ? F C 18 N3 ? ? ? 1_555 F G 29 N1 ? ? Y C 18 Y G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog77 hydrog ? ? F C 18 N4 ? ? ? 1_555 F G 29 O6 ? ? Y C 18 Y G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog78 hydrog ? ? F C 18 O2 ? ? ? 1_555 F G 29 N2 ? ? Y C 18 Y G 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? hydrog ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 2 ? AA5 ? 4 ? AA6 ? 2 ? AA7 ? 4 ? AA8 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA8 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 40 ? VAL A 45 ? ILE A 40 VAL A 45 AA1 2 ALA A 55 ? PHE A 59 ? ALA A 55 PHE A 59 AA1 3 THR A 11 ? ASN A 15 ? THR A 11 ASN A 15 AA1 4 ARG A 83 ? TYR A 86 ? ARG A 83 TYR A 86 AA2 1 PRO A 76 ? PHE A 77 ? PRO A 76 PHE A 77 AA2 2 LYS A 80 ? PRO A 81 ? LYS A 80 PRO A 81 AA3 1 ILE B 40 ? LEU B 44 ? ILE B 40 LEU B 44 AA3 2 GLN B 54 ? PHE B 59 ? GLN B 54 PHE B 59 AA3 3 THR B 11 ? ASN B 15 ? THR B 11 ASN B 15 AA3 4 ARG B 83 ? TYR B 86 ? ARG B 83 TYR B 86 AA4 1 PRO B 76 ? PHE B 77 ? PRO B 76 PHE B 77 AA4 2 LYS B 80 ? PRO B 81 ? LYS B 80 PRO B 81 AA5 1 ILE C 40 ? VAL C 45 ? ILE C 40 VAL C 45 AA5 2 GLN C 54 ? PHE C 59 ? GLN C 54 PHE C 59 AA5 3 THR C 11 ? ASN C 15 ? THR C 11 ASN C 15 AA5 4 ARG C 83 ? TYR C 86 ? ARG C 83 TYR C 86 AA6 1 PRO C 76 ? PHE C 77 ? PRO C 76 PHE C 77 AA6 2 LYS C 80 ? PRO C 81 ? LYS C 80 PRO C 81 AA7 1 ILE D 40 ? VAL D 45 ? ILE D 40 VAL D 45 AA7 2 GLN D 54 ? PHE D 59 ? GLN D 54 PHE D 59 AA7 3 THR D 11 ? ASN D 15 ? THR D 11 ASN D 15 AA7 4 ARG D 83 ? TYR D 86 ? ARG D 83 TYR D 86 AA8 1 PRO D 76 ? PHE D 77 ? PRO D 76 PHE D 77 AA8 2 LYS D 80 ? PRO D 81 ? LYS D 80 PRO D 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 41 ? N LEU A 41 O ILE A 58 ? O ILE A 58 AA1 2 3 O ALA A 55 ? O ALA A 55 N ILE A 14 ? N ILE A 14 AA1 3 4 N TYR A 13 ? N TYR A 13 O GLN A 85 ? O GLN A 85 AA2 1 2 N PHE A 77 ? N PHE A 77 O LYS A 80 ? O LYS A 80 AA3 1 2 N LEU B 41 ? N LEU B 41 O ILE B 58 ? O ILE B 58 AA3 2 3 O ALA B 55 ? O ALA B 55 N ILE B 14 ? N ILE B 14 AA3 3 4 N TYR B 13 ? N TYR B 13 O GLN B 85 ? O GLN B 85 AA4 1 2 N PHE B 77 ? N PHE B 77 O LYS B 80 ? O LYS B 80 AA5 1 2 N LEU C 44 ? N LEU C 44 O PHE C 56 ? O PHE C 56 AA5 2 3 O ALA C 55 ? O ALA C 55 N ILE C 14 ? N ILE C 14 AA5 3 4 N TYR C 13 ? N TYR C 13 O GLN C 85 ? O GLN C 85 AA6 1 2 N PHE C 77 ? N PHE C 77 O LYS C 80 ? O LYS C 80 AA7 1 2 N LEU D 44 ? N LEU D 44 O PHE D 56 ? O PHE D 56 AA7 2 3 O ALA D 55 ? O ALA D 55 N ILE D 14 ? N ILE D 14 AA7 3 4 N TYR D 13 ? N TYR D 13 O GLN D 85 ? O GLN D 85 AA8 1 2 N PHE D 77 ? N PHE D 77 O LYS D 80 ? O LYS D 80 # _atom_sites.entry_id 7DWH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015892 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000899 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012936 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009871 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CU N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 PHE 101 101 ? ? ? A . n A 1 102 VAL 102 102 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ALA 2 2 ? ? ? B . n B 1 3 VAL 3 3 ? ? ? B . n B 1 4 PRO 4 4 ? ? ? B . n B 1 5 GLU 5 5 ? ? ? B . n B 1 6 THR 6 6 ? ? ? B . n B 1 7 ARG 7 7 ? ? ? B . n B 1 8 PRO 8 8 8 PRO PRO B . n B 1 9 ASN 9 9 9 ASN ASN B . n B 1 10 HIS 10 10 10 HIS HIS B . n B 1 11 THR 11 11 11 THR THR B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 TYR 13 13 13 TYR TYR B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 ASN 15 15 15 ASN ASN B . n B 1 16 ASN 16 16 16 ASN ASN B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 ASN 18 18 18 ASN ASN B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 ILE 21 21 21 ILE ILE B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 ASP 24 24 24 ASP ASP B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 SER 29 29 29 SER SER B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 TYR 31 31 31 TYR TYR B . n B 1 32 ALA 32 32 32 ALA ALA B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 GLN 36 36 36 GLN GLN B . n B 1 37 PHE 37 37 37 PHE PHE B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 GLN 39 39 39 GLN GLN B . n B 1 40 ILE 40 40 40 ILE ILE B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 ASP 42 42 42 ASP ASP B . n B 1 43 ILE 43 43 43 ILE ILE B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 SER 46 46 46 SER SER B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 SER 48 48 48 SER SER B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 MET 51 51 51 MET MET B . n B 1 52 ARG 52 52 52 ARG ARG B . n B 1 53 GLY 53 53 53 GLY GLY B . n B 1 54 GLN 54 54 54 GLN GLN B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 PHE 56 56 56 PHE PHE B . n B 1 57 VAL 57 57 57 VAL VAL B . n B 1 58 ILE 58 58 58 ILE ILE B . n B 1 59 PHE 59 59 59 PHE PHE B . n B 1 60 LYS 60 60 60 LYS LYS B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 VAL 62 62 62 VAL VAL B . n B 1 63 SER 63 63 63 SER SER B . n B 1 64 SER 64 64 64 SER SER B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 THR 66 66 66 THR THR B . n B 1 67 ASN 67 67 67 ASN ASN B . n B 1 68 ALA 68 68 68 ALA ALA B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 ARG 70 70 70 ARG ARG B . n B 1 71 SER 71 71 71 SER SER B . n B 1 72 MET 72 72 72 MET MET B . n B 1 73 GLN 73 73 73 GLN GLN B . n B 1 74 GLY 74 74 74 GLY GLY B . n B 1 75 PHE 75 75 75 PHE PHE B . n B 1 76 PRO 76 76 76 PRO PRO B . n B 1 77 PHE 77 77 77 PHE PHE B . n B 1 78 TYR 78 78 78 TYR TYR B . n B 1 79 ASP 79 79 79 ASP ASP B . n B 1 80 LYS 80 80 80 LYS LYS B . n B 1 81 PRO 81 81 81 PRO PRO B . n B 1 82 MET 82 82 82 MET MET B . n B 1 83 ARG 83 83 83 ARG ARG B . n B 1 84 ILE 84 84 84 ILE ILE B . n B 1 85 GLN 85 85 85 GLN GLN B . n B 1 86 TYR 86 86 86 TYR TYR B . n B 1 87 ALA 87 87 87 ALA ALA B . n B 1 88 LYS 88 88 88 LYS LYS B . n B 1 89 THR 89 89 89 THR THR B . n B 1 90 ASP 90 90 90 ASP ASP B . n B 1 91 SER 91 91 91 SER SER B . n B 1 92 ASP 92 92 92 ASP ASP B . n B 1 93 ILE 93 93 ? ? ? B . n B 1 94 ILE 94 94 ? ? ? B . n B 1 95 ALA 95 95 ? ? ? B . n B 1 96 LYS 96 96 ? ? ? B . n B 1 97 MET 97 97 ? ? ? B . n B 1 98 LYS 98 98 ? ? ? B . n B 1 99 GLY 99 99 ? ? ? B . n B 1 100 THR 100 100 ? ? ? B . n B 1 101 PHE 101 101 ? ? ? B . n B 1 102 VAL 102 102 ? ? ? B . n C 1 1 MET 1 1 ? ? ? C . n C 1 2 ALA 2 2 ? ? ? C . n C 1 3 VAL 3 3 ? ? ? C . n C 1 4 PRO 4 4 ? ? ? C . n C 1 5 GLU 5 5 ? ? ? C . n C 1 6 