data_7DWS # _entry.id 7DWS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DWS pdb_00007dws 10.2210/pdb7dws/pdb WWPDB D_1300020351 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DWS _pdbx_database_status.recvd_initial_deposition_date 2021-01-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, X.' 1 0000-0002-0798-4175 'Chen, S.' 2 0000-0002-6984-5373 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biomaterials _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1878-5905 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 274 _citation.language ? _citation.page_first 120895 _citation.page_last 120895 _citation.title 'Rationally designed protein cross-linked hydrogel for bone regeneration via synergistic release of magnesium and zinc ions.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.biomaterials.2021.120895 _citation.pdbx_database_id_PubMed 34020269 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, X.' 1 ? primary 'Tan, B.' 2 ? primary 'Wang, S.' 3 ? primary 'Tang, R.' 4 ? primary 'Bao, Z.' 5 ? primary 'Chen, G.' 6 ? primary 'Chen, S.' 7 ? primary 'Tang, W.' 8 ? primary 'Wang, Z.' 9 ? primary 'Long, C.' 10 ? primary 'Lu, W.W.' 11 ? primary 'Yang, D.' 12 ? primary 'Bian, L.' 13 ? primary 'Peng, S.' 14 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7DWS _cell.details ? _cell.formula_units_Z ? _cell.length_a 102.861 _cell.length_a_esd ? _cell.length_b 102.861 _cell.length_b_esd ? _cell.length_c 244.533 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 36 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DWS _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Endolysin 19496.316 3 3.2.1.17 I3C,C54T,R125C,E128C ? ? 2 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? 3 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lysis protein,Lysozyme,Muramidase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMNCFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAV RGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKCWDCAAVNLAKSRWYNQTPNRAKRVITTFRT GTWDAYKGGGGRGDSP ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMNCFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAV RGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKCWDCAAVNLAKSRWYNQTPNRAKRVITTFRT GTWDAYKGGGGRGDSP ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 ASN n 1 8 CYS n 1 9 PHE n 1 10 GLU n 1 11 MET n 1 12 LEU n 1 13 ARG n 1 14 ILE n 1 15 ASP n 1 16 GLU n 1 17 GLY n 1 18 LEU n 1 19 ARG n 1 20 LEU n 1 21 LYS n 1 22 ILE n 1 23 TYR n 1 24 LYS n 1 25 ASP n 1 26 THR n 1 27 GLU n 1 28 GLY n 1 29 TYR n 1 30 TYR n 1 31 THR n 1 32 ILE n 1 33 GLY n 1 34 ILE n 1 35 GLY n 1 36 HIS n 1 37 LEU n 1 38 LEU n 1 39 THR n 1 40 LYS n 1 41 SER n 1 42 PRO n 1 43 SER n 1 44 LEU n 1 45 ASN n 1 46 ALA n 1 47 ALA n 1 48 LYS n 1 49 SER n 1 50 GLU n 1 51 LEU n 1 52 ASP n 1 53 LYS n 1 54 ALA n 1 55 ILE n 1 56 GLY n 1 57 ARG n 1 58 ASN n 1 59 THR n 1 60 ASN n 1 61 GLY n 1 62 VAL n 1 63 ILE n 1 64 THR n 1 65 LYS n 1 66 ASP n 1 67 GLU n 1 68 ALA n 1 69 GLU n 1 70 LYS n 1 71 LEU n 1 72 PHE n 1 73 ASN n 1 74 GLN n 1 75 ASP n 1 76 VAL n 1 77 ASP n 1 78 ALA n 1 79 ALA n 1 80 VAL n 1 81 ARG n 1 82 GLY n 1 83 ILE n 1 84 LEU n 1 85 ARG n 1 86 ASN n 1 87 ALA n 1 88 LYS n 1 89 LEU n 1 90 LYS n 1 91 PRO n 1 92 VAL n 1 93 TYR n 1 94 ASP n 1 95 SER n 1 96 LEU n 1 97 ASP n 1 98 ALA n 1 99 VAL n 1 100 ARG n 1 101 ARG n 1 102 CYS n 1 103 ALA n 1 104 LEU n 1 105 ILE n 1 106 ASN n 1 107 MET n 1 108 VAL n 1 109 PHE n 1 110 GLN n 1 111 MET n 1 112 GLY n 1 113 GLU n 1 114 THR n 1 115 GLY n 1 116 VAL n 1 117 ALA n 1 118 GLY n 1 119 PHE n 1 120 THR n 1 121 ASN n 1 122 SER n 1 123 LEU n 1 124 ARG n 1 125 MET n 1 126 LEU n 1 127 GLN n 1 128 GLN n 1 129 LYS n 1 130 CYS n 1 131 TRP n 1 132 ASP n 1 133 CYS n 1 134 ALA n 1 135 ALA n 1 136 VAL n 1 137 ASN n 1 138 LEU n 1 139 ALA n 1 140 LYS n 1 141 SER n 1 142 ARG n 1 143 TRP n 1 144 TYR n 1 145 ASN n 1 146 GLN n 1 147 THR n 1 148 PRO n 1 149 ASN n 1 150 ARG n 1 151 ALA n 1 152 LYS n 1 153 ARG n 1 154 VAL n 1 155 ILE n 1 156 THR n 1 157 THR n 1 158 PHE n 1 159 ARG n 1 160 THR n 1 161 GLY n 1 162 THR n 1 163 TRP n 1 164 ASP n 1 165 ALA n 1 166 TYR n 1 167 LYS n 1 168 GLY n 1 169 GLY n 1 170 GLY n 1 171 GLY n 1 172 ARG n 1 173 GLY n 1 174 ASP n 1 175 SER n 1 176 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 176 _entity_src_gen.gene_src_common_name 'Bacteriophage T4' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'e, T4Tp126' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D9IEF7_BPT4 _struct_ref.pdbx_db_accession D9IEF7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YK ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7DWS A 6 ? 167 ? D9IEF7 1 ? 162 ? 1 162 2 1 7DWS B 6 ? 167 ? D9IEF7 1 ? 162 ? 1 162 3 1 7DWS C 6 ? 167 ? D9IEF7 1 ? 162 ? 1 162 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7DWS GLY A 1 ? UNP D9IEF7 ? ? 'expression tag' -4 1 1 7DWS PRO A 2 ? UNP D9IEF7 ? ? 'expression tag' -3 2 1 7DWS LEU A 3 ? UNP D9IEF7 ? ? 'expression tag' -2 3 1 7DWS GLY A 4 ? UNP D9IEF7 ? ? 'expression tag' -1 4 1 7DWS SER A 5 ? UNP D9IEF7 ? ? 'expression tag' 0 5 1 7DWS CYS A 8 ? UNP D9IEF7 ILE 3 'engineered mutation' 3 6 1 7DWS THR A 59 ? UNP D9IEF7 CYS 54 'engineered mutation' 54 7 1 7DWS CYS A 130 ? UNP D9IEF7 ARG 125 'engineered mutation' 125 8 1 7DWS CYS A 133 ? UNP D9IEF7 GLU 128 'engineered mutation' 128 9 1 7DWS GLY A 168 ? UNP D9IEF7 ? ? 'expression tag' 163 10 1 7DWS GLY A 169 ? UNP D9IEF7 ? ? 'expression tag' 164 11 1 7DWS GLY A 170 ? UNP D9IEF7 ? ? 'expression tag' 165 12 1 7DWS GLY A 171 ? UNP D9IEF7 ? ? 'expression tag' 166 13 1 7DWS ARG A 172 ? UNP D9IEF7 ? ? 'expression tag' 167 14 1 7DWS GLY A 173 ? UNP D9IEF7 ? ? 'expression tag' 168 15 1 7DWS ASP A 174 ? UNP D9IEF7 ? ? 'expression tag' 169 16 1 7DWS SER A 175 ? UNP D9IEF7 ? ? 'expression tag' 170 17 1 7DWS PRO A 176 ? UNP D9IEF7 ? ? 'expression tag' 171 18 2 7DWS GLY B 1 ? UNP D9IEF7 ? ? 'expression tag' -4 19 2 7DWS PRO B 2 ? UNP D9IEF7 ? ? 'expression tag' -3 20 2 7DWS LEU B 3 ? UNP D9IEF7 ? ? 'expression tag' -2 21 2 7DWS GLY B 4 ? UNP D9IEF7 ? ? 'expression tag' -1 22 2 7DWS SER B 5 ? UNP D9IEF7 ? ? 'expression tag' 0 23 2 7DWS CYS B 8 ? UNP D9IEF7 ILE 3 'engineered mutation' 3 24 2 7DWS THR B 59 ? UNP D9IEF7 CYS 54 'engineered mutation' 54 25 2 7DWS CYS B 130 ? UNP D9IEF7 ARG 125 'engineered mutation' 125 26 2 7DWS CYS B 133 ? UNP D9IEF7 GLU 128 'engineered mutation' 128 27 2 7DWS GLY B 168 ? UNP D9IEF7 ? ? 'expression tag' 163 28 2 7DWS GLY B 169 ? UNP D9IEF7 ? ? 'expression tag' 164 29 2 7DWS GLY B 170 ? UNP D9IEF7 ? ? 'expression tag' 165 30 2 7DWS GLY B 171 ? UNP D9IEF7 ? ? 'expression tag' 166 31 2 7DWS ARG B 172 ? UNP D9IEF7 ? ? 'expression tag' 167 32 2 7DWS GLY B 173 ? UNP D9IEF7 ? ? 'expression tag' 168 33 2 7DWS ASP B 174 ? UNP D9IEF7 ? ? 'expression tag' 169 34 2 7DWS SER B 175 ? UNP D9IEF7 ? ? 'expression tag' 170 35 2 7DWS PRO B 176 ? UNP D9IEF7 ? ? 'expression tag' 171 36 3 7DWS GLY C 1 ? UNP D9IEF7 ? ? 'expression tag' -4 37 3 7DWS PRO C 2 ? UNP D9IEF7 ? ? 'expression tag' -3 38 3 7DWS LEU C 3 ? UNP D9IEF7 ? ? 'expression tag' -2 39 3 7DWS GLY C 4 ? UNP D9IEF7 ? ? 'expression tag' -1 40 3 7DWS SER C 5 ? UNP D9IEF7 ? ? 