THR 6 6 6 THR THR C . n C 1 7 ARG 7 7 7 ARG ARG C . n C 1 8 PRO 8 8 8 PRO PRO C . n C 1 9 ASN 9 9 9 ASN ASN C . n C 1 10 HIS 10 10 10 HIS HIS C . n C 1 11 THR 11 11 11 THR THR C . n C 1 12 ILE 12 12 12 ILE ILE C . n C 1 13 TYR 13 13 13 TYR TYR C . n C 1 14 ILE 14 14 14 ILE ILE C . n C 1 15 ASN 15 15 15 ASN ASN C . n C 1 16 ASN 16 16 16 ASN ASN C . n C 1 17 LEU 17 17 17 LEU LEU C . n C 1 18 ASN 18 18 18 ASN ASN C . n C 1 19 GLU 19 19 19 GLU GLU C . n C 1 20 LYS 20 20 20 LYS LYS C . n C 1 21 ILE 21 21 21 ILE ILE C . n C 1 22 LYS 22 22 22 LYS LYS C . n C 1 23 LYS 23 23 23 LYS LYS C . n C 1 24 ASP 24 24 24 ASP ASP C . n C 1 25 GLU 25 25 25 GLU GLU C . n C 1 26 LEU 26 26 26 LEU LEU C . n C 1 27 LYS 27 27 27 LYS LYS C . n C 1 28 LYS 28 28 28 LYS LYS C . n C 1 29 SER 29 29 29 SER SER C . n C 1 30 LEU 30 30 30 LEU LEU C . n C 1 31 TYR 31 31 31 TYR TYR C . n C 1 32 ALA 32 32 32 ALA ALA C . n C 1 33 ILE 33 33 33 ILE ILE C . n C 1 34 PHE 34 34 34 PHE PHE C . n C 1 35 SER 35 35 35 SER SER C . n C 1 36 GLN 36 36 36 GLN GLN C . n C 1 37 PHE 37 37 37 PHE PHE C . n C 1 38 GLY 38 38 38 GLY GLY C . n C 1 39 GLN 39 39 39 GLN GLN C . n C 1 40 ILE 40 40 40 ILE ILE C . n C 1 41 LEU 41 41 41 LEU LEU C . n C 1 42 ASP 42 42 42 ASP ASP C . n C 1 43 ILE 43 43 43 ILE ILE C . n C 1 44 LEU 44 44 44 LEU LEU C . n C 1 45 VAL 45 45 45 VAL VAL C . n C 1 46 SER 46 46 46 SER SER C . n C 1 47 ARG 47 47 47 ARG ARG C . n C 1 48 SER 48 48 48 SER SER C . n C 1 49 LEU 49 49 49 LEU LEU C . n C 1 50 LYS 50 50 50 LYS LYS C . n C 1 51 MET 51 51 51 MET MET C . n C 1 52 ARG 52 52 52 ARG ARG C . n C 1 53 GLY 53 53 53 GLY GLY C . n C 1 54 GLN 54 54 54 GLN GLN C . n C 1 55 ALA 55 55 55 ALA ALA C . n C 1 56 PHE 56 56 56 PHE PHE C . n C 1 57 VAL 57 57 57 VAL VAL C . n C 1 58 ILE 58 58 58 ILE ILE C . n C 1 59 PHE 59 59 59 PHE PHE C . n C 1 60 LYS 60 60 60 LYS LYS C . n C 1 61 GLU 61 61 61 GLU GLU C . n C 1 62 VAL 62 62 62 VAL VAL C . n C 1 63 SER 63 63 63 SER SER C . n C 1 64 SER 64 64 64 SER SER C . n C 1 65 ALA 65 65 65 ALA ALA C . n C 1 66 THR 66 66 66 THR THR C . n C 1 67 ASN 67 67 67 ASN ASN C . n C 1 68 ALA 68 68 68 ALA ALA C . n C 1 69 LEU 69 69 69 LEU LEU C . n C 1 70 ARG 70 70 70 ARG ARG C . n C 1 71 SER 71 71 71 SER SER C . n C 1 72 MET 72 72 72 MET MET C . n C 1 73 GLN 73 73 73 GLN GLN C . n C 1 74 GLY 74 74 74 GLY GLY C . n C 1 75 PHE 75 75 75 PHE PHE C . n C 1 76 PRO 76 76 76 PRO PRO C . n C 1 77 PHE 77 77 77 PHE PHE C . n C 1 78 TYR 78 78 78 TYR TYR C . n C 1 79 ASP 79 79 79 ASP ASP C . n C 1 80 LYS 80 80 80 LYS LYS C . n C 1 81 PRO 81 81 81 PRO PRO C . n C 1 82 MET 82 82 82 MET MET C . n C 1 83 ARG 83 83 83 ARG ARG C . n C 1 84 ILE 84 84 84 ILE ILE C . n C 1 85 GLN 85 85 85 GLN GLN C . n C 1 86 TYR 86 86 86 TYR TYR C . n C 1 87 ALA 87 87 87 ALA ALA C . n C 1 88 LYS 88 88 88 LYS LYS C . n C 1 89 THR 89 89 89 THR THR C . n C 1 90 ASP 90 90 90 ASP ASP C . n C 1 91 SER 91 91 91 SER SER C . n C 1 92 ASP 92 92 92 ASP ASP C . n C 1 93 ILE 93 93 93 ILE ILE C . n C 1 94 ILE 94 94 94 ILE ILE C . n C 1 95 ALA 95 95 95 ALA ALA C . n C 1 96 LYS 96 96 96 LYS LYS C . n C 1 97 MET 97 97 97 MET MET C . n C 1 98 LYS 98 98 98 LYS LYS C . n C 1 99 GLY 99 99 99 GLY GLY C . n C 1 100 THR 100 100 100 THR THR C . n C 1 101 PHE 101 101 101 PHE PHE C . n C 1 102 VAL 102 102 102 VAL VAL C . n D 1 1 MET 1 1 ? ? ? D . n D 1 2 ALA 2 2 ? ? ? D . n D 1 3 VAL 3 3 ? ? ? D . n D 1 4 PRO 4 4 ? ? ? D . n D 1 5 GLU 5 5 5 GLU GLU D . n D 1 6 THR 6 6 6 THR THR D . n D 1 7 ARG 7 7 7 ARG ARG D . n D 1 8 PRO 8 8 8 PRO PRO D . n D 1 9 ASN 9 9 9 ASN ASN D . n D 1 10 HIS 10 10 10 HIS HIS D . n D 1 11 THR 11 11 11 THR THR D . n D 1 12 ILE 12 12 12 ILE ILE D . n D 1 13 TYR 13 13 13 TYR TYR D . n D 1 14 ILE 14 14 14 ILE ILE D . n D 1 15 ASN 15 15 15 ASN ASN D . n D 1 16 ASN 16 16 16 ASN ASN D . n D 1 17 LEU 17 17 17 LEU LEU D . n D 1 18 ASN 18 18 18 ASN ASN D . n D 1 19 GLU 19 19 19 GLU GLU D . n D 1 20 LYS 20 20 20 LYS LYS D . n D 1 21 ILE 21 21 21 ILE ILE D . n D 1 22 LYS 22 22 22 LYS LYS D . n D 1 23 LYS 23 23 23 LYS LYS D . n D 1 24 ASP 24 24 24 ASP ASP D . n D 1 25 GLU 25 25 25 GLU GLU D . n D 1 26 LEU 26 26 26 LEU LEU D . n D 1 27 LYS 27 27 27 LYS LYS D . n D 1 28 LYS 28 28 28 LYS LYS D . n D 1 29 SER 29 29 29 SER SER D . n D 1 30 LEU 30 30 30 LEU LEU D . n D 1 31 TYR 31 31 31 TYR TYR D . n D 1 32 ALA 32 32 32 ALA ALA D . n D 1 33 ILE 33 33 33 ILE ILE D . n D 1 34 PHE 34 34 34 PHE PHE D . n D 1 35 SER 35 35 35 SER SER D . n D 1 36 GLN 36 36 36 GLN GLN D . n D 1 37 PHE 37 37 37 PHE PHE D . n D 1 38 GLY 38 38 38 GLY GLY D . n D 1 39 GLN 39 39 39 GLN GLN D . n D 1 40 ILE 40 40 40 ILE ILE D . n D 1 41 LEU 41 41 41 LEU LEU D . n D 1 42 ASP 42 42 42 ASP ASP D . n D 1 43 ILE 43 43 43 ILE ILE D . n D 1 44 LEU 44 44 44 LEU LEU D . n D 1 45 VAL 45 45 45 VAL VAL D . n D 1 46 SER 46 46 46 SER SER D . n D 1 47 ARG 47 47 47 ARG ARG D . n D 1 48 SER 48 48 48 SER SER D . n D 1 49 LEU 49 49 49 LEU LEU D . n D 1 50 LYS 50 50 50 LYS LYS D . n D 1 51 MET 51 51 51 MET MET D . n D 1 52 ARG 52 52 52 ARG ARG D . n D 1 53 GLY 53 53 53 GLY GLY D . n D 1 54 GLN 54 54 54 GLN GLN D . n D 1 55 ALA 55 55 55 ALA ALA D . n D 1 56 PHE 56 56 56 PHE PHE D . n D 1 57 VAL 57 57 57 VAL VAL D . n D 1 58 ILE 58 58 58 ILE ILE D . n D 1 59 PHE 59 59 59 PHE PHE D . n D 1 60 LYS 60 60 60 LYS LYS D . n D 1 61 GLU 61 61 61 GLU GLU D . n D 1 62 VAL 62 62 62 VAL VAL D . n D 1 63 SER 63 63 63 SER SER D . n D 1 64 SER 64 64 64 SER SER D . n D 1 65 ALA 65 65 65 ALA ALA D . n D 1 66 THR 66 66 66 THR THR D . n D 1 67 ASN 67 67 67 ASN ASN D . n D 1 68 ALA 68 68 68 ALA ALA D . n D 1 69 LEU 69 69 69 LEU LEU D . n D 1 70 ARG 70 70 70 ARG ARG D . n D 1 71 SER 71 71 71 SER SER D . n D 1 72 MET 72 72 72 MET MET D . n D 1 73 GLN 73 73 73 GLN GLN D . n D 1 74 GLY 74 74 74 GLY GLY D . n D 1 75 PHE 75 75 75 PHE PHE D . n D 1 76 PRO 76 76 76 PRO PRO D . n D 1 77 PHE 77 77 77 PHE PHE D . n D 1 78 TYR 78 78 78 TYR TYR D . n D 1 79 ASP 79 79 79 ASP ASP D . n D 1 80 LYS 80 80 80 LYS LYS D . n D 1 81 PRO 81 81 81 PRO PRO D . n D 1 82 MET 82 82 82 MET MET D . n D 1 83 ARG 83 83 83 ARG ARG D . n D 1 84 ILE 84 84 84 ILE ILE D . n D 1 85 GLN 85 85 85 GLN GLN D . n D 1 86 TYR 86 86 86 TYR TYR D . n D 1 87 ALA 87 87 87 ALA ALA D . n D 1 88 LYS 88 88 88 LYS LYS D . n D 1 89 THR 89 89 89 THR THR D . n D 1 90 ASP 90 90 90 ASP ASP D . n D 1 91 SER 91 91 91 SER SER D . n D 1 92 ASP 