'expression tag' 0 41 3 7DWS CYS C 8 ? UNP D9IEF7 ILE 3 'engineered mutation' 3 42 3 7DWS THR C 59 ? UNP D9IEF7 CYS 54 'engineered mutation' 54 43 3 7DWS CYS C 130 ? UNP D9IEF7 ARG 125 'engineered mutation' 125 44 3 7DWS CYS C 133 ? UNP D9IEF7 GLU 128 'engineered mutation' 128 45 3 7DWS GLY C 168 ? UNP D9IEF7 ? ? 'expression tag' 163 46 3 7DWS GLY C 169 ? UNP D9IEF7 ? ? 'expression tag' 164 47 3 7DWS GLY C 170 ? UNP D9IEF7 ? ? 'expression tag' 165 48 3 7DWS GLY C 171 ? UNP D9IEF7 ? ? 'expression tag' 166 49 3 7DWS ARG C 172 ? UNP D9IEF7 ? ? 'expression tag' 167 50 3 7DWS GLY C 173 ? UNP D9IEF7 ? ? 'expression tag' 168 51 3 7DWS ASP C 174 ? UNP D9IEF7 ? ? 'expression tag' 169 52 3 7DWS SER C 175 ? UNP D9IEF7 ? ? 'expression tag' 170 53 3 7DWS PRO C 176 ? UNP D9IEF7 ? ? 'expression tag' 171 54 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DWS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.3 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.01 mM CoCl2, 0.1 M MES, pH 6.2, 2.2 M Ammonium Sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR555 FLAT PANEL' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9785 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NFPSS BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9785 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site NFPSS # _reflns.B_iso_Wilson_estimate 74.490 _reflns.entry_id 7DWS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.800 _reflns.d_resolution_low 19.865 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16874 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.900 _reflns.pdbx_Rmerge_I_obs 0.042 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all 0.042 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.800 2.950 ? ? 5044 ? ? ? 2615 96.400 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 1.900 ? ? ? 3.700 0.217 0.153 ? 1 1 0.938 ? ? ? ? ? ? ? ? ? ? 8.850 19.860 ? ? 825 ? ? ? 453 72.800 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 1.800 ? ? ? 23.100 0.046 0.032 ? 2 1 0.995 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 174.480 _refine.B_iso_mean 99.6258 _refine.B_iso_min 68.910 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DWS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8000 _refine.ls_d_res_low 19.860 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16818 _refine.ls_number_reflns_R_free 1590 _refine.ls_number_reflns_R_work 15228 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 85.8100 _refine.ls_percent_reflns_R_free 9.4500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3316 _refine.ls_R_factor_R_free 0.3450 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3301 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.410 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3SB5 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 41.5800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8000 _refine_hist.d_res_low 19.860 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 2986 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 421 _refine_hist.pdbx_B_iso_mean_ligand 83.92 _refine_hist.pdbx_B_iso_mean_solvent 85.05 _refine_hist.pdbx_number_atoms_protein 2970 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 3012 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.823 ? 4096 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 489 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 528 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.152 ? 1774 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? C 810 10.588 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 810 10.588 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8001 2.8902 . . 155 1452 93.0000 . . . 0.4451 0.0000 0.3782 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8902 2.9931 . . 141 1468 93.0000 . . . 0.4010 0.0000 0.3571 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9931 3.1126 . . 149 1473 93.0000 . . . 0.4060 0.0000 0.3944 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1126 3.2536 . . 158 1410 90.0000 . . . 0.3987 0.0000 0.3488 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2536 3.4243 . . 148 1430 90.0000 . . . 0.4191 0.0000 0.3870 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4243 3.6377 . . 141 1427 89.0000 . . . 0.4439 0.0000 0.4063 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6377 3.9166 . . 153 1369 87.0000 . . . 0.4207 0.0000 0.3602 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9166 4.3071 . . 139 1361 84.0000 . . . 0.3695 0.0000 0.3152 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3071 4.9220 . . 158 1292 81.0000 . . . 0.3190 0.0000 0.2918 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.9220 6.1702 . . 121 1295 77.0000 . . . 0.3445 0.0000 0.3445 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.1702 19.8600 . . 127 1251 70.0000 . . . 0.2440 0.0000 0.2440 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain C and (resseq 0 or (resid 1 and (name N or name CA or name C or name O or name CB )) or resseq 2:4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resseq 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resseq 8:10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resseq 12:13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resseq 15:16 or resseq 59:64 or resseq 66:78 or resseq 80:100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resseq 102:103 or resseq 105:121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or (resid 123 and (name N or name CA or name C or name O or name CB )) or resseq 124:138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resseq 140:144 or resseq 146 or (resid 147 and (name N or name CA or name C or name O or name CB )) or (resid 148 and (name N or name CA or name C or name O or name CB )) or resseq 149:153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resseq 155:157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or (resid 159 and (name N or name CA or name C or name O or name CB )) or resseq 160:161)) ; 1 2 ;(chain B and (resseq 0:12 or (resid 13 and (name N or name CA or name C or name O or name CB )) or resseq 14:16 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resseq 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:64 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resseq 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resseq 70:75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resseq 77:78 or (resid 80 and (name N or name C or name O or name CA or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB )) or resseq 82:95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resseq 97:103 or resseq 105:118 or (resid 119 and (name N or name CA or name C or name O or name CB )) or resseq 120:132 or (resid 133 and (name N or name CA or name C or name O or name CB )) or resseq 134 or (resid 135 and (name N or name CA or name C or name O or name CB )) or resseq 136:139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resseq 141:144 or resseq 146:161)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 C SER 5 . C SER 5 . C SER 0 C SER 0 ? ;(chain C and (resseq 0 or (resid 1 and (name