92 92 92 ASP ASP D . n D 1 93 ILE 93 93 93 ILE ILE D . n D 1 94 ILE 94 94 94 ILE ILE D . n D 1 95 ALA 95 95 95 ALA ALA D . n D 1 96 LYS 96 96 96 LYS LYS D . n D 1 97 MET 97 97 97 MET MET D . n D 1 98 LYS 98 98 98 LYS LYS D . n D 1 99 GLY 99 99 99 GLY GLY D . n D 1 100 THR 100 100 100 THR THR D . n D 1 101 PHE 101 101 101 PHE PHE D . n D 1 102 VAL 102 102 ? ? ? D . n E 2 1 G 1 1 1 G G X . n E 2 2 G 2 2 2 G G X . n E 2 3 A 3 3 3 A A X . n E 2 4 C 4 4 4 C C X . n E 2 5 C 5 5 5 C C X . n E 2 6 U 6 6 6 U U X . n E 2 7 A 7 7 7 A A X . n E 2 8 C 8 8 8 C C X . n E 2 9 U 9 9 9 U U X . n E 2 10 A 10 10 10 A A X . n E 2 11 C 11 11 11 C C X . n E 2 12 G 12 12 12 G G X . n E 2 13 A 13 13 13 A A X . n E 2 14 G 14 14 14 G G X . n E 2 15 C 15 15 15 C C X . n E 2 16 G 16 16 16 G G X . n E 2 17 C 17 17 17 C C X . n E 2 18 C 18 18 18 C C X . n E 2 19 A 19 19 19 A A X . n E 2 20 U 20 20 20 U U X . n E 2 21 U 21 21 21 U U X . n E 2 22 G 22 22 22 G G X . n E 2 23 C 23 23 23 C C X . n E 2 24 A 24 24 24 A A X . n E 2 25 C 25 25 25 C C X . n E 2 26 U 26 26 26 U U X . n E 2 27 C 27 27 27 C C X . n E 2 28 C 28 28 28 C C X . n E 2 29 G 29 29 29 G G X . n E 2 30 G 30 30 30 G G X . n E 2 31 C 31 31 31 C C X . n E 2 32 G 32 32 32 G G X . n E 2 33 C 33 33 33 C C X . n E 2 34 C 34 34 34 C C X . n E 2 35 A 35 35 35 A A X . n E 2 36 C 36 36 36 C C X . n E 2 37 G 37 37 37 G G X . n E 2 38 G 38 38 38 G G X . n E 2 39 G 39 39 39 G G X . n E 2 40 G 40 40 40 G G X . n E 2 41 G 41 41 41 G G X . n E 2 42 G 42 42 42 G G X . n E 2 43 U 43 43 43 U U X . n E 2 44 C 44 44 44 C C X . n E 2 45 C 45 45 45 C C X . n F 2 1 G 1 1 1 G G Y . n F 2 2 G 2 2 2 G G Y . n F 2 3 A 3 3 3 A A Y . n F 2 4 C 4 4 4 C C Y . n F 2 5 C 5 5 5 C C Y . n F 2 6 U 6 6 6 U U Y . n F 2 7 A 7 7 7 A A Y . n F 2 8 C 8 8 8 C C Y . n F 2 9 U 9 9 9 U U Y . n F 2 10 A 10 10 10 A A Y . n F 2 11 C 11 11 11 C C Y . n F 2 12 G 12 12 12 G G Y . n F 2 13 A 13 13 13 A A Y . n F 2 14 G 14 14 14 G G Y . n F 2 15 C 15 15 15 C C Y . n F 2 16 G 16 16 16 G G Y . n F 2 17 C 17 17 17 C C Y . n F 2 18 C 18 18 18 C C Y . n F 2 19 A 19 19 19 A A Y . n F 2 20 U 20 20 20 U U Y . n F 2 21 U 21 21 21 U U Y . n F 2 22 G 22 22 22 G G Y . n F 2 23 C 23 23 23 C C Y . n F 2 24 A 24 24 24 A A Y . n F 2 25 C 25 25 25 C C Y . n F 2 26 U 26 26 26 U U Y . n F 2 27 C 27 27 27 C C Y . n F 2 28 C 28 28 28 C C Y . n F 2 29 G 29 29 29 G G Y . n F 2 30 G 30 30 30 G G Y . n F 2 31 C 31 31 31 C C Y . n F 2 32 G 32 32 32 G G Y . n F 2 33 C 33 33 33 C C Y . n F 2 34 C 34 34 34 C C Y . n F 2 35 A 35 35 35 A A Y . n F 2 36 C 36 36 36 C C Y . n F 2 37 G 37 37 37 G G Y . n F 2 38 G 38 38 38 G G Y . n F 2 39 G 39 39 39 G G Y . n F 2 40 G 40 40 40 G G Y . n F 2 41 G 41 41 41 G G Y . n F 2 42 G 42 42 42 G G Y . n F 2 43 U 43 43 43 U U Y . n F 2 44 C 44 44 44 C C Y . n F 2 45 C 45 45 45 C C Y . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 3 CU 1 101 1 CU CU X . H 4 SAM 1 102 1 SAM SAM X . I 3 CU 1 101 2 CU CU Y . J 4 SAM 1 102 2 SAM SAM Y . K 5 HOH 1 201 4 HOH HOH B . L 5 HOH 1 201 2 HOH HOH C . M 5 HOH 1 201 6 HOH HOH D . M 5 HOH 2 202 3 HOH HOH D . M 5 HOH 3 203 5 HOH HOH D . N 5 HOH 1 201 1 HOH HOH X . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N7 ? E G 40 ? X G 40 ? 1_555 CU ? G CU . ? X CU 101 ? 1_555 N ? H SAM . ? X SAM 102 ? 1_555 133.9 ? 2 N7 ? E G 40 ? X G 40 ? 1_555 CU ? G CU . ? X CU 101 ? 1_555 O ? H SAM . ? X SAM 102 ? 1_555 159.1 ? 3 N ? H SAM . ? X SAM 102 ? 1_555 CU ? G CU . ? X CU 101 ? 1_555 O ? H SAM . ? X SAM 102 ? 1_555 67.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-27 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -6.1700 _pdbx_refine_tls.origin_y 17.4446 _pdbx_refine_tls.origin_z -23.2270 _pdbx_refine_tls.T[1][1] 0.2847 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0164 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0359 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1917 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0750 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2829 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.6295 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.1302 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.0839 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.7566 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.1903 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.6015 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1006 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.1800 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0468 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1447 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0204 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0242 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.2296 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.1789 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0669 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 6 ? ? ? A 100 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 8 ? ? ? B 92 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? C 6 ? ? ? C 102 ? ? all 4 'X-RAY DIFFRACTION' 1 ? ? D 5 ? ? ? D 101 ? ? all 5 'X-RAY DIFFRACTION' 1 ? ? X 1 ? ? ? X 45 ? ? all 6 'X-RAY DIFFRACTION' 1 ? ? Y 1 ? ? ? Y 45 ? ? all 7 'X-RAY DIFFRACTION' 1 ? ? E 1 ? ? ? E 2 ? ? all 8 'X-RAY DIFFRACTION' 1 ? ? F 1 ? ? ? F 1 ? ? all 9 'X-RAY DIFFRACTION' 1 ? ? F 2 ? ? ? F 2 ? ? all 10 'X-RAY DIFFRACTION' 1 ? ? G 1 ? ? ? G 6 ? ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7DWH _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 8 ? ? -48.54 91.69 2 1 PRO C 8 ? ? -59.34 95.93 3 1 MET C 51 ? ? -106.34 41.98 4 1 PRO D 8 ? ? -60.49 92.82 5 1 ASP D 90 ? ? 56.19 19.69 6 1 THR D 100 ? ? -144.24 52.65 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 6 ? OG1 ? A THR 6 OG1 2 1 Y 1 A THR 6 ? CG2 ? A THR 6 CG2 3 1 Y 1 A ARG 7 ? CG ? A ARG 7 CG 4 1 Y 1 A ARG 7 ? CD ? A ARG 7 CD 5 1 Y 1 A ARG 7 ? NE ? A ARG 7 NE 6 1 Y 1 A ARG 7 ? CZ ? A ARG 7 CZ 7 1 Y 1 A ARG 7 ? NH1 ? A ARG 7 NH1 8 1 Y 1 A ARG 7 ? NH2 ? A ARG 7 NH2 9 1 Y 1 A LYS 20 ? CD ? A LYS 20 CD 10 1 Y 1 A LYS 20 ? CE ? A LYS 20 CE 11 1 Y 1 A LYS 20 ? NZ ? A LYS 20 NZ 12 1 Y 1 A LYS 96 ? CG ? A LYS 96 CG 13 1 Y 1 A LYS 96 ? CD ? A LYS 96 CD 14 1 Y 1 A LYS 96 ? CE ? A LYS 96 CE 15 1 Y 1 A LYS 96 ? NZ ? A LYS 96 NZ 16 1 Y 1 A LYS 98 ? CG ? A LYS 98 CG 17 1 Y 1 A LYS 98 ? CD ? A LYS 98 CD 18 1 Y 1 A LYS 98 ? CE ? A LYS 98 CE 19 1 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 20 1 Y 1 A THR 100 ? OG1 ? A THR 100 OG1 21 1 Y 1 A THR 100 ? CG2 ? A THR 100 CG2 22 1 Y 1 B ASN 9 ? CG ? B ASN 9 CG 23 1 Y 1 B ASN 9 ? OD1 ? B ASN 9 OD1 24 1 Y 1 B ASN 9 ? ND2 ? B ASN 9 ND2 25 1 Y 1 B LYS 20 ? CD ? B LYS 20 CD 26 1 Y 1 B LYS 20 ? CE ? B LYS 20 CE 27 1 Y 1 B LYS 20 ? NZ ? B LYS 20 NZ 28 1 Y 1 B ASP 90 ? CG ? B ASP 90 CG 29 1 Y 1 B ASP 90 ? OD1 ? B ASP 90 OD1 30 1 Y 1 B ASP 90 ? OD2 ? B ASP 90 OD2 31 1 Y 1 C ARG 7 ? CG ? C ARG 7 CG 32 1 Y 1 C ARG 7 ? CD ? C ARG 7 CD 33 1 Y 1 C ARG 7 ? NE ? C ARG 7 NE 34 1 Y 1 C ARG 7 ? CZ ? C ARG 7 CZ 35 1 Y 1 C ARG 7 ? NH1 ? C ARG 7 NH1 36 1 Y 1 C ARG 7 ? NH2 ? C ARG 7 NH2 37 1 Y 1 C LYS 20 ? CD ? C LYS 20 CD 38 1 Y 1 C LYS 20 ? CE ? C LYS 20 CE 39 1 Y 1 C LYS 20 ? NZ ? C LYS 20 NZ 40 1 Y 1 C LYS 23 ? CG ? C LYS 23 CG 41 1 Y 1 C LYS 23 ? CD ? C LYS 23 CD 42 1 Y 1 C LYS 23 ? CE ? C LYS 23 CE 43 1 Y 1 C LYS 23 ? NZ ? C LYS 23 NZ 44 1 Y 1 C ARG 47 ? CG ? C ARG 47 CG 45 1 Y 1 C ARG 47 ? CD ? C ARG 47 CD 46 1 Y 1 C ARG 47 ? NE ? C ARG 47 NE 47 1 Y 1 C ARG 47 ? CZ ? C ARG 47 CZ 48 1 Y 1 C ARG 47 ? NH1 ? C ARG 47 NH1 49 1 Y 1 C ARG 47 ? NH2 ? C ARG 47 NH2 50 1 Y 1 C LYS 50 ? CG ? C LYS 50 CG 51 1 Y 1 C LYS 50 ? CD ? C LYS 50 CD 52 1 Y 1 C LYS 50 ? CE ? C LYS 50 CE 53 1 Y 1 C LYS 50 ? NZ ? C LYS 50 NZ 54 1 Y 1 C LYS 98 ? CG ? C LYS 98 CG 55 1 Y 1 C LYS 98 ? CD ? C LYS 98 CD 56 1 Y 1 C LYS 98 ? CE ? C LYS 98 CE 57 1 Y 1 C LYS 98 ? NZ ? C LYS 98 NZ 58 1 Y 1 C VAL 102 ? CG1 ? C VAL 102 CG1 59 1 Y 1 C VAL 102 ? CG2 ? C VAL 102 CG2 60 1 Y 1 D GLU 5 ? CG ? D GLU 5 CG 61 1 Y 1 D GLU 5 ? CD ? D GLU 5 CD 62 1 Y 1 D GLU 5 ? OE1 ? D GLU 5 OE1 63 1 Y 1 D GLU 5 ? OE2 ? D GLU 5 OE2 64 1 Y 1 D ARG 7 ? NE ? D ARG 7 NE 65 1 Y 1 D ARG 7 ? CZ ? D ARG 7 CZ 66 1 Y 1 D ARG 7 ? NH1 ? D ARG 7 NH1 67 1 Y 1 D ARG 7 ? NH2 ? D ARG 7 NH2 68 1 Y 1 D LYS 20 ? CD ? D LYS 20 CD 69 1 Y 1 D LYS 20 ? CE ? D LYS 20 CE 70 1 Y 1 D LYS 20 ? NZ ? D LYS 20 NZ 71 1 Y 1 D LYS 22 ? CG ? D LYS 22 CG 72 1 Y 1 D LYS 22 ? CD ? D LYS 22 CD 73 1 Y 1 D LYS 22 ? CE ? D LYS 22 CE 74 1 Y 1 D LYS 22 ? NZ ? D LYS 22 NZ 75 1 Y 1 D ARG 47 ? CG ? D ARG 47 CG 76 1 Y 1 D ARG 47 ? CD ? D ARG 47 CD 77 1 Y 1 D ARG 47 ? NE ? D ARG 47 NE 78 1 Y 1 D ARG 47 ? CZ ? D ARG 47 CZ 79 1 Y 1 D ARG 47 ? NH1 ? D ARG 47 NH1 80 1 Y 1 D ARG 47 ? NH2 ? D ARG 47 NH2 81 1 Y 1 D LEU 49 ? CG ? D LEU 49 CG 82 1 Y 1 D LEU 49 ? CD1 ? D LEU 49 CD1 83 1 Y 1 D LEU 49 ? CD2 ? D LEU 49 CD2 84 1 Y 1 D LYS 50 ? CG ? D LYS 50 CG 85 1 Y 1 D LYS 50 ? CD ? D LYS 50 CD 86 1 Y 1 D LYS 50 ? CE ? D LYS 50 CE 87 1 Y 1 D LYS 50 ? NZ ? D LYS 50 NZ 88 1 Y 1 D MET 51 ? CG ? D MET 51 CG 89 1 Y 1 D MET 51 ? SD ? D MET 51 SD 90 1 Y 1 D MET 51 ? CE ? D MET 51 CE 91 1 Y 1 D ARG 52 ? CG ? D ARG 52 CG 92 1 Y 1 D ARG 52 ? CD ? D ARG 52 CD 93 1 Y 1 D ARG 52 ? NE ? D ARG 52 NE 94 1 Y 1 D ARG 52 ? CZ ? D ARG 52 CZ 95 1 Y 1 D ARG 52 ? NH1 ? D ARG 52 NH1 96 1 Y 1 D ARG 52 ? NH2 ? D ARG 52 NH2 97 1 Y 1 D LYS 88 ? CG ? D LYS 88 CG 98 1 Y 1 D LYS 88 ? CD ? D LYS 88 CD 99 1 Y 1 D LYS 88 ? CE ? D LYS 88 CE 100 1 Y 1 D LYS 88 ? NZ ? D LYS 88 NZ 101 1 Y 1 D LYS 98 ? CG ? D LYS 98 CG 102 1 Y 1 D LYS 98 ? CD ? D LYS 98 CD 103 1 Y 1 D LYS 98 ? CE ? D LYS 98 CE 104 1 Y 1 D LYS 98 ? NZ ? D LYS 98 NZ 105 1 Y 1 D PHE 101 ? CG ? D PHE 101 CG 106 1 Y 1 D PHE 101 ? CD1 ? D PHE 101 CD1 107 1 Y 1 D PHE 101 ? CD2 ? D PHE 101 CD2 108 1 Y 1 D PHE 101 ? CE1 ? D PHE 101 CE1 109 1 Y 1 D PHE 101 ? CE2 ? D PHE 101 CE2 110 1 Y 1 D PHE 101 ? CZ ? D PHE 101 CZ 111 1 N 1 X SAM 102 ? CE ? H SAM 1 CE 112 1 N 1 Y SAM 102 ? N ? J SAM 1 N 113 1 N 1 Y SAM 102 ? CA ? J SAM 1 CA 114 1 N 1 Y SAM 102 ? C ? J SAM 1 C 115 1 N 1 Y SAM 102 ? O ? J SAM 1 O 116 1 N 1 Y SAM 102 ? OXT ? J SAM 1 OXT 117 1 N 1 Y SAM 102 ? CB ? J SAM 1 CB 118 1 N 1 Y SAM 102 ? CG ? J SAM 1 CG 119 1 N 1 Y SAM 102 ? CE ? J SAM 1 CE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A PHE 101 ? A PHE 101 7 1 Y 1 A VAL 102 ? A VAL 102 8 1 Y 1 B MET 1 ? B MET 1 9 1 Y 1 B ALA 2 ? B ALA 2 10 1 Y 1 B VAL 3 ? B VAL 3 11 1 Y 1 B PRO 4 ? B PRO 4 12 1 Y 1 B GLU 5 ? B GLU 5 13 1 Y 1 B THR 6 ? B THR 6 14 1 Y 1 B ARG 7 ? B ARG 7 15 1 Y 1 B ILE 93 ? B ILE 93 16 1 Y 1 B ILE 94 ? B ILE 94 17 1 Y 1 B ALA 95 ? B ALA 95 18 1 Y 1 B LYS 96 ? B LYS 96 19 1 Y 1 B MET 97 ? B MET 97 20 1 Y 1 B LYS 98 ? B LYS 98 21 1 Y 1 B GLY 99 ? B GLY 99 22 1 Y 1 B THR 100 ? B THR 100 23 1 Y 1 B PHE 101 ? B PHE 101 24 1 Y 1 B VAL 102 ? B VAL 102 25 1 Y 1 C MET 1 ? C MET 1 26 1 Y 1 C ALA 2 ? C ALA 2 27 1 Y 1 C VAL 3 ? C VAL 3 28 1 Y 1 C PRO 4 ? C PRO 4 29 1 Y 1 C GLU 5 ? C GLU 5 30 1 Y 1 D MET 1 ? D MET 1 31 1 Y 1 D ALA 2 ? D ALA 2 32 1 Y 1 D VAL 3 ? D VAL 3 33 1 Y 1 D PRO 4 ? D PRO 4 34 1 Y 1 D VAL 102 ? D VAL 102 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 C OP3 O N N 111 C P P N N 112 C OP1 O N N 113 C OP2 O N N 114 C "O5'" O N N 115 C "C5'" C N N 116 C "C4'" C N R 117 C "O4'" O N N 118 C "C3'" C N S 119 C "O3'" O N N 120 C "C2'" C N R 121 C "O2'" O N N 122 C "C1'" C N R 123 C N1 N N N 124 C C2 C N N 125 C O2 O N N 126 C N3 N N N 127 C C4 C N N 128 C N4 N N N 129 C C5 C N N 130 C C6 C N N 131 C HOP3 H N N 132 C HOP2 H N N 133 C "H5'" H N N 134 C "H5''" H N N 135 C "H4'" H N N 136 C "H3'" H N N 137 C "HO3'" H N N 138 C "H2'" H N N 139 C "HO2'" H N N 140 C "H1'" H N N 141 C H41 H N N 142 C H42 H N N 143 C H5 H N N 144 C H6 H N N 145 CU CU CU N N 146 G OP3 O N N 147 G P P N N 148 G OP1 O N N 149 G OP2 O N N 150 G "O5'" O N N 151 G "C5'" C N N 152 G "C4'" C N R 153 G "O4'" O N N 154 G "C3'" C N S 155 G "O3'" O N N 156 G "C2'" C N R 157 G "O2'" O N N 158 G "C1'" C N R 159 G N9 N Y N 160 G C8 C Y N 161 G N7 N Y N 162 G C5 C Y N 163 G C6 C N N 164 G O6 O N N 165 G N1 N N N 166 G C2 C N N 167 G N2 N N N 168 G N3 N N N 169 G C4 C Y N 170 G HOP3 H N N 171 G HOP2 H N N 172 G "H5'" H N N 173 G "H5''" H N N 174 G "H4'" H N N 175 G "H3'" H N N 176 G "HO3'" H N N 177 G "H2'" H N N 178 G "HO2'" H N N 179 G "H1'" H N N 180 G H8 H N N 181 G H1 H N N 182 G H21 H N N 183 G H22 H N N 184 GLN N N N N 185 GLN CA C N S 186 GLN C C N N 187 GLN O O N N 188 GLN CB C N N 189 GLN CG C N N 190 GLN CD C N N 191 GLN OE1 O N N 192 GLN NE2 N N N 193 GLN OXT O N N 194 GLN H H N N 195 GLN H2 H N N 196 GLN HA H N N 197 GLN HB2 H N N 198 GLN HB3 H N N 199 GLN HG2 H N N 200 GLN HG3 H N N 201 GLN HE21 