N or name CA or name C or name O or name CB )) or resseq 2:4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resseq 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resseq 8:10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resseq 12:13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resseq 15:16 or resseq 59:64 or resseq 66:78 or resseq 80:100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resseq 102:103 or resseq 105:121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or (resid 123 and (name N or name CA or name C or name O or name CB )) or resseq 124:138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resseq 140:144 or resseq 146 or (resid 147 and (name N or name CA or name C or name O or name CB )) or (resid 148 and (name N or name CA or name C or name O or name CB )) or resseq 149:153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resseq 155:157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or (resid 159 and (name N or name CA or name C or name O or name CB )) or resseq 160:161)) ; 1 1 2 C MET 6 . C MET 6 . C MET 1 C MET 1 ? ;(chain C and (resseq 0 or (resid 1 and (name N or name CA or name C or name O or name CB )) or resseq 2:4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resseq 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resseq 8:10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resseq 12:13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resseq 15:16 or resseq 59:64 or resseq 66:78 or resseq 80:100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resseq 102:103 or resseq 105:121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or (resid 123 and (name N or name CA or name C or name O or name CB )) or resseq 124:138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resseq 140:144 or resseq 146 or (resid 147 and (name N or name CA or name C or name O or name CB )) or (resid 148 and (name N or name CA or name C or name O or name CB )) or resseq 149:153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resseq 155:157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or (resid 159 and (name N or name CA or name C or name O or name CB )) or resseq 160:161)) ; 1 1 3 C SER 5 . C LYS 167 . C SER 0 C LYS 162 ? ;(chain C and (resseq 0 or (resid 1 and (name N or name CA or name C or name O or name CB )) or resseq 2:4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resseq 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resseq 8:10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resseq 12:13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resseq 15:16 or resseq 59:64 or resseq 66:78 or resseq 80:100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resseq 102:103 or resseq 105:121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or (resid 123 and (name N or name CA or name C or name O or name CB )) or resseq 124:138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resseq 140:144 or resseq 146 or (resid 147 and (name N or name CA or name C or name O or name CB )) or (resid 148 and (name N or name CA or name C or name O or name CB )) or resseq 149:153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resseq 155:157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or (resid 159 and (name N or name CA or name C or name O or name CB )) or resseq 160:161)) ; 1 1 4 C SER 5 . C LYS 167 . C SER 0 C LYS 162 ? ;(chain C and (resseq 0 or (resid 1 and (name N or name CA or name C or name O or name CB )) or resseq 2:4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resseq 6 or (resid 7 and (name N or name CA or name C or name O or name CB )) or resseq 8:10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resseq 12:13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resseq 15:16 or resseq 59:64 or resseq 66:78 or resseq 80:100 or (resid 101 and (name N or name CA or name C or name O or name CB )) or resseq 102:103 or resseq 105:121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or (resid 123 and (name N or name CA or name C or name O or name CB )) or resseq 124:138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resseq 140:144 or resseq 146 or (resid 147 and (name N or name CA or name C or name O or name CB )) or (resid 148 and (name N or name CA or name C or name O or name CB )) or resseq 149:153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resseq 155:157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or (resid 159 and (name N or name CA or name C or name O or name CB )) or resseq 160:161)) ; 1 2 1 B SER 5 . B GLY 17 . B SER 0 B GLY 12 ? ;(chain B and (resseq 0:12 or (resid 13 and (name N or name CA or name C or name O or name CB )) or resseq 14:16 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resseq 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:64 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resseq 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resseq 70:75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resseq 77:78 or (resid 80 and (name N or name C or name O or name CA or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB )) or resseq 82:95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resseq 97:103 or resseq 105:118 or (resid 119 and (name N or name CA or name C or name O or name CB )) or resseq 120:132 or (resid 133 and (name N or name CA or name C or name O or name CB )) or resseq 134 or (resid 135 and (name N or name CA or name C or name O or name CB )) or resseq 136:139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resseq 141:144 or resseq 146:161)) ; 1 2 2 B LEU 18 . B LEU 18 . B LEU 13 B LEU 13 ? ;(chain B and (resseq 0:12 or (resid 13 and (name N or name CA or name C or name O or name CB )) or resseq 14:16 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resseq 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:64 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resseq 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resseq 70:75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resseq 77:78 or (resid 80 and (name N or name C or name O or name CA or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB )) or resseq 82:95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resseq 97:103 or resseq 105:118 or (resid 119 and (name N or name CA or name C or name O or name CB )) or resseq 120:132 or (resid 133 and (name N or name CA or name C or name O or name CB )) or resseq 134 or (resid 135 and (name N or name CA or name C or name O or name CB )) or resseq 136:139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resseq 141:144 or resseq 146:161)) ; 1 2 3 B GLY 4 . B TYR 166 . B GLY -1 B TYR 161 ? ;(chain B and (resseq 0:12 or (resid 13 and (name N or name CA or name C or name O or name CB )) or resseq 14:16 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resseq 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:64 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resseq 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resseq 70:75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resseq 77:78 or (resid 80 and (name N or name C or name O or name CA or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB )) or resseq 82:95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resseq 97:103 or resseq 105:118 or (resid 119 and (name N or name CA or name C or name O or name CB )) or resseq 120:132 or (resid 133 and (name N or name CA or name C or name O or name CB )) or resseq 134 or (resid 135 and (name N or name CA or name C or name O or name CB )) or resseq 136:139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resseq 141:144 or resseq 146:161)) ; 1 2 4 B GLY 4 . B TYR 166 . B GLY -1 B TYR 161 ? ;(chain B and (resseq 0:12 or (resid 13 and (name N or name CA or name C or name O or name CB )) or resseq 14:16 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resseq 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:64 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resseq 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resseq 70:75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resseq 77:78 or (resid 80 and (name N or name C or name O or name CA or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB )) or resseq 82:95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resseq 97:103 or resseq 105:118 or (resid 119 and (name N or name CA or name C or name O or name CB )) or resseq 120:132 or (resid 133 and (name N or name CA or name C or name O or name CB )) or resseq 134 or (resid 135 and (name N or name CA or name C or name O or name CB )) or resseq 136:139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resseq 141:144 or resseq 146:161)) ; 1 2 5 B GLY 4 . B TYR 166 . B GLY -1 B TYR 161 ? ;(chain B and (resseq 0:12 or (resid 13 and (name N or name CA or name C or name O or name CB )) or resseq 14:16 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resseq 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:64 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resseq 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resseq 70:75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resseq 77:78 or (resid 80 and (name N or name C or name O or name CA or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB )) or resseq 82:95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resseq 97:103 or resseq 105:118 or (resid 119 and (name N or name CA or name C or name O or name CB )) or resseq 120:132 or (resid 133 and (name N or name CA or name C or name O or name CB )) or resseq 134 or (resid 135 and (name N or name CA or name C or name O or name CB )) or resseq 136:139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resseq 141:144 or resseq 146:161)) ; 1 2 6 B GLY 4 . B TYR 166 . B GLY -1 B TYR 161 ? ;(chain B and (resseq 0:12 or (resid 13 and (name N or name CA or name C or name O or name CB )) or resseq 14:16 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resseq 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:64 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resseq 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resseq 70:75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resseq 77:78 or (resid 80 and (name N or name C or name O or name CA or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB )) or resseq 82:95 or (resid 96 and (name N or name CA or name C or name O or name CB )) or resseq 97:103 or resseq 105:118 or (resid 119 and (name N or name CA or name C or name O or name CB )) or resseq 120:132 or (resid 133 and (name N or name CA or name C or name O or name CB )) or resseq 134 or (resid 135 and (name N or name CA or name C or name O or name CB )) or resseq 136:139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resseq 141:144 or resseq 146:161)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7DWS _struct.title 'The structure of T4 Lysozyme I3C/C54T/R125C/E128C complex with Zinc ions' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DWS _struct_keywords.text 'muramidase, enzyme, mutant, metal ion, ANTIMICROBIAL PROTEIN, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 3 ? I N N 3 ? J N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 7 ? GLU A 16 ? ASN A 2 GLU A 11 1 ? 10 HELX_P HELX_P2 AA2 SER A 43 ? ILE A 55 ? SER A 38 ILE A 50 1 ? 13 HELX_P HELX_P3 AA3 THR A 64 ? LEU A 84 ? THR A 59 LEU A 79 1 ? 21 HELX_P HELX_P4 AA4 LYS A 88 ? ASP A 94 ? LYS A 83 ASP A 89 1 ? 7 HELX_P HELX_P5 AA5 ASP A 97 ? GLY A 112 ? ASP A 92 GLY A 107 1 ? 16 HELX_P HELX_P6 AA6 GLY A 112 ? GLY A 118 ? GLY A 107 GLY A 113 1 ? 7 HELX_P HELX_P7 AA7 PHE A 119 ? MET A 125 ? PHE A 114 MET A 120 1 ? 7 HELX_P HELX_P8 AA8 CYS A 130 ? ALA A 139 ? CYS A 125 ALA A 134 1 ? 10 HELX_P HELX_P9 AA9 SER A 141 ? THR A 147 ? SER A 136 THR A 142 1 ? 7 HELX_P HELX_P10 AB1 THR A 147 ? GLY A 161 ? THR A 142 GLY A 156 1 ? 15 HELX_P HELX_P11 AB2 TRP A 163 ? LYS A 167 ? TRP A 158 LYS A 162 5 ? 5 HELX_P HELX_P12 AB3 ASN B 7 ? GLU B 16 ? ASN B 2 GLU B 11 1 ? 10 HELX_P HELX_P13 AB4 THR B 64 ? ARG B 85 ? THR B 59 ARG B 80 1 ? 22 HELX_P HELX_P14 AB5 LEU B 89 ? LEU B 96 ? LEU B 84 LEU B 91 1 ? 8 HELX_P HELX_P15 AB6 ASP B 97 ? GLY B 112 ? ASP B 92 GLY B 107 1 ? 16 HELX_P HELX_P16 AB7 GLY B 112 ? GLY B 118 ? GLY B 107 GLY B 113 1 ? 7 HELX_P HELX_P17 AB8 PHE B 119 ? GLN B 128 ? PHE B 114 GLN B 123 1 ? 10 HELX_P HELX_P18 AB9 CYS B 130 ? LEU B 138 ? CYS B 125 LEU B 133 1 ? 9 HELX_P HELX_P19 AC1 SER B 141 ? THR B 147 ? SER B 136 THR B 142 1 ? 7 HELX_P HELX_P20 AC2 THR B 147 ? GLY B 161 ? THR B 142 GLY B 156 1 ? 15 HELX_P HELX_P21 AC3 ASN C 7 ? GLU C 16 ? ASN C 2 GLU C 11 1 ? 10 HELX_P HELX_P22 AC4 LYS C 65 ? ARG C 85 ? LYS C 60 ARG C 80 1 ? 21 HELX_P HELX_P23 AC5 LEU C 89 ? LEU C 96 ? LEU C 84 LEU C 91 1 ? 8 HELX_P HELX_P24 AC6 ASP C 97 ? MET C 111 ? ASP C 92 MET C 106 1 ? 15 HELX_P HELX_P25 AC7 GLY C 112 ? GLY C 118 ? GLY C 107 GLY C 113 1 ? 7 HELX_P HELX_P26 AC8 PHE C 119 ? GLN C 128 ? PHE C 114 GLN C 123 1 ? 10 HELX_P HELX_P27 AC9 CYS C 130 ? LEU C 138 ? CYS C 125 LEU C 133 1 ? 9 HELX_P HELX_P28 AD1 SER C 141 ? THR C 147 ? SER C 136 THR C 142 1 ? 7 HELX_P HELX_P29 AD2 PRO C 148 ? GLY C 161 ? PRO C 143 GLY C 156 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? B CYS 8 SG ? ? ? 1_555 B CYS 102 SG ? ? B CYS 3 B CYS 97 1_555 ? ? ? ? ? ? ? 2.028 ? ? metalc1 metalc ? ? A CYS 130 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 125 A ZN 201 1_555 ? ? ? ? ? ? ? 2.651 ? ? metalc2 metalc ? ? A CYS 133 SG ? ? ? 1_555 F ZN . ZN ? ? A CYS 128 B ZN 202 10_554 ? ? ? ? ? ? ? 2.455 ? ? metalc3 metalc ? ? D ZN . ZN ? ? ? 10_554 C CYS 130 SG ? ? A ZN 201 C CYS 125 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc4 metalc ? ? B CYS 133 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 128 B ZN 202 1_555 ? ? ? ? ? ? ? 2.515 ? ? metalc5 metalc ? ? E ZN . ZN ? ? ? 1_555 C CYS 130 SG ? ? B ZN 201 C CYS 125 1_555 ? ? ? ? ? ? ? 2.726 ? ? metalc6 metalc ? ? F ZN . ZN ? ? ? 1_555 C CYS 133 SG ? ? B ZN 202 C CYS 128 1_555 ? ? ? ? ? ? ? 2.663 ? ? metalc7 metalc ? ? C CYS 133 SG ? ? ? 1_555 G ZN . ZN ? ? C CYS 128 C ZN 201 1_555 ? ? ? ? ? ? ? 2.708 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 31 ? ILE A 32 ? THR A 26 ILE A 27 AA1 2 HIS A 36 ? LEU A 37 ? HIS A 31 LEU A 32 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 32 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id HIS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 36 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id HIS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 31 # _atom_sites.entry_id 7DWS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009722 _atom_sites.fract_transf_matrix[1][2] 0.005613 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011226 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004089 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 PRO 2 -3 ? ? ? A . n A 1 3 LEU 3 -2 ? ? ? A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 ASN 7 2 2 ASN ASN A . n A 1 8 CYS 8 3 3 CYS CYS A . n A 1 9 PHE 9 4 4 PHE PHE A . n A 1 10 GLU 10 5 5 GLU GLU A . n A 1 11 MET 11 6 6 MET MET A . n A 1 12 LEU 12 7 7 LEU LEU A . n A 1 13 ARG 13 8 8 ARG ARG A . n A 1 14 ILE 14 9 9 ILE ILE A . n A 1 15 ASP 15 10 10 ASP ASP A . n A 1 16 GLU 16 11 11 GLU GLU A . n A 1 17 GLY 17 12 12 GLY GLY A . n A 1 18 LEU 18 13 13 LEU LEU A . n A 1 19 ARG 19 14 14 ARG ARG A . n A 1 20 LEU 20 15 15 LEU LEU A . n A 1 21 LYS 21 16 16 LYS LYS A . n A 1 22 ILE 22 17 17 ILE ILE A . n A 1 23 TYR 23 18 18 TYR TYR A . n A 1 24 LYS 24 19 19 LYS LYS A . n A 1 25 ASP 25 20 20 ASP ASP A . n A 1 26 THR 26 21 21 THR THR A . n A 1 27 GLU 27 22 22 GLU GLU A . n A 1 28 GLY 28 23 23 GLY GLY A . n A 1 29 TYR 29 24 24 TYR TYR A . n A 1 30 TYR 30 25 25 TYR TYR A . n A 1 31 THR 31 26 26 THR THR A . n A 1 32 ILE 32 27 27 ILE ILE A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ILE 34 29 29 ILE ILE A . n A 1 35 GLY 35 30 30 GLY GLY A . n A 1 36 HIS 36 31 31 HIS HIS A . n A 1 37 LEU 37 32 32 LEU LEU A . n A 1 38 LEU 38 33 33 LEU LEU A . n A 1 39 THR 39 34 34 THR THR A . n A 1 40 LYS 40 35 35 LYS LYS A . n A 1 41 SER 41 36 36 SER SER A . n A 1 42 PRO 42 37 37 PRO PRO A . n A 1 43 SER 43 38 38 SER SER A . n A 1 44 LEU 44 39 39 LEU LEU A . n A 1 45 ASN 45 40 40 ASN ASN A . n A 1 46 ALA 46 41 41 ALA ALA A . n A 1 47 ALA 47 42 42 ALA ALA A . n A 1 48 LYS 48 43 43 LYS LYS A . n A 1 49 SER 49 44 44 SER SER A . n A 1 50 GLU 50 45 45 GLU GLU A . n A 1 51 LEU 51 46 46 LEU LEU A . n A 1 52 ASP 52 47 47 ASP ASP A . n A 1 53 LYS 53 48 48 LYS LYS A . n A 1 54 ALA 54 49 49 ALA ALA A . n A 1 55 ILE 55 50 50 ILE ILE A . n A 1 56 GLY 56 51 51 GLY GLY A . n A 1 57 ARG 57 52 52 ARG ARG A . n A 1 58 ASN 58 53 53 ASN ASN A . n A 1 59 THR 59 54 54 THR THR A . n A 1 60 ASN 60 55 55 ASN ASN A . n A 1 61 GLY 61 56 56 GLY GLY A . n A 1 62 VAL 62 57 57 VAL VAL A . n A 1 63 ILE 63 58 58 ILE ILE A . n A 1 64 THR 64 59 59 THR THR A . n A 1 65 LYS 65 60 60 LYS LYS A . n A 1 66 ASP 66 61 61 ASP ASP A . n A 1 67 GLU 67 62 62 GLU GLU A . n A 1 68 ALA 68 63 63 ALA ALA A . n A 1 69 GLU 69 64 64 GLU GLU A . n A 1 70 LYS 70 65 65 LYS LYS A . n A 1 71 LEU 71 66 66 LEU LEU A . n A 1 72 PHE 72 67 67 PHE PHE A . n A 1 73 ASN 73 68 68 ASN ASN A . n A 1 74 GLN 74 69 69 GLN GLN A . n A 1 75 ASP 75 70 70 ASP ASP A . n A 1 76 VAL 76 71 71 VAL VAL A . n A 1 77 ASP 77 72 72 ASP ASP A . n A 1 78 ALA 78 73 73 ALA ALA A . n A 1 79 ALA 79 74 74 ALA ALA A . n A 1 80 VAL 80 75 75 VAL VAL A . n A 1 81 ARG 81 76 76 ARG ARG A . n A 1 82 GLY 82 77 77 GLY GLY A . n A 1 83 ILE 83 78 78 ILE ILE A . n A 1 84 LEU 84 79 79 LEU LEU A . n A 1 85 ARG 85 80 80 ARG ARG A . n A 1 86 ASN 86 81 81 ASN ASN A . n A 1 87 ALA 87 82 82 ALA ALA A . n A 1 88 LYS 88 83 83 LYS LYS A . n A 1 89 LEU 89 84 84 LEU LEU A . n A 1 90 LYS 90 85 85 LYS LYS A . n A 1 91 PRO 91 86 86 PRO PRO A . n A 1 92 VAL 92 87 87 VAL VAL A . n A 1 93 TYR 93 88 88 TYR TYR A . n A 1 94 ASP 94 89 89 ASP ASP A . n A 1 95 SER 95 90 90 SER SER A . n A 1 96 LEU 96 91 91 LEU LEU A . n A 1 97 ASP 97 92 92 ASP ASP A . n A 1 98 ALA 98 93 93 ALA ALA A . n A 1 99 VAL 99 94 94 VAL VAL A . n A 1 100 ARG 100 95 95 ARG ARG A . n A 1 101 ARG 101 96 96 ARG ARG A . n A 1 102 CYS 102 97 97 CYS CYS A . n A 1 103 ALA 103 98 98 ALA ALA A . n A 1 104 LEU 104 99 99 LEU LEU A . n A 1 105 ILE 105 100 100 ILE ILE A . n A 1 106 ASN 106 101 101 ASN ASN A . n A 1 107 MET 107 102 102 MET MET A . n A 1 108 VAL 108 103 103 VAL VAL A . n A 1 109 PHE 109 104 104 PHE PHE A . n A 1 110 GLN 110 105 105 GLN GLN A . n A 1 111 MET 111 106 106 MET MET A . n A 1 112 GLY 112 107 107 GLY GLY A . n A 1 113 GLU 113 108 108 GLU GLU A . n A 1 114 THR 114 109 109 THR THR A . n A 1 115 GLY 115 110 110 GLY GLY A . n A 1 116 VAL 116 111 111 VAL VAL A . n A 1 117 ALA 117 112 112 ALA ALA A . n A 1 118 GLY 118 113 113 GLY GLY A . n A 1 119 PHE 119 114 114 PHE PHE A . n A 1 120 THR 120 115 115 THR THR A . n A 1 121 ASN 121 116 116 ASN ASN A . n A 1 122 SER 122 117 117 SER SER A . n A 1 123 LEU 123 118 118 LEU LEU A . n A 1 124 ARG 124 119 119 ARG ARG A . n A 1 125 MET 125 120 120 MET MET A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 GLN 127 122 122 GLN GLN A . n A 1 128 GLN 128 123 123 GLN GLN A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 CYS 130 125 125 CYS CYS A . n A 1 131 TRP 131 126 126 TRP TRP A . n A 1 132 ASP 132 127 127 ASP ASP A . n A 1 133 CYS 133 128 128 CYS CYS A . n A 1 134 ALA 134 129 129 ALA ALA A . n A 1 135 ALA 135 130 130 ALA ALA A . n A 1 136 VAL 136 131 131 VAL VAL A . n A 1 137 ASN 137 132 132 ASN ASN A . n A 1 138 LEU 138 133 133 LEU LEU A . n A 1 139 ALA 139 134 134 ALA ALA A . n A 1 140 LYS 140 135 135 LYS LYS A . n A 1 141 SER 141 136 136 SER SER A . n A 1 142 ARG 142 137 137 ARG ARG A . n A 1 143 TRP 143 138 138 TRP TRP A . n A 1 144 TYR 144 139 139 TYR TYR A . n A 1 145 ASN 145 140 140 ASN ASN A . n A 1 146 GLN 146 141 141 GLN GLN A . n A 1 147 THR 147 142 142 THR THR A . n A 1 148 PRO 148 143 143 PRO PRO A . n A 1 149 ASN 149 144 144 ASN ASN A . n A 1 150 ARG 150 145 145 ARG ARG A . n A 1 151 ALA 151 146 146 ALA ALA A . n A 1 152 LYS 152 147 147 LYS LYS A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 VAL 154 149 149 VAL VAL A . n A 1 155 ILE 155 150 150 ILE ILE A . n A 1 156 THR 156 151 151 THR THR A . n A 1 157 THR 157 152 152 THR THR A . n A 1 158 PHE 158 153 153 PHE PHE A . n A 1 159 ARG 159 154 154 ARG ARG A . n A 1 160 THR 160 155 155 THR THR A . n A 1 161 GLY 161 156 156 GLY GLY A . n A 1 162 THR 162 157 157 THR THR A . n A 1 163 TRP 163 158 158 TRP TRP A . n A 1 164 ASP 164 159 159 ASP ASP A . n A 1 165 ALA 165 160 160 ALA ALA A . n A 1 166 TYR 166 161 161 TYR TYR A . n A 1 167 LYS 167 162 162 LYS LYS A . n A 1 168 GLY 168 163 ? ? ? A . n A 1 169 GLY 169 164 ? ? ? A . n A 1 170 GLY 170 165 ? ? ? A . n A 1 171 GLY 171 166 ? ? ? A . n A 1 172 ARG 172 167 ? ? ? A . n A 1 173 GLY 173 168 ? ? ? A . n A 1 174 ASP 174 169 ? ? ? A . n A 1 175 SER 175 170 ? ? ? A . n A 1 176 PRO 176 171 ? ? ? A . n B 1 1 GLY 1 -4 ? ? ? B . n B 1 2 PRO 2 -3 ? ? ? B . n B 1 3 LEU 3 -2 ? ? ? B . n B 1 4 GLY 4 -1 -1 GLY GLY B . n B 1 5 SER 5 0 0 SER SER B . n B 1 6 MET 6 1 1 MET MET B . n B 1 7 ASN 7 2 2 ASN ASN B . n B 1 8 CYS 8 3 3 CYS CYS B . n B 1 9 PHE 9 4 4 PHE PHE B . n B 1 10 GLU 10 5 5 GLU GLU B . n B 1 11 MET 11 6 6 MET MET B . n B 1 12 LEU 12 7 7 LEU LEU B . n B 1 13 ARG 13 8 8 ARG ARG B . n B 1 14 ILE 14 9 9 ILE ILE B . n B 1 15 ASP 15 10 10 ASP ASP B . n B 1 16 GLU 16 11 11 GLU GLU B . n B 1 17 GLY 17 12 12 GLY GLY B . n B 1 18 LEU 18 13 13 LEU LEU B . n B 1 19 ARG 19 