H N N 202 GLN HE22 H N N 203 GLN HXT H N N 204 GLU N N N N 205 GLU CA C N S 206 GLU C C N N 207 GLU O O N N 208 GLU CB C N N 209 GLU CG C N N 210 GLU CD C N N 211 GLU OE1 O N N 212 GLU OE2 O N N 213 GLU OXT O N N 214 GLU H H N N 215 GLU H2 H N N 216 GLU HA H N N 217 GLU HB2 H N N 218 GLU HB3 H N N 219 GLU HG2 H N N 220 GLU HG3 H N N 221 GLU HE2 H N N 222 GLU HXT H N N 223 GLY N N N N 224 GLY CA C N N 225 GLY C C N N 226 GLY O O N N 227 GLY OXT O N N 228 GLY H H N N 229 GLY H2 H N N 230 GLY HA2 H N N 231 GLY HA3 H N N 232 GLY HXT H N N 233 HIS N N N N 234 HIS CA C N S 235 HIS C C N N 236 HIS O O N N 237 HIS CB C N N 238 HIS CG C Y N 239 HIS ND1 N Y N 240 HIS CD2 C Y N 241 HIS CE1 C Y N 242 HIS NE2 N Y N 243 HIS OXT O N N 244 HIS H H N N 245 HIS H2 H N N 246 HIS HA H N N 247 HIS HB2 H N N 248 HIS HB3 H N N 249 HIS HD1 H N N 250 HIS HD2 H N N 251 HIS HE1 H N N 252 HIS HE2 H N N 253 HIS HXT H N N 254 HOH O O N N 255 HOH H1 H N N 256 HOH H2 H N N 257 ILE N N N N 258 ILE CA C N S 259 ILE C C N N 260 ILE O O N N 261 ILE CB C N S 262 ILE CG1 C N N 263 ILE CG2 C N N 264 ILE CD1 C N N 265 ILE OXT O N N 266 ILE H H N N 267 ILE H2 H N N 268 ILE HA H N N 269 ILE HB H N N 270 ILE HG12 H N N 271 ILE HG13 H N N 272 ILE HG21 H N N 273 ILE HG22 H N N 274 ILE HG23 H N N 275 ILE HD11 H N N 276 ILE HD12 H N N 277 ILE HD13 H N N 278 ILE HXT H N N 279 LEU N N N N 280 LEU CA C N S 281 LEU C C N N 282 LEU O O N N 283 LEU CB C N N 284 LEU CG C N N 285 LEU CD1 C N N 286 LEU CD2 C N N 287 LEU OXT O N N 288 LEU H H N N 289 LEU H2 H N N 290 LEU HA H N N 291 LEU HB2 H N N 292 LEU HB3 H N N 293 LEU HG H N N 294 LEU HD11 H N N 295 LEU HD12 H N N 296 LEU HD13 H N N 297 LEU HD21 H N N 298 LEU HD22 H N N 299 LEU HD23 H N N 300 LEU HXT H N N 301 LYS N N N N 302 LYS CA C N S 303 LYS C C N N 304 LYS O O N N 305 LYS CB C N N 306 LYS CG C N N 307 LYS CD C N N 308 LYS CE C N N 309 LYS NZ N N N 310 LYS OXT O N N 311 LYS H H N N 312 LYS H2 H N N 313 LYS HA H N N 314 LYS HB2 H N N 315 LYS HB3 H N N 316 LYS HG2 H N N 317 LYS HG3 H N N 318 LYS HD2 H N N 319 LYS HD3 H N N 320 LYS HE2 H N N 321 LYS HE3 H N N 322 LYS HZ1 H N N 323 LYS HZ2 H N N 324 LYS HZ3 H N N 325 LYS HXT H N N 326 MET N N N N 327 MET CA C N S 328 MET C C N N 329 MET O O N N 330 MET CB C N N 331 MET CG C N N 332 MET SD S N N 333 MET CE C N N 334 MET OXT O N N 335 MET H H N N 336 MET H2 H N N 337 MET HA H N N 338 MET HB2 H N N 339 MET HB3 H N N 340 MET HG2 H N N 341 MET HG3 H N N 342 MET HE1 H N N 343 MET HE2 H N N 344 MET HE3 H N N 345 MET HXT H N N 346 PHE N N N N 347 PHE CA C N S 348 PHE C C N N 349 PHE O O N N 350 PHE CB C N N 351 PHE CG C Y N 352 PHE CD1 C Y N 353 PHE CD2 C Y N 354 PHE CE1 C Y N 355 PHE CE2 C Y N 356 PHE CZ C Y N 357 PHE OXT O N N 358 PHE H H N N 359 PHE H2 H N N 360 PHE HA H N N 361 PHE HB2 H N N 362 PHE HB3 H N N 363 PHE HD1 H N N 364 PHE HD2 H N N 365 PHE HE1 H N N 366 PHE HE2 H N N 367 PHE HZ H N N 368 PHE HXT H N N 369 PRO N N N N 370 PRO CA C N S 371 PRO C C N N 372 PRO O O N N 373 PRO CB C N N 374 PRO CG C N N 375 PRO CD C N N 376 PRO OXT O N N 377 PRO H H N N 378 PRO HA H N N 379 PRO HB2 H N N 380 PRO HB3 H N N 381 PRO HG2 H N N 382 PRO HG3 H N N 383 PRO HD2 H N N 384 PRO HD3 H N N 385 PRO HXT H N N 386 SAM N N N N 387 SAM CA C N S 388 SAM C C N N 389 SAM O O N N 390 SAM OXT O N N 391 SAM CB C N N 392 SAM CG C N N 393 SAM SD S N S 394 SAM CE C N N 395 SAM "C5'" C N N 396 SAM "C4'" C N S 397 SAM "O4'" O N N 398 SAM "C3'" C N S 399 SAM "O3'" O N N 400 SAM "C2'" C N R 401 SAM "O2'" O N N 402 SAM "C1'" C N R 403 SAM N9 N Y N 404 SAM C8 C Y N 405 SAM N7 N Y N 406 SAM C5 C Y N 407 SAM C6 C Y N 408 SAM N6 N N N 409 SAM N1 N Y N 410 SAM C2 C Y N 411 SAM N3 N Y N 412 SAM C4 C Y N 413 SAM HN1 H N N 414 SAM HN2 H N N 415 SAM HA H N N 416 SAM HB1 H N N 417 SAM HB2 H N N 418 SAM HG1 H N N 419 SAM HG2 H N N 420 SAM HE1 H N N 421 SAM HE2 H N N 422 SAM HE3 H N N 423 SAM "H5'1" H N N 424 SAM "H5'2" H N N 425 SAM "H4'" H N N 426 SAM "H3'" H N N 427 SAM "HO3'" H N N 428 SAM "H2'" H N N 429 SAM "HO2'" H N N 430 SAM "H1'" H N N 431 SAM H8 H N N 432 SAM HN61 H N N 433 SAM HN62 H N N 434 SAM H2 H N N 435 SER N N N N 436 SER CA C N S 437 SER C C N N 438 SER O O N N 439 SER CB C N N 440 SER OG O N N 441 SER OXT O N N 442 SER H H N N 443 SER H2 H N N 444 SER HA H N N 445 SER HB2 H N N 446 SER HB3 H N N 447 SER HG H N N 448 SER HXT H N N 449 THR N N N N 450 THR CA C N S 451 THR C C N N 452 THR O O N N 453 THR CB C N R 454 THR OG1 O N N 455 THR CG2 C N N 456 THR OXT O N N 457 THR H H N N 458 THR H2 H N N 459 THR HA H N N 460 THR HB H N N 461 THR HG1 H N N 462 THR HG21 H N N 463 THR HG22 H N N 464 THR HG23 H N N 465 THR HXT H N N 466 TYR N N N N 467 TYR CA C N S 468 TYR C C N N 469 TYR O O N N 470 TYR CB C N N 471 TYR CG C Y N 472 TYR CD1 C Y N 473 TYR CD2 C Y N 474 TYR CE1 C Y N 475 TYR CE2 C Y N 476 TYR CZ C Y N 477 TYR OH O N N 478 TYR OXT O N N 479 TYR H H N N 480 TYR H2 H N N 481 TYR HA H N N 482 TYR HB2 H N N 483 TYR HB3 H N N 484 TYR HD1 H N N 485 TYR HD2 H N N 486 TYR HE1 H N N 487 TYR HE2 H N N 488 TYR HH H N N 489 TYR HXT H N N 490 U OP3 O N N 491 U P P N N 492 U OP1 O N N 493 U OP2 O N N 494 U "O5'" O N N 495 U "C5'" C N N 496 U "C4'" C N R 497 U "O4'" O N N 498 U "C3'" C N S 499 U "O3'" O N N 500 U "C2'" C N R 501 U "O2'" O N N 502 U "C1'" C N R 503 U N1 N N N 504 U C2 C N N 505 U O2 O N N 506 U N3 N N N 507 U C4 C N N 508 U O4 O N N 509 U C5 C N N 510 U C6 C N N 511 U HOP3 H N N 512 U HOP2 H N N 513 U "H5'" H N N 514 U "H5''" H N N 515 U "H4'" H N N 516 U "H3'" H N N 517 U "HO3'" H N N 518 U "H2'" H N N 519 U "HO2'" H N N 520 U "H1'" H N N 521 U H3 H N N 522 U H5 H N N 523 U H6 H N N 524 VAL N N N N 525 VAL CA C N S 526 VAL C C N N 527 VAL O O N N 528 VAL CB C N N 529 VAL CG1 C N N 530 VAL CG2 C N N 531 VAL OXT O N N 532 VAL H H N N 533 VAL H2 H N N 534 VAL HA H N N 535 VAL HB H N N 536 VAL HG11 H N N 537 VAL HG12 H N N 538 VAL HG13 H N N 539 VAL HG21 H N N 540 VAL HG22 H N N 541 VAL HG23 H N N 542 VAL HXT H N N 543 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 C OP3 P sing N N 109 C OP3 HOP3 sing N N 110 C P OP1 doub N N 111 C P OP2 sing N N 112 C P "O5'" sing N N 113 C OP2 HOP2 sing N N 114 C "O5'" "C5'" sing N N 115 C "C5'" "C4'" sing N N 116 C "C5'" "H5'" sing N N 117 C "C5'" "H5''" sing N N 118 C "C4'" "O4'" sing N N 119 C "C4'" "C3'" sing N N 120 C "C4'" "H4'" sing N N 121 C "O4'" "C1'" sing N N 122 C "C3'" "O3'" sing N N 123 C "C3'" "C2'" sing N N 124 C "C3'" "H3'" sing N N 125 C "O3'" "HO3'" sing N N 126 C "C2'" "O2'" sing N N 127 C "C2'" "C1'" sing N N 128 C "C2'" "H2'" sing N N 129 C "O2'" "HO2'" sing N N 130 C "C1'" N1 sing N N 131 C "C1'" "H1'" sing N N 132 C N1 C2 sing N N 133 C N1 C6 sing N N 134 C C2 O2 doub N N 135 C C2 N3 sing N N 136 C N3 C4 doub N N 137 C C4 N4 sing N N 138 C C4 C5 sing N N 139 C N4 H41 sing N N 140 C N4 H42 sing N N 141 C C5 C6 doub N N 142 C C5 H5 sing N N 143 C C6 H6 sing N N 144 G OP3 P sing N N 145 G OP3 HOP3 sing N N 146 G P OP1 doub N N 147 G P OP2 sing N N 148 G P "O5'" sing N N 149 G OP2 HOP2 sing N N 150 G "O5'" "C5'" sing N N 151 G "C5'" "C4'" sing N N 152 G "C5'" "H5'" sing N N 153 G "C5'" "H5''" sing N N 154 G "C4'" "O4'" sing N N 155 G "C4'" "C3'" sing N N 156 G "C4'" "H4'" sing N N 157 G "O4'" "C1'" sing N N 158 G "C3'" "O3'" sing N N 159 G "C3'" "C2'" sing N N 160 G "C3'" "H3'" sing N N 161 G "O3'" "HO3'" sing N N 162 G "C2'" "O2'" sing N N 163 G "C2'" "C1'" sing N N 164 G "C2'" "H2'" sing N N 165 G "O2'" "HO2'" sing N N 166 G "C1'" N9 sing N N 167 G "C1'" "H1'" sing N N 168 G N9 C8 sing Y N 169 G N9 C4 sing Y N 170 G C8 N7 doub Y N 171 G C8 H8 sing N N 172 G N7 C5 sing Y N 173 G C5 C6 sing N N 174 G C5 C4 doub Y N 175 G C6 O6 doub N N 176 G C6 N1 sing N N 177 G N1 C2 sing N N 178 G N1 H1 sing N N 179 G C2 N2 sing N N 180 G C2 N3 doub N N 181 G N2 H21 sing N N 182 G N2 H22 sing N N 183 G N3 C4 sing N N 184 GLN N CA sing N N 185 GLN N H sing N N 186 GLN N H2 sing N N 187 GLN CA C sing N N 188 GLN CA CB sing N N 189 GLN CA HA sing N N 190 GLN C O doub N N 191 GLN C OXT sing N N 192 GLN CB CG sing N N 193 GLN CB HB2 sing N N 194 GLN CB HB3 sing N N 195 GLN CG CD sing N N 196 GLN CG HG2 sing N N 197 GLN CG HG3 sing N N 198 GLN CD OE1 doub N N 199 GLN CD NE2 sing N N 200 GLN NE2 HE21 sing N N 201 GLN NE2 HE22 sing N N 202 GLN OXT HXT sing N N 203 GLU N CA sing N N 204 GLU N H sing N N 205 GLU N H2 sing N N 206 GLU CA C sing N N 207 GLU CA CB sing N N 208 GLU CA HA sing N N 209 GLU C O doub N N 210 GLU C OXT sing N N 211 GLU CB CG sing N N 212 GLU CB HB2 sing N N 213 GLU CB HB3 sing N N 214 GLU CG CD sing N N 215 GLU CG HG2 sing N N 216 GLU CG HG3 sing N N 217 GLU CD OE1 doub N N 218 GLU CD OE2 sing N N 219 GLU OE2 HE2 sing N N 220 GLU OXT HXT sing N N 221 GLY N CA sing N N 222 GLY N H sing N N 223 GLY N H2 sing N N 224 GLY CA C sing N N 225 GLY CA HA2 sing N N 226 GLY CA HA3 sing N N 227 GLY C O doub N N 228 GLY C OXT sing N N 229 GLY OXT HXT sing N N 230 HIS N CA sing N N 231 HIS N H sing N N 232 HIS N H2 sing N N 233 HIS CA C sing N N 234 HIS CA CB sing N N 235 HIS CA HA sing N N 236 HIS C O doub N N 237 HIS C OXT sing N N 238 HIS CB CG sing N N 239 HIS CB HB2 sing N N 240 HIS CB HB3 sing N N 241 HIS CG ND1 sing Y N 242 HIS CG CD2 doub Y N 243 HIS ND1 CE1 doub Y N 244 HIS ND1 HD1 sing N N 245 HIS CD2 NE2 sing Y N 246 HIS CD2 HD2 sing N N 247 HIS CE1 NE2 sing Y N 248 HIS CE1 HE1 sing N N 249 HIS NE2 HE2 sing N N 250 HIS OXT HXT sing N N 251 HOH O H1 sing N N 252 HOH O H2 sing N N 253 ILE N CA sing N N 254 ILE N H sing N N 255 ILE N H2 sing N N 256 ILE CA C sing N N 257 ILE CA CB sing N N 258 ILE CA HA sing N N 259 ILE C O doub N N 260 ILE C OXT sing N N 261 ILE CB CG1 sing N N 262 ILE CB CG2 sing N N 263 ILE CB HB sing N N 264 ILE CG1 CD1 sing N N 265 ILE CG1 HG12 sing N N 266 ILE CG1 HG13 sing N N 267 ILE CG2 HG21 sing N N 268 ILE CG2 HG22 sing N N 269 ILE CG2 HG23 sing N N 270 ILE CD1 HD11 sing N N 271 ILE CD1 HD12 sing N N 272 ILE CD1 HD13 sing N N 273 ILE OXT HXT sing N N 274 LEU N CA sing N N 275 LEU N H sing N N 276 LEU N H2 sing N N 277 LEU CA C sing N N 278 LEU CA CB sing N N 279 LEU CA HA sing N N 280 LEU C O doub N N 281 LEU C OXT sing N N 282 LEU CB CG sing N N 283 LEU CB HB2 sing N N 284 LEU CB HB3 sing N N 285 LEU CG CD1 sing N N 286 LEU CG CD2 sing N N 287 LEU CG HG sing N N 288 LEU CD1 HD11 sing N N 289 LEU CD1 HD12 sing N N 290 LEU CD1 HD13 sing N N 291 LEU CD2 HD21 sing N N 292 LEU CD2 HD22 sing N N 293 LEU CD2 HD23 sing N N 294 LEU OXT HXT sing N N 295 LYS N CA sing N N 296 LYS N H sing N N 297 LYS N H2 sing N N 298 LYS CA C sing N N 299 LYS CA CB sing N N 300 LYS CA HA sing N N 301 LYS C O doub N N 302 LYS C OXT sing N N 303 LYS CB CG sing N N 304 LYS CB HB2 sing N N 305 LYS CB HB3 sing N N 306 LYS CG CD sing N N 307 LYS CG HG2 sing N N 308 LYS CG HG3 sing N N 309 LYS CD CE sing N N 310 LYS CD HD2 sing N N 311 LYS CD HD3 sing N N 312 LYS CE NZ sing N N 313 LYS CE HE2 sing N N 314 LYS CE HE3 sing N N 315 LYS NZ HZ1 sing N N 316 LYS NZ HZ2 sing N N 317 LYS NZ HZ3 sing N N 318 LYS OXT HXT sing N N 319 MET N CA sing N N 320 MET N H sing N N 321 MET N H2 sing N N 322 MET CA C sing N N 323 MET CA CB sing N N 324 MET CA HA sing N N 325 MET C O doub N N 326 MET C OXT sing N N 327 MET CB CG sing N N 328 MET CB HB2 sing N N 329 MET CB HB3 sing N N 330 MET CG SD sing N N 331 MET CG HG2 sing N N 332 MET CG HG3 sing N N 333 MET SD CE sing N N 334 MET CE HE1 sing N N 335 MET CE HE2 sing N N 336 MET CE HE3 sing N N 337 MET OXT HXT sing N N 338 PHE N CA sing N N 339 PHE N H sing N N 340 PHE N H2 sing N N 341 PHE CA C sing N N 342 PHE CA CB sing N N 343 PHE CA HA sing N N 344 PHE C O doub N N 345 PHE C OXT sing N N 346 PHE CB CG sing N N 347 PHE CB HB2 sing N N 348 PHE CB HB3 sing N N 349 PHE CG CD1 doub Y N 350 PHE CG CD2 sing Y N 351 PHE CD1 CE1 sing Y N 352 PHE CD1 HD1 sing N N 353 PHE CD2 CE2 doub Y N 354 PHE CD2 HD2 sing N N 355 PHE CE1 CZ doub Y N 356 PHE CE1 HE1 sing N N 357 PHE CE2 CZ sing Y N 358 PHE CE2 HE2 sing N N 359 PHE CZ HZ sing N N 360 PHE OXT HXT sing N N 361 PRO N CA sing N N 362 PRO N CD sing N N 363 PRO N H sing N N 364 PRO CA C sing N N 365 PRO CA CB sing N N 366 PRO CA HA sing N N 367 PRO C O doub N N 368 PRO C OXT sing N N 369 PRO CB CG sing N N 370 PRO CB HB2 sing N N 371 PRO CB HB3 sing N N 372 PRO CG CD sing N N 373 PRO CG HG2 sing N N 374 PRO CG HG3 sing N N 375 PRO CD HD2 sing N N 376 PRO CD HD3 sing N N 377 PRO OXT HXT sing N N 378 SAM N CA sing N N 379 SAM N HN1 sing N N 380 SAM N HN2 sing N N 381 SAM CA C sing N N 382 SAM CA CB sing N N 383 SAM CA HA sing N N 384 SAM C O doub N N 385 SAM C OXT sing N N 386 SAM CB CG sing N N 387 SAM CB HB1 sing N N 388 SAM CB HB2 sing N N 389 SAM CG SD sing N N 390 SAM CG HG1 sing