14 14 ARG ARG B . n B 1 20 LEU 20 15 15 LEU LEU B . n B 1 21 LYS 21 16 16 LYS LYS B . n B 1 22 ILE 22 17 17 ILE ILE B . n B 1 23 TYR 23 18 18 TYR TYR B . n B 1 24 LYS 24 19 19 LYS LYS B . n B 1 25 ASP 25 20 20 ASP ASP B . n B 1 26 THR 26 21 21 THR THR B . n B 1 27 GLU 27 22 22 GLU GLU B . n B 1 28 GLY 28 23 ? ? ? B . n B 1 29 TYR 29 24 ? ? ? B . n B 1 30 TYR 30 25 25 TYR TYR B . n B 1 31 THR 31 26 26 THR THR B . n B 1 32 ILE 32 27 ? ? ? B . n B 1 33 GLY 33 28 ? ? ? B . n B 1 34 ILE 34 29 ? ? ? B . n B 1 35 GLY 35 30 30 GLY GLY B . n B 1 36 HIS 36 31 31 HIS HIS B . n B 1 37 LEU 37 32 32 LEU LEU B . n B 1 38 LEU 38 33 ? ? ? B . n B 1 39 THR 39 34 ? ? ? B . n B 1 40 LYS 40 35 ? ? ? B . n B 1 41 SER 41 36 ? ? ? B . n B 1 42 PRO 42 37 ? ? ? B . n B 1 43 SER 43 38 ? ? ? B . n B 1 44 LEU 44 39 ? ? ? B . n B 1 45 ASN 45 40 ? ? ? B . n B 1 46 ALA 46 41 ? ? ? B . n B 1 47 ALA 47 42 ? ? ? B . n B 1 48 LYS 48 43 ? ? ? B . n B 1 49 SER 49 44 ? ? ? B . n B 1 50 GLU 50 45 ? ? ? B . n B 1 51 LEU 51 46 ? ? ? B . n B 1 52 ASP 52 47 ? ? ? B . n B 1 53 LYS 53 48 ? ? ? B . n B 1 54 ALA 54 49 ? ? ? B . n B 1 55 ILE 55 50 ? ? ? B . n B 1 56 GLY 56 51 ? ? ? B . n B 1 57 ARG 57 52 ? ? ? B . n B 1 58 ASN 58 53 ? ? ? B . n B 1 59 THR 59 54 ? ? ? B . n B 1 60 ASN 60 55 ? ? ? B . n B 1 61 GLY 61 56 ? ? ? B . n B 1 62 VAL 62 57 ? ? ? B . n B 1 63 ILE 63 58 58 ILE ILE B . n B 1 64 THR 64 59 59 THR THR B . n B 1 65 LYS 65 60 60 LYS LYS B . n B 1 66 ASP 66 61 61 ASP ASP B . n B 1 67 GLU 67 62 62 GLU GLU B . n B 1 68 ALA 68 63 63 ALA ALA B . n B 1 69 GLU 69 64 64 GLU GLU B . n B 1 70 LYS 70 65 65 LYS LYS B . n B 1 71 LEU 71 66 66 LEU LEU B . n B 1 72 PHE 72 67 67 PHE PHE B . n B 1 73 ASN 73 68 68 ASN ASN B . n B 1 74 GLN 74 69 69 GLN GLN B . n B 1 75 ASP 75 70 70 ASP ASP B . n B 1 76 VAL 76 71 71 VAL VAL B . n B 1 77 ASP 77 72 72 ASP ASP B . n B 1 78 ALA 78 73 73 ALA ALA B . n B 1 79 ALA 79 74 74 ALA ALA B . n B 1 80 VAL 80 75 75 VAL VAL B . n B 1 81 ARG 81 76 76 ARG ARG B . n B 1 82 GLY 82 77 77 GLY GLY B . n B 1 83 ILE 83 78 78 ILE ILE B . n B 1 84 LEU 84 79 79 LEU LEU B . n B 1 85 ARG 85 80 80 ARG ARG B . n B 1 86 ASN 86 81 81 ASN ASN B . n B 1 87 ALA 87 82 82 ALA ALA B . n B 1 88 LYS 88 83 83 LYS LYS B . n B 1 89 LEU 89 84 84 LEU LEU B . n B 1 90 LYS 90 85 85 LYS LYS B . n B 1 91 PRO 91 86 86 PRO PRO B . n B 1 92 VAL 92 87 87 VAL VAL B . n B 1 93 TYR 93 88 88 TYR TYR B . n B 1 94 ASP 94 89 89 ASP ASP B . n B 1 95 SER 95 90 90 SER SER B . n B 1 96 LEU 96 91 91 LEU LEU B . n B 1 97 ASP 97 92 92 ASP ASP B . n B 1 98 ALA 98 93 93 ALA ALA B . n B 1 99 VAL 99 94 94 VAL VAL B . n B 1 100 ARG 100 95 95 ARG ARG B . n B 1 101 ARG 101 96 96 ARG ARG B . n B 1 102 CYS 102 97 97 CYS CYS B . n B 1 103 ALA 103 98 98 ALA ALA B . n B 1 104 LEU 104 99 99 LEU LEU B . n B 1 105 ILE 105 100 100 ILE ILE B . n B 1 106 ASN 106 101 101 ASN ASN B . n B 1 107 MET 107 102 102 MET MET B . n B 1 108 VAL 108 103 103 VAL VAL B . n B 1 109 PHE 109 104 104 PHE PHE B . n B 1 110 GLN 110 105 105 GLN GLN B . n B 1 111 MET 111 106 106 MET MET B . n B 1 112 GLY 112 107 107 GLY GLY B . n B 1 113 GLU 113 108 108 GLU GLU B . n B 1 114 THR 114 109 109 THR THR B . n B 1 115 GLY 115 110 110 GLY GLY B . n B 1 116 VAL 116 111 111 VAL VAL B . n B 1 117 ALA 117 112 112 ALA ALA B . n B 1 118 GLY 118 113 113 GLY GLY B . n B 1 119 PHE 119 114 114 PHE PHE B . n B 1 120 THR 120 115 115 THR THR B . n B 1 121 ASN 121 116 116 ASN ASN B . n B 1 122 SER 122 117 117 SER SER B . n B 1 123 LEU 123 118 118 LEU LEU B . n B 1 124 ARG 124 119 119 ARG ARG B . n B 1 125 MET 125 120 120 MET MET B . n B 1 126 LEU 126 121 121 LEU LEU B . n B 1 127 GLN 127 122 122 GLN GLN B . n B 1 128 GLN 128 123 123 GLN GLN B . n B 1 129 LYS 129 124 124 LYS LYS B . n B 1 130 CYS 130 125 125 CYS CYS B . n B 1 131 TRP 131 126 126 TRP TRP B . n B 1 132 ASP 132 127 127 ASP ASP B . n B 1 133 CYS 133 128 128 CYS CYS B . n B 1 134 ALA 134 129 129 ALA ALA B . n B 1 135 ALA 135 130 130 ALA ALA B . n B 1 136 VAL 136 131 131 VAL VAL B . n B 1 137 ASN 137 132 132 ASN ASN B . n B 1 138 LEU 138 133 133 LEU LEU B . n B 1 139 ALA 139 134 134 ALA ALA B . n B 1 140 LYS 140 135 135 LYS LYS B . n B 1 141 SER 141 136 136 SER SER B . n B 1 142 ARG 142 137 137 ARG ARG B . n B 1 143 TRP 143 138 138 TRP TRP B . n B 1 144 TYR 144 139 139 TYR TYR B . n B 1 145 ASN 145 140 140 ASN ASN B . n B 1 146 GLN 146 141 141 GLN GLN B . n B 1 147 THR 147 142 142 THR THR B . n B 1 148 PRO 148 143 143 PRO PRO B . n B 1 149 ASN 149 144 144 ASN ASN B . n B 1 150 ARG 150 145 145 ARG ARG B . n B 1 151 ALA 151 146 146 ALA ALA B . n B 1 152 LYS 152 147 147 LYS LYS B . n B 1 153 ARG 153 148 148 ARG ARG B . n B 1 154 VAL 154 149 149 VAL VAL B . n B 1 155 ILE 155 150 150 ILE ILE B . n B 1 156 THR 156 151 151 THR THR B . n B 1 157 THR 157 152 152 THR THR B . n B 1 158 PHE 158 153 153 PHE PHE B . n B 1 159 ARG 159 154 154 ARG ARG B . n B 1 160 THR 160 155 155 THR THR B . n B 1 161 GLY 161 156 156 GLY GLY B . n B 1 162 THR 162 157 157 THR THR B . n B 1 163 TRP 163 158 158 TRP TRP B . n B 1 164 ASP 164 159 159 ASP ASP B . n B 1 165 ALA 165 160 160 ALA ALA B . n B 1 166 TYR 166 161 161 TYR TYR B . n B 1 167 LYS 167 162 ? ? ? B . n B 1 168 GLY 168 163 ? ? ? B . n B 1 169 GLY 169 164 ? ? ? B . n B 1 170 GLY 170 165 ? ? ? B . n B 1 171 GLY 171 166 ? ? ? B . n B 1 172 ARG 172 167 ? ? ? B . n B 1 173 GLY 173 168 ? ? ? B . n B 1 174 ASP 174 169 ? ? ? B . n B 1 175 SER 175 170 ? ? ? B . n B 1 176 PRO 176 171 ? ? ? B . n C 1 1 GLY 1 -4 ? ? ? C . n C 1 2 PRO 2 -3 ? ? ? C . n C 1 3 LEU 3 -2 ? ? ? C . n C 1 4 GLY 4 -1 ? ? ? C . n C 1 5 SER 5 0 0 SER SER C . n C 1 6 MET 6 1 1 MET MET C . n C 1 7 ASN 7 2 2 ASN ASN C . n C 1 8 CYS 8 3 3 CYS CYS C . n C 1 9 PHE 9 4 4 PHE PHE C . n C 1 10 GLU 10 5 5 GLU GLU C . n C 1 11 MET 11 6 6 MET MET C . n C 1 12 LEU 12 7 7 LEU LEU C . n C 1 13 ARG 13 8 8 ARG ARG C . n C 1 14 ILE 14 9 9 ILE ILE C . n C 1 15 ASP 15 10 10 ASP ASP C . n C 1 16 GLU 16 11 11 GLU GLU C . n C 1 17 GLY 17 12 12 GLY GLY C . n C 1 18 LEU 18 13 13 LEU LEU C . n C 1 19 ARG 19 14 14 ARG ARG C . n C 1 20 LEU 20 15 15 LEU LEU C . n C 1 21 LYS 21 16 16 LYS LYS C . n C 1 22 ILE 22 17 ? ? ? C . n C 1 23 TYR 23 18 ? ? ? C . n C 1 24 LYS 24 19 ? ? ? C . n C 1 25 ASP 25 20 ? ? ? C . n C 1 26 THR 26 21 ? ? ? C . n C 1 27 GLU 27 22 ? ? ? C . n C 1 28 GLY 28 23 ? ? ? C . n C 1 29 TYR 29 24 ? ? ? C . n C 1 30 TYR 30 25 ? ? ? C . n C 1 31 THR 31 26 ? ? ? C . n C 1 32 ILE 32 27 ? ? ? C . n C 1 33 GLY 33 28 28 GLY GLY C . n C 1 34 ILE 34 29 29 ILE ILE C . n C 1 35 GLY 35 30 30 GLY GLY C . n C 1 36 HIS 36 31 ? ? ? C . n C 1 37 LEU 37 32 ? ? ? C . n C 1 38 LEU 38 33 ? ? ? C . n C 1 39 THR 39 34 ? ? ? C . n C 1 40 LYS 40 35 ? ? ? C . n C 1 41 SER 41 36 ? ? ? C . n C 1 42 PRO 42 37 ? ? ? C . n C 1 43 SER 43 38 ? ? ? C . n C 1 44 LEU 44 39 ? ? ? C . n C 1 45 ASN 45 40 ? ? ? C . n C 1 46 ALA 46 41 ? ? ? C . n C 1 47 ALA 47 42 ? ? ? C . n C 1 48 LYS 48 43 ? ? ? C . n C 1 49 SER 49 44 ? ? ? C . n C 1 50 GLU 50 45 ? ? ? C . n C 1 51 LEU 51 46 ? ? ? C . n C 1 52 ASP 52 47 ? ? ? C . n C 1 53 LYS 53 48 ? ? ? C . n C 1 54 ALA 54 49 ? ? ? C . n C 1 55 ILE 55 50 ? ? ? C . n C 1 56 GLY 56 51 ? ? ? C . n C 1 57 ARG 57 52 ? ? ? C . n C 1 58 ASN 58 53 ? ? ? C . n C 1 59 THR 59 54 ? ? ? C . n C 1 60 ASN 60 55 ? ? ? C . n C 1 61 GLY 61 56 ? ? ? C . n C 1 62 VAL 62 57 ? ? ? C . n C 1 63 ILE 63 58 ? ? ? C . n C 1 64 THR 64 59 59 THR THR C . n C 1 65 LYS 65 60 60 LYS LYS C . n C 1 66 ASP 66 61 61 ASP ASP C . n C 1 67 GLU 67 62 62 GLU GLU C . n C 1 68 ALA 68 63 63 ALA ALA C . n C 1 69 GLU 69 64 64 GLU GLU C . n C 1 70 LYS 70 65 65 LYS LYS C . n C 1 71 LEU 71 66 66 LEU LEU C . n C 1 72 PHE 72 67 67 PHE PHE C . n C 1 73 ASN 73 68 68 ASN ASN C . n C 1 74 GLN 74 69 69 GLN GLN C . n C 1 75 ASP 75 70 70 ASP ASP C . n C 1 76 VAL 76 71 71 VAL VAL C . n C 1 77 ASP 77 72 72 ASP ASP C . n C 1 78 ALA 78 73 73 ALA ALA C . n C 1 79 ALA 79 74 74 ALA ALA C . n C 1 80 VAL 80 75 75 VAL VAL C . n C 1 81 ARG 81 76 76 ARG ARG C . n C 1 82 GLY 82 77 77 GLY GLY C . n C 1 83 ILE 83 78 78 ILE ILE C . n C 1 84 LEU 84 79 79 LEU LEU C . n C 1 85 ARG 85 80 80 ARG ARG C . n C 1 86 ASN 86 81 81 ASN ASN C . n C 1 87 ALA 87 82 82 ALA ALA C . n C 1 88 LYS 88 83 83 LYS LYS C . n C 1 89 LEU 89 84 84 LEU LEU C . n C 1 90 LYS 90 85 85 LYS LYS C . n C 1 91 PRO 91 86 86 PRO PRO C . n C 1 92 VAL 92 87 87 VAL VAL C . n C 1 93 TYR 93 88 88 TYR TYR C . n C 1 94 ASP 94 89 89 ASP ASP C . n C 1 95 SER 95 90 90 SER SER C . n C 1 96 LEU 96 91 91 LEU LEU C . n C 1 97 ASP 97 92 92 ASP ASP C . n C 1 98 ALA 98 93 93 ALA ALA C . n C 1 99 VAL 99 94 94 VAL VAL C . n C 1 100 ARG 100 95 95 ARG ARG C . n C 1 101 ARG 101 96 96 ARG ARG C . n C 1 102 CYS 102 97 97 CYS CYS C . n C 1 103 ALA 103 98 98 ALA ALA C . n C 1 104 LEU 104 99 99 LEU LEU C . n C 1 105 ILE 105 100 100 ILE ILE C . n C 1 106 ASN 106 101 101 ASN ASN C . n C 1 107 MET 107 102 102 MET MET C . n C 1 108 VAL 108 103 103 VAL VAL C . n C 1 109 PHE 109 104 104 PHE PHE C . n C 1 110 GLN 110 105 105 GLN GLN C . n C 1 111 MET 111 106 106 MET MET C . n C 1 112 GLY 112 107 107 GLY GLY C . n C 1 113 GLU 113 108 108 GLU GLU C . n C 1 114 THR 114 109 109 THR THR C . n C 1 115 GLY 115 110 110 GLY GLY C . n C 1 116 VAL 116 111 111 VAL VAL C . n C 1 117 ALA 117 112 112 ALA ALA C . n C 1 118 GLY 118 113 113 GLY GLY C . n C 1 119 PHE 119 114 114 PHE PHE C . n C 1 120 THR 120 115 115 THR THR C . n C 1 121 ASN 121 116 116 ASN ASN C . n C 1 122 SER 122 117 117 SER SER C . n C 1 123 LEU 123 118 118 LEU LEU C . n C 1 124 ARG 124 119 119 ARG ARG C . n C 1 125 MET 125 120 120 MET MET C . n C 1 126 LEU 126 121 121 LEU LEU C . n C 1 127 GLN 127 122 122 GLN GLN C . n C 1 128 GLN 128 123 123 GLN GLN C . n C 1 129 LYS 129 124 124 LYS LYS C . n C 1 130 CYS 130 125 125 CYS CYS C . n C 1 131 TRP 131 126 126 TRP TRP C . n C 1 132 ASP 132 127 127 ASP ASP C . n C 1 133 CYS 133 128 128 CYS CYS C . n C 1 134 ALA 134 129 129 ALA ALA C . n C 1 135 ALA 135 130 130 ALA ALA C . n C 1 136 VAL 136 131 131 VAL VAL C . n C 1 137 ASN 137 132 132 ASN ASN C . n C 1 138 LEU 138 133 133 LEU LEU C . n C 1 139 ALA 139 134 134 ALA ALA C . n C 1 140 LYS 140 135 135 LYS LYS C . n C 1 141 SER 141 136 136 SER SER C . n C 1 142 ARG 142 137 137 ARG ARG C . n C 1 143 TRP 143 138 138 TRP TRP C . n C 1 144 TYR 144 139 139 TYR TYR C . n C 1 145 ASN 145 140 140 ASN ASN C . n C 1 146 GLN 146 141 141 GLN GLN C . n C 1 147 THR 147 142 142 THR THR C . n C 1 148 PRO 148 143 143 PRO PRO C . n C 1 149 ASN 149 144 144 ASN ASN C . n C 1 150 ARG 150 145 145 ARG ARG C . n C 1 151 ALA 151 146 146 ALA ALA C . n C 1 152 LYS 152 147 147 LYS LYS C . n C 1 153 ARG 153 148 148 ARG ARG C . n C 1 154 VAL 154 149 149 VAL VAL C . n C 1 155 ILE 155 150 150 ILE ILE C . n C 1 156 THR 156 151 151 THR THR C . n C 1 157 THR 157 152 152 THR THR C . n C 1 158 PHE 158 153 153 PHE PHE C . n C 1 159 ARG 159 154 154 ARG ARG C . n C 1 160 THR 160 155 155 THR THR C . n C 1 161 GLY 161 156 156 GLY GLY C . n C 1 162 THR 162 157 157 THR THR C . n C 1 163 TRP 163 158 158 TRP TRP C . n C 1 164 ASP 164 159 159 ASP ASP C . n C 1 165 ALA 165 160 160 ALA ALA C . n C 1 166 TYR 166 161 161 TYR TYR C . n C 1 167 LYS 167 162 162 LYS LYS C . n C 1 168 GLY 168 163 ? ? ? C . n C 1 169 GLY 169 164 ? ? ? C . n C 1 170 GLY 170 165 ? ? ? C . n C 1 171 GLY 171 166 ? ? ? C . n C 1 172 ARG 172 167 ? ? ? C . n C 1 173 GLY 173 168 ? ? ? C . n C 1 174 ASP 174 169 ? ? ? C . n C 1 175 SER 175 170 ? ? ? C . n C 1 176 PRO 176 171 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 ZN 1 201 1 ZN ZN A . E 2 ZN 1 201 3 ZN ZN B . F 2 ZN 1 202 4 ZN ZN B . G 2 ZN 1 201 5 ZN ZN C . H 3 HOH 1 301 21 HOH HOH A . H 3 HOH 2 302 7 HOH HOH A . H 3 HOH 3 303 19 HOH HOH A . H 3 HOH 4 304 6 HOH HOH A . H 3 HOH 5 305 5 HOH HOH A . I 3 HOH 1 301 9 HOH HOH B . I 3 HOH 2 302 15 HOH HOH B . I 3 HOH 3 303 18 HOH HOH B . J 3 HOH 1 301 10 HOH HOH C . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 3 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D,H 2 1 B,E,F,I 3 1 C,G,J # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8510 ? 2 'ABSA (A^2)' 60 ? 2 MORE -19 ? 2 'SSA (A^2)' 7720 ? 3 'ABSA (A^2)' 60 ? 3 MORE -17 ? 3 'SSA (A^2)' 6620 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 303 ? H HOH . 2 1 A HOH 305 ? H HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 130 ? A CYS 125 ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 SG ? C CYS 130 ? C CYS 125 ? 1_555 81.4 ? 2 SG ? A CYS 133 ? A CYS 128 ? 1_555 ZN ? F ZN . ? B ZN 202 ? 10_554 SG ? B CYS 133 ? B CYS 128 ? 1_555 74.4 ? 3 SG ? A CYS 133 ? A CYS 128 ? 1_555 ZN ? F ZN . ? B ZN 202 ? 10_554 SG ? C CYS 133 ? C CYS 128 ? 1_555 76.9 ? 4 SG ? B CYS 133 ? B CYS 128 ? 1_555 ZN ? F ZN . ? B ZN 202 ? 10_554 SG ? C CYS 133 ? C CYS 128 ? 1_555 9.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-02 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 5 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 9 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 10 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -35.2088 _pdbx_refine_tls.origin_y 22.9309 _pdbx_refine_tls.origin_z -29.5737 _pdbx_refine_tls.T[1][1] 1.6612 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.9314 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0401 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.4577 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0509 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.6704 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.1492 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.4342 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.0458 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.5559 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.2702 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.2859 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.1133 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0311 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1595 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1995 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.1584 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.1455 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1257 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.2949 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.4120 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A -1 ? ? ? A 162 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? B -1 ? ? ? B 161 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? C 0 ? ? ? C 162 ? ? all 4 'X-RAY DIFFRACTION' 1 ? ? D 1 ? ? ? D 5 ? ? all 5 'X-RAY DIFFRACTION' 1 ? ? E 5 ? ? ? E 23 ? ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7DWS _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 ND2 B ASN 81 ? ? OE2 B GLU 108 ? ? 2.04 2 1 O B TYR 88 ? ? NH1 B ARG 96 ? ? 2.09 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 18 ? ? -131.72 -131.54 2 1 GLU A 22 ? ? 170.35 23.56 3 1 THR A 34 ? ? 179.21 154.71 4 1 LYS A 35 ? ? -95.27 37.52 5 1 ASN A 55 ? ? -94.12 43.08 6 1 ASP A 89 ? ? -67.51 7.22 7 1 CYS A 125 ? ? -101.97 76.41 8 1 ASP B 20 ? ? -111.15 -158.55 9 1 LYS B 135 ? ? -114.40 66.18 10 1 ARG C 80 ? ? -65.85 8.20 11 1 LYS C 135 ? ? -114.91 63.52 12 1 PRO C 143 ? ? -79.10 -87.89 13 1 TYR C 161 ? ? -126.87 -50.95 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 305 ? 8.75 . 2 1 O ? B HOH 301 ? 7.31 . 3 1 O ? B HOH 302 ? 7.42 . 4 1 O ? B HOH 303 ? 8.41 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 8 ? CG ? A ARG 13 CG 2 1 Y 1 A ARG 8 ? CD ? A ARG 13 CD 3 1 Y 1 A ARG 8 ? NE ? A ARG 13 NE 4 1 Y 1 A ARG 8 ? CZ ? A ARG 13 CZ 5 1 Y 1 A ARG 8 ? NH1 ? A ARG 13 NH1 6 1 Y 1 A ARG 8 ? NH2 ? A ARG 13 NH2 7 1 Y 1 A ARG 14 ? CG ? A ARG 19 CG 8 1 Y 1 A ARG 14 ? CD ? A ARG 19 CD 9 1 Y 1 A ARG 14 ? NE ? A ARG 19 NE 10 1 Y 1 A ARG 14 ? CZ ? A ARG 19 CZ 11 1 Y 1 A ARG 14 ? NH1 ? A ARG 19 NH1 12 1 Y 1 A ARG 14 ? NH2 ? A ARG 19 NH2 13 1 Y 1 A LYS 16 ? CG ? A LYS 21 CG 14 1 Y 1 A LYS 16 ? CD ? A LYS 21 CD 15 1 Y 1 A LYS 16 ? CE ? A LYS 21 CE 16 1 Y 1 A LYS 16 ? NZ ? A LYS 21 NZ 17 1 Y 1 A TYR 18 ? CG ? A TYR 23 CG 18 1 Y 1 A TYR 18 ? CD1 ? A TYR 23 CD1 19 1 Y 1 A TYR 18 ? CD2 ? A TYR 23 CD2 20 1 Y 1 A TYR 18 ? CE1 ? A TYR 23 CE1 21 1 Y 1 A TYR 18 ? CE2 ? A TYR 23 CE2 22 1 Y 1 A TYR 18 ? CZ ? A TYR 23 CZ 23 1 Y 1 A TYR 18 ? OH ? A TYR 23 OH 24 1 Y 1 A LYS 19 ? CG ? A LYS 24 CG 25 1 Y 1 A LYS 19 ? CD ? A LYS 24 CD 26 1 Y 1 A LYS 19 ? CE ? A LYS 24 CE 27 1 Y 1 A LYS 19 ? NZ ? A LYS 24 NZ 28 1 Y 1 A ASP 20 ? CG ? A ASP 25 CG 29 1 Y 1 A ASP 20 ? OD1 ? A ASP 25 OD1 30 1 Y 1 A ASP 20 ? OD2 ? A ASP 25 OD2 31 1 Y 1 A GLU 22 ? CG ? A GLU 27 CG 32 1 Y 1 A GLU 22 ? CD ? A GLU 27 CD 33 1 Y 1 A GLU 22 ? OE1 ? A GLU 27 OE1 34 1 Y 1 A GLU 22 ? OE2 ? A GLU 27 OE2 35 1 Y 1 A TYR 24 ? CG ? A TYR 29 CG 36 1 Y 1 A TYR 24 ? CD1 ? A TYR 29 CD1 37 1 Y 1 A TYR 24 ? CD2 ? A TYR 29 CD2 38 1 Y 1 A TYR 24 ? CE1 ? A TYR 29 CE1 39 1 Y 1 A TYR 24 ? CE2 ? A TYR 29 CE2 40 1 Y 1 A TYR 24 ? CZ ? A TYR 29 CZ 41 1 Y 1 A TYR 24 ? OH ? A TYR 29 OH 42 1 Y 1 A ILE 27 ? CG1 ? A ILE 32 CG1 43 1 Y 1 A ILE 27 ? CG2 ? A ILE 32 CG2 44 1 Y 1 A ILE 27 ? CD1 ? A ILE 32 CD1 45 1 Y 1 A LEU 32 ? CG ? A LEU 37 CG 46 1 Y 1 A LEU 32 ? CD1 ? A LEU 37 CD1 47 1 Y 1 A LEU 32 ? CD2 ? A LEU 37 CD2 48 1 Y 1 A LYS 35 ? CG ? A LYS 40 CG 49 1 Y 1 A LYS 35 ? CD ? A LYS 40 CD 50 1 Y 1 A LYS 35 ? CE ? A LYS 40 CE 51 1 Y 1 A LYS 35 ? NZ ? A LYS 40 NZ 52 1 Y 1 A LEU 39 ? CG ? A LEU 44 CG 53 1 Y 1 A LEU 39 ? CD1 ? A LEU 44 CD1 54 1 Y 1 A LEU 39 ? CD2 ? A LEU 44 CD2 55 1 Y 1 A LYS 43 ? CG ? A LYS 48 CG 56 1 Y 1 A LYS 43 ? CD ? A LYS 48 CD 57 1 Y 1 A LYS 43 ? CE ? A LYS 48 CE 58 1 Y 1 A LYS 43 ? NZ ? A LYS 48 NZ 59 1 Y 1 A GLU 45 ? CG ? A GLU 50 CG 60 1 Y 1 A GLU 45 ? CD ? A GLU 50 CD 61 1 Y 1 A GLU 45 ? OE1 ? A GLU 50 OE1 62 1 Y 1 A GLU 45 ? OE2 ? A GLU 50 OE2 63 1 Y 1 A ASP 47 ? CG ? A ASP 52 CG 64 1 Y 1 A ASP 47 ? OD1 ? A ASP 52 OD1 65 1 Y 1 A ASP 47 ? OD2 ? A ASP 52 OD2 66 1 Y 1 A LYS 48 ? CG ? A LYS 53 CG 67 1 Y 1 A LYS 48 ? CD ? A LYS 53 CD 68 1 Y 1 A LYS 48 ? CE ? A LYS 53 CE 69 1 Y 1 A LYS 48 ? NZ ? A LYS 53 NZ 70 1 Y 1 A ARG 52 ? CG ? A ARG 57 CG 71 1 Y 1 A ARG 52 ? CD ? A ARG 57 CD 72 1 Y 1 A ARG 52 ? NE ? A ARG 57 NE 73 1 Y 1 A ARG 52 ? CZ ? A ARG 57 CZ 74 1 Y 1 A ARG 52 ? NH1 ? A ARG 57 NH1 75 1 Y 1 A ARG 52 ? NH2 ? A ARG 57 NH2 76 1 Y 1 A ASN 53 ? CG ? A ASN 58 CG 77 1 Y 1 A ASN 53 ? OD1 ? A ASN 58 OD1 78 1 Y 1 A ASN 53 ? ND2 ? A ASN 58 ND2 79 1 Y 1 A THR 59 ? OG1 ? A THR 64 OG1 80 1 Y 1 A THR 59 ? CG2 ? A THR 64 CG2 81 1 Y 1 A LYS 60 ? CG ? A LYS 65 CG 82 1 Y 1 A LYS 60 ? CD ? A LYS 65 CD 83 1 Y 1 A LYS 60 ? CE ? A LYS 65 CE 84 1 Y 1 A LYS 60 ? NZ ? A LYS 65 NZ 85 1 Y 1 A ARG 76 ? CG ? A ARG 81 CG 86 1 Y 1 A ARG 76 ? CD ? A ARG 81 CD 87 1 Y 1 A ARG 76 ? NE ? A ARG 81 NE 88 1 Y 1 A ARG 76 ? CZ ? A ARG 81 CZ 89 1 Y 1 A ARG 76 ? NH1 ? A ARG 81 NH1 90 1 Y 1 A ARG 76 ? NH2 ? A ARG 81 NH2 91 1 Y 1 A ASN 81 ? CG ? A ASN 86 CG 92 1 Y 1 A ASN 81 ? OD1 ? A ASN 86 OD1 93 1 Y 1 A ASN 81 ? ND2 ? A ASN 86 ND2 94 1 Y 1 A LEU 91 ? CG ? A LEU 96 CG 95 1 Y 1 A LEU 91 ? CD1 ? A LEU 96 CD1 96 1 Y 1 A LEU 91 ? CD2 ? A LEU 96 CD2 97 1 Y 1 A ASN 101 ? CG ? A ASN 106 CG 98 1 Y 1 A ASN 101 ? OD1 ? A ASN 106 OD1 99 1 Y 1 A ASN 101 ? ND2 ? A ASN 106 ND2 100 1 Y 1 A SER 117 ? OG ? A SER 122 OG 101 1 Y 1 A ASP 127 ? CG ? A ASP 132 CG 102 1 Y 1 A ASP 127 ? OD1 ? A ASP 132 OD1 103 1 Y 1 A ASP 127 ? OD2 ? A ASP 132 OD2 104 1 Y 1 A SER 136 ? OG ? A SER 141 OG 105 1 Y 1 A ARG 137 ? CG ? A ARG 142 CG 106 1 Y 1 A ARG 137 ? CD ? A ARG 142 CD 107 1 Y 1 A ARG 137 ? NE ? A ARG 142 NE 108 1 Y 1 A ARG 137 ? CZ ? A ARG 142 CZ 109 1 Y 1 A ARG 137 ? NH1 ? A ARG 142 NH1 110 1 Y 1 A ARG 137 ? NH2 ? A ARG 142 NH2 111 1 Y 1 A ASP 159 ? CG ? A ASP 164 CG 112 1 Y 1 A ASP 159 ? OD1 ? A ASP 164 OD1 113 1 Y 1 A ASP 159 ? OD2 ? A ASP 164 OD2 114 1 Y 1 A LYS 162 ? CG ? A LYS 167 CG 115 1 Y 1 A LYS 162 ? CD ? A LYS 167 CD 116 1 Y 1 A LYS 162 ? CE ? A LYS 167 CE 117 1 Y 1 A LYS 162 ? NZ ? A LYS 167 NZ 118 1 Y 1 B MET 1 ? CG ? B MET 6 CG 119 1 Y 1 B MET 1 ? SD ? B MET 6 SD 120 1 Y 1 B MET 1 ? CE ? B MET 6 CE 121 1 Y 1 B GLU 5 ? CG ? B GLU 10 CG 122 1 Y 1 B GLU 5 ? CD ? B GLU 10 CD 123 1 Y 1 B GLU 5 ? OE1 ? B GLU 10 OE1 124 1 Y 1 B GLU 5 ? OE2 ? B GLU 10 OE2 125 1 Y 1 B LEU 7 ? CG ? B LEU 12 CG 126 1 Y 1 B LEU 7 ? CD1 ? B LEU 12 CD1 127 1 Y 1 B LEU 7 ? CD2 ? B LEU 12 CD2 128 1 Y 1 B ARG 8 ? CG ? B ARG 13 CG 129 1 Y 1 B ARG 8 ? CD ? B ARG 13 CD 130 1 Y 1 B ARG 8 ? NE ? B ARG 13 NE 131 1 Y 1 B ARG 8 ? CZ ? B ARG 13 CZ 132 1 Y 1 B ARG 8 ? NH1 ? B ARG 13 NH1 133 1 Y 1 B ARG 8 ? NH2 ? B ARG 13 NH2 134 1 Y 1 B GLU 11 ? CG ? B GLU 16 CG 135 1 Y 1 B GLU 11 ? CD ? B GLU 16 CD 136 1 Y 1 B GLU 11 ? OE1 ? B GLU 16 OE1 137 1 Y 1 B GLU 11 ? OE2 ? B GLU 16 OE2 138 1 Y 1 B ARG 14 ? CG ? B ARG 19 CG 139 1 Y 1 B ARG 14 ? CD ? B ARG 19 CD 140 1 Y 1 B ARG 14 ? NE ? B ARG 19 NE 141 1 Y 1 B ARG 14 ? CZ ? B ARG 19 CZ 142 1 Y 1 B ARG 14 ? NH1 ? B ARG 19 NH1 143 1 Y 1 B ARG 14 ? NH2 ? B ARG 19 NH2 144 1 Y 1 B LEU 15 ? CG ? B LEU 20 CG 145 1 Y 1 B LEU 15 ? CD1 ? B LEU 20 CD1 146 1 Y 1 B LEU 15 ? CD2 ? B LEU 20 CD2 147 1 Y 1 B LYS 16 ? CG ? B LYS 21 CG 148 1 Y 1 B LYS 16 ? CD ? B LYS 21 CD 149 1 Y 1 B LYS 16 ? CE ? B LYS 21 CE 150 1 Y 1 B LYS 16 ? NZ ? B LYS 21 NZ 151 1 Y 1 B ILE 17 ? CG1 ? B ILE 22 CG1 152 1 Y 1 B ILE 17 ? CG2 ? B ILE 22 CG2 153 1 Y 1 B ILE 17 ? CD1 ? B ILE 22 CD1 154 1 Y 1 B TYR 18 ? CG ? B TYR 23 CG 155 1 Y 1 B TYR 18 ? CD1 ? B TYR 23 CD1 156 1 Y 1 B TYR 18 ? CD2 ? B TYR 23 CD2 157 1 Y 1 B TYR 18 ? CE1 ? B TYR 23 CE1 158 1 Y 1 B TYR 18 ? CE2 ? B TYR 23 CE2 159