N N 391 SAM CG HG2 sing N N 392 SAM SD CE sing N N 393 SAM SD "C5'" sing N N 394 SAM CE HE1 sing N N 395 SAM CE HE2 sing N N 396 SAM CE HE3 sing N N 397 SAM "C5'" "C4'" sing N N 398 SAM "C5'" "H5'1" sing N N 399 SAM "C5'" "H5'2" sing N N 400 SAM "C4'" "O4'" sing N N 401 SAM "C4'" "C3'" sing N N 402 SAM "C4'" "H4'" sing N N 403 SAM "O4'" "C1'" sing N N 404 SAM "C3'" "O3'" sing N N 405 SAM "C3'" "C2'" sing N N 406 SAM "C3'" "H3'" sing N N 407 SAM "O3'" "HO3'" sing N N 408 SAM "C2'" "O2'" sing N N 409 SAM "C2'" "C1'" sing N N 410 SAM "C2'" "H2'" sing N N 411 SAM "O2'" "HO2'" sing N N 412 SAM "C1'" N9 sing N N 413 SAM "C1'" "H1'" sing N N 414 SAM N9 C8 sing Y N 415 SAM N9 C4 sing Y N 416 SAM C8 N7 doub Y N 417 SAM C8 H8 sing N N 418 SAM N7 C5 sing Y N 419 SAM C5 C6 sing Y N 420 SAM C5 C4 doub Y N 421 SAM C6 N6 sing N N 422 SAM C6 N1 doub Y N 423 SAM N6 HN61 sing N N 424 SAM N6 HN62 sing N N 425 SAM N1 C2 sing Y N 426 SAM C2 N3 doub Y N 427 SAM C2 H2 sing N N 428 SAM N3 C4 sing Y N 429 SER N CA sing N N 430 SER N H sing N N 431 SER N H2 sing N N 432 SER CA C sing N N 433 SER CA CB sing N N 434 SER CA HA sing N N 435 SER C O doub N N 436 SER C OXT sing N N 437 SER CB OG sing N N 438 SER CB HB2 sing N N 439 SER CB HB3 sing N N 440 SER OG HG sing N N 441 SER OXT HXT sing N N 442 THR N CA sing N N 443 THR N H sing N N 444 THR N H2 sing N N 445 THR CA C sing N N 446 THR CA CB sing N N 447 THR CA HA sing N N 448 THR C O doub N N 449 THR C OXT sing N N 450 THR CB OG1 sing N N 451 THR CB CG2 sing N N 452 THR CB HB sing N N 453 THR OG1 HG1 sing N N 454 THR CG2 HG21 sing N N 455 THR CG2 HG22 sing N N 456 THR CG2 HG23 sing N N 457 THR OXT HXT sing N N 458 TYR N CA sing N N 459 TYR N H sing N N 460 TYR N H2 sing N N 461 TYR CA C sing N N 462 TYR CA CB sing N N 463 TYR CA HA sing N N 464 TYR C O doub N N 465 TYR C OXT sing N N 466 TYR CB CG sing N N 467 TYR CB HB2 sing N N 468 TYR CB HB3 sing N N 469 TYR CG CD1 doub Y N 470 TYR CG CD2 sing Y N 471 TYR CD1 CE1 sing Y N 472 TYR CD1 HD1 sing N N 473 TYR CD2 CE2 doub Y N 474 TYR CD2 HD2 sing N N 475 TYR CE1 CZ doub Y N 476 TYR CE1 HE1 sing N N 477 TYR CE2 CZ sing Y N 478 TYR CE2 HE2 sing N N 479 TYR CZ OH sing N N 480 TYR OH HH sing N N 481 TYR OXT HXT sing N N 482 U OP3 P sing N N 483 U OP3 HOP3 sing N N 484 U P OP1 doub N N 485 U P OP2 sing N N 486 U P "O5'" sing N N 487 U OP2 HOP2 sing N N 488 U "O5'" "C5'" sing N N 489 U "C5'" "C4'" sing N N 490 U "C5'" "H5'" sing N N 491 U "C5'" "H5''" sing N N 492 U "C4'" "O4'" sing N N 493 U "C4'" "C3'" sing N N 494 U "C4'" "H4'" sing N N 495 U "O4'" "C1'" sing N N 496 U "C3'" "O3'" sing N N 497 U "C3'" "C2'" sing N N 498 U "C3'" "H3'" sing N N 499 U "O3'" "HO3'" sing N N 500 U "C2'" "O2'" sing N N 501 U "C2'" "C1'" sing N N 502 U "C2'" "H2'" sing N N 503 U "O2'" "HO2'" sing N N 504 U "C1'" N1 sing N N 505 U "C1'" "H1'" sing N N 506 U N1 C2 sing N N 507 U N1 C6 sing N N 508 U C2 O2 doub N N 509 U C2 N3 sing N N 510 U N3 C4 sing N N 511 U N3 H3 sing N N 512 U C4 O4 doub N N 513 U C4 C5 sing N N 514 U C5 C6 doub N N 515 U C5 H5 sing N N 516 U C6 H6 sing N N 517 VAL N CA sing N N 518 VAL N H sing N N 519 VAL N H2 sing N N 520 VAL CA C sing N N 521 VAL CA CB sing N N 522 VAL CA HA sing N N 523 VAL C O doub N N 524 VAL C OXT sing N N 525 VAL CB CG1 sing N N 526 VAL CB CG2 sing N N 527 VAL CB HB sing N N 528 VAL CG1 HG11 sing N N 529 VAL CG1 HG12 sing N N 530 VAL CG1 HG13 sing N N 531 VAL CG2 HG21 sing N N 532 VAL CG2 HG22 sing N N 533 VAL CG2 HG23 sing N N 534 VAL OXT HXT sing N N 535 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 7DWH 'double helix' 7DWH 'a-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 E G 1 1_555 E C 45 1_555 0.852 0.109 -0.819 -13.445 -10.426 -9.813 1 X_G1:C45_X X 1 ? X 45 ? 19 1 1 E G 2 1_555 E C 44 1_555 0.902 -0.092 -0.459 -13.037 -6.157 -20.413 2 X_G2:C44_X X 2 ? X 44 ? 19 1 1 E A 3 1_555 E U 43 1_555 0.821 -0.256 0.329 2.962 -12.076 0.713 3 X_A3:U43_X X 3 ? X 43 ? 20 1 1 E C 4 1_555 E G 42 1_555 -1.154 0.495 -0.536 11.348 -24.356 -10.822 4 X_C4:G42_X X 4 ? X 42 ? ? 1 1 E C 5 1_555 E G 41 1_555 -0.511 -0.088 0.390 3.020 -17.345 3.484 5 X_C5:G41_X X 5 ? X 41 ? 19 1 1 E U 6 1_555 E G 40 1_555 2.169 0.192 0.237 -12.967 -8.026 -4.596 6 X_U6:G40_X X 6 ? X 40 ? 28 1 1 E C 8 1_555 E G 39 1_555 -0.105 -0.128 -0.761 0.155 -1.462 6.143 7 X_C8:G39_X X 8 ? X 39 ? 19 1 1 E U 9 1_555 E G 38 1_555 2.238 -0.804 -0.520 -4.398 -5.085 -15.074 8 X_U9:G38_X X 9 ? X 38 ? 28 1 1 E C 11 1_555 E G 37 1_555 -0.077 -0.594 -1.273 20.903 3.376 1.278 9 X_C11:G37_X X 11 ? X 37 ? 19 1 1 E G 12 1_555 E C 36 1_555 0.303 0.011 0.145 -13.592 -22.103 -31.493 10 X_G12:C36_X X 12 ? X 36 ? ? 1 1 E A 13 1_555 E C 34 1_555 -3.280 -0.392 0.090 6.403 2.184 9.505 11 X_A13:C34_X X 13 ? X 34 ? ? 1 1 E G 14 1_555 E C 33 1_555 -0.488 -0.091 -0.042 -7.011 -0.188 -4.833 12 X_G14:C33_X X 14 ? X 33 ? 19 1 1 E C 15 1_555 E G 32 1_555 -0.120 0.224 0.184 -1.357 -8.952 -3.428 13 X_C15:G32_X X 15 ? X 32 ? 19 1 1 E G 16 1_555 E C 31 1_555 0.653 -0.269 0.061 -5.318 -19.741 -18.560 14 X_G16:C31_X X 16 ? X 31 ? 19 1 1 E C 17 1_555 E G 30 1_555 -0.466 -0.051 0.091 4.841 -12.621 -0.140 15 X_C17:G30_X X 17 ? X 30 ? 19 1 1 E C 18 1_555 E G 29 1_555 0.159 -0.051 -0.220 2.264 -6.373 -1.478 16 X_C18:G29_X X 18 ? X 29 ? 19 1 1 F G 1 1_555 F C 45 1_555 0.746 -0.001 -0.463 -10.451 -5.341 -19.241 17 Y_G1:C45_Y Y 1 ? Y 45 ? 19 1 1 F G 2 1_555 F C 44 1_555 -0.127 -0.160 0.247 -3.690 -15.204 -11.225 18 Y_G2:C44_Y Y 2 ? Y 44 ? 19 1 1 F A 3 1_555 F U 43 1_555 1.379 -0.022 -0.174 0.219 -19.149 -5.448 19 Y_A3:U43_Y Y 3 ? Y 43 ? 20 1 1 F C 4 1_555 F G 42 1_555 0.060 -0.075 0.061 9.797 -20.878 -21.044 20 Y_C4:G42_Y Y 4 ? Y 42 ? ? 1 1 F C 5 1_555 F G 41 1_555 -1.168 -0.140 0.425 11.994 -19.390 -5.284 21 Y_C5:G41_Y Y 5 ? Y 41 ? 19 1 1 F U 6 1_555 F G 40 1_555 0.650 0.231 -0.622 4.660 -17.750 3.522 22 Y_U6:G40_Y Y 6 ? Y 40 ? ? 1 1 F C 8 1_555 F G 39 1_555 0.132 -0.009 -1.048 -1.292 -7.626 2.337 23 Y_C8:G39_Y Y 8 ? Y 39 ? 19 1 1 F U 9 1_555 F G 38 1_555 1.931 -0.315 -0.019 -10.150 -3.568 -6.181 24 Y_U9:G38_Y Y 9 ? Y 38 ? 28 1 1 F C 11 1_555 F G 37 1_555 0.230 -0.709 -0.506 6.716 -5.003 -3.047 25 Y_C11:G37_Y Y 11 ? Y 37 ? 19 1 1 F G 12 1_555 F C 36 1_555 0.083 0.143 -0.456 -12.308 -38.043 -35.390 26 Y_G12:C36_Y Y 12 ? Y 36 ? ? 1 1 F A 13 1_555 F C 34 1_555 -2.520 0.009 -0.035 -0.568 -9.374 7.179 27 Y_A13:C34_Y Y 13 ? Y 34 ? ? ? 1 F G 14 1_555 F C 33 1_555 -0.569 0.287 -0.128 -1.616 -4.021 1.075 28 Y_G14:C33_Y Y 14 ? Y 33 ? 19 1 1 F C 15 1_555 F G 32 1_555 -0.214 0.356 0.022 -2.834 -10.734 3.447 29 Y_C15:G32_Y Y 15 ? Y 32 ? 19 1 1 F G 16 1_555 F C 31 1_555 1.309 0.029 -0.105 -7.202 -14.557 -10.978 30 Y_G16:C31_Y Y 16 ? Y 31 ? 19 1 1 F C 17 1_555 F G 30 1_555 -0.215 -0.507 0.322 0.875 -6.899 -3.773 31 Y_C17:G30_Y Y 17 ? Y 30 ? 19 1 1 F C 18 1_555 F G 29 1_555 -0.437 -0.164 -0.242 3.746 -1.149 -10.527 32 Y_C18:G29_Y Y 18 ? Y 29 ? 19 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 E G 1 1_555 E C 45 1_555 E G 2 1_555 E C 44 1_555 -0.950 -2.107 3.418 -4.689 12.660 34.275 -4.990 0.895 2.607 20.523 7.601 36.764 1 XX_G1G2:C44C45_XX X 1 ? X 45 ? X 2 ? X 44 ? 1 E G 2 1_555 E C 44 1_555 E A 3 1_555 E U 43 1_555 0.652 -2.058 2.962 -0.402 4.029 30.030 -4.639 -1.317 2.661 7.730 0.771 30.295 2 XX_G2A3:U43C44_XX X 2 ? X 44 ? X 3 ? X 43 ? 1 E A 3 1_555 E U 43 1_555 E C 4 1_555 E G 42 1_555 0.112 -1.791 2.995 5.576 7.840 23.402 -5.997 1.097 2.252 18.365 -13.061 25.277 3 XX_A3C4:G42U43_XX X 3 ? X 43 ? X 4 ? X 42 ? 1 E C 4 1_555 E G 42 1_555 E C 5 1_555 E G 41 1_555 1.370 -2.508 3.374 -3.380 12.552 29.802 -6.386 -2.962 2.017 23.074 6.213 32.454 4 XX_C4C5:G41G42_XX X 4 ? X 42 ? X 5 ? X 41 ? 1 E C 5 1_555 E G 41 1_555 E U 6 1_555 E G 40 1_555 -0.421 -1.599 3.751 2.355 7.804 41.788 -3.074 0.843 3.385 10.818 -3.264 42.541 5 XX_C5U6:G40G41_XX X 5 ? X 41 ? X 6 ? X 40 ? 1 E U 6 1_555 E G 40 1_555 E C 8 1_555 E G 39 1_555 -1.687 -1.798 2.920 11.464 5.109 38.190 -3.080 3.488 2.101 7.564 -16.972 40.127 6 XX_U6C8:G39G40_XX X 6 ? X 40 ? X 8 ? X 39 ? 1 E C 8 1_555 E G 39 1_555 E U 9 1_555 E G 38 1_555 -0.780 -1.996 3.466 5.481 12.248 44.040 -3.584 1.459 2.736 15.900 -7.115 45.941 7 XX_C8U9:G38G39_XX X 8 ? X 39 ? X 9 ? X 38 ? 1 E U 9 1_555 E G 38 1_555 E C 11 1_555 E G 37 1_555 -1.644 -2.204 3.377 11.337 -5.773 38.831 -2.518 3.627 3.082 -8.413 -16.521 40.786 8 XX_U9C11:G37G38_XX X 9 ? X 38 ? X 11 ? X 37 ? 1 E C 11 1_555 E G 37 1_555 E G 12 1_555 E C 36 1_555 -1.672 -2.908 4.415 -5.102 8.824 32.251 -6.826 1.824 3.726 15.412 8.912 33.782 9 XX_C11G12:C36G37_XX X 11 ? X 37 ? X 12 ? X 36 ? 1 E G 12 1_555 E C 36 1_555 E A 13 1_555 E C 34 1_555 4.695 -0.645 2.696 -3.508 3.148 43.697 -1.089 -6.528 2.282 4.215 4.696 43.938 10 XX_G12A13:C34C36_XX X 12 ? X 36 ? X 13 ? X 34 ? 1 E A 13 1_555 E C 34 1_555 E G 14 1_555 E C 33 1_555 -0.620 -2.036 3.647 -2.389 6.402 39.787 -3.727 0.610 3.324 9.323 3.480 40.346 11 XX_A13G14:C33C34_XX X 13 ? X 34 ? X 14 ? X 33 ? 1 E G 14 1_555 E C 33 1_555 E C 15 1_555 E G 32 1_555 0.158 -2.186 3.176 1.422 -0.159 31.209 -4.031 -0.030 3.191 -0.296 -2.642 31.241 12 XX_G14C15:G32C33_XX X 14 ? X 33 ? X 15 ? X 32 ? 1 E C 15 1_555 E G 32 1_555 E G 16 1_555 E C 31 1_555 -0.286 -1.830 3.174 1.053 20.035 36.643 -4.356 0.496 1.951 29.326 -1.541 41.610 13 XX_C15G16:C31G32_XX X 15 ? X 32 ? X 16 ? X 31 ? 1 E G 16 1_555 E C 31 1_555 E C 17 1_555 E G 30 1_555 0.071 -2.457 2.898 -2.306 -2.955 24.390 -4.911 -0.821 3.148 -6.942 5.417 24.672 14 XX_G16C17:G30C31_XX X 16 ? X 31 ? X 17 ? X 30 ? 1 E C 17 1_555 E G 30 1_555 E C 18 1_555 E G 29 1_555 0.047 -1.751 3.335 0.715 4.780 32.190 -3.945 0.039 3.051 8.560 -1.280 32.542 15 XX_C17C18:G29G30_XX X 17 ? X 30 ? X 18 ? X 29 ? 1 F G 1 1_555 F C 45 1_555 F G 2 1_555 F C 44 1_555 0.589 -1.889 2.857 -4.741 14.230 33.450 -4.484 -1.430 1.832 23.321 7.770 36.571 16 YY_G1G2:C44C45_YY Y 1 ? Y 45 ? Y 2 ? Y 44 ? 1 F G 2 1_555 F C 44 1_555 F A 3 1_555 F U 43 1_555 -0.713 -2.005 3.355 3.341 0.433 36.498 -3.250 1.598 3.256 0.690 -5.321 36.648 17 YY_G2A3:U43C44_YY Y 2 ? Y 44 ? Y 3 ? Y 43 ? 1 F A 3 1_555 F U 43 1_555 F C 4 1_555 F G 42 1_555 0.002 -1.712 2.985 0.694 3.828 26.116 -4.643 0.157 2.709 8.412 -1.525 26.399 18 YY_A3C4:G42U43_YY Y 3 ? Y 43 ? Y 4 ? Y 42 ? 1 F C 4 1_555 F G 42 1_555 F C 5 1_555 F G 41 1_555 1.337 -3.161 3.019 -1.447 5.473 21.530 -9.819 -3.894 2.068 14.333 3.790 22.253 19 YY_C4C5:G41G42_YY Y 4 ? Y 42 ? Y 5 ? Y 41 ? 1 F C 5 1_555 F G 41 1_555 F U 6 1_555 F G 40 1_555 0.449 -1.914 3.645 11.233 4.017 38.983 -3.244 0.732 3.435 5.855 -16.371 40.699 20 YY_C5U6:G40G41_YY Y 5 ? Y 41 ? Y 6 ? Y 40 ? 1 F U 6 1_555 F G 40 1_555 F C 8 1_555 F G 39 1_555 -1.553 -0.992 3.386 7.327 16.354 42.651 -2.601 2.581 2.575 21.391 -9.583 46.101 21 YY_U6C8:G39G40_YY Y 6 ? Y 40 ? Y 8 ? Y 39 ? 1 F C 8 1_555 F G 39 1_555 F U 9 1_555 F G 38 1_555 -0.206 -1.958 3.628 -1.580 13.386 41.324 -3.982 0.121 2.893 18.388 2.170 43.376 22 YY_C8U9:G38G39_YY Y 8 ? Y 39 ? Y 9 ? Y 38 ? 1 F U 9 1_555 F G 38 1_555 F C 11 1_555 F G 37 1_555 -2.266 -1.908 3.229 6.050 -4.274 40.966 -2.248 3.810 3.054 -6.048 -8.560 41.602 23 YY_U9C11:G37G38_YY Y 9 ? Y 38 ? Y 11 ? Y 37 ? 1 F C 11 1_555 F G 37 1_555 F G 12 1_555 F C 36 1_555 -1.845 -3.046 4.099 -0.283 8.041 25.259 -9.022 3.943 3.022 17.820 0.628 26.489 24 YY_C11G12:C36G37_YY Y 11 ? Y 37 ? Y 12 ? Y 36 ? 1 F G 12 1_555 F C 36 1_555 F A 13 1_555 F C 34 1_555 4.413 -0.519 3.343 -9.064 5.518 48.211 -0.992 -5.897 2.456 6.662 10.942 49.297 25 YY_G12A13:C34C36_YY Y 12 ? Y 36 ? Y 13 ? Y 34 ? 1 F A 13 1_555 F C 34 1_555 F G 14 1_555 F C 33 1_555 -0.437 -2.038 3.360 -3.005 2.009 34.197 -3.766 0.263 3.264 3.404 5.093 34.382 26 YY_A13G14:C33C34_YY Y 13 ? Y 34 ? Y 14 ? Y 33 ? 1 F G 14 1_555 F C 33 1_555 F C 15 1_555 F G 32 1_555 0.341 -2.385 3.292 0.729 5.441 30.192 -5.520 -0.510 2.836 10.338 -1.384 30.675 27 YY_G14C15:G32C33_YY Y 14 ? Y 33 ? Y 15 ? Y 32 ? 1 F C 15 1_555 F G 32 1_555 F G 16 1_555 F C 31 1_555 -0.464 -1.544 3.436 0.696 10.737 37.615 -3.585 0.777 2.896 16.250 -1.054 39.070 28 YY_C15G16:C31G32_YY Y 15 ? Y 32 ? Y 16 ? Y 31 ? 1 F G 16 1_555 F C 31 1_555 F C 17 1_555 F G 30 1_555 -0.523 -2.468 2.999 -4.700 0.730 23.155 -6.250 -0.167 2.967 1.794 11.554 23.632 29 YY_G16C17:G30C31_YY Y 16 ? Y 31 ? Y 17 ? Y 30 ? 1 F C 17 1_555 F G 30 1_555 F C 18 1_555 F G 29 1_555 -0.251 -1.846 3.212 2.554 2.563 30.359 -3.986 0.959 3.019 4.872 -4.855 30.569 30 YY_C17C18:G29G30_YY Y 17 ? Y 30 ? Y 18 ? Y 29 ? # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SAM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SAM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'COPPER (II) ION' CU 4 S-ADENOSYLMETHIONINE SAM 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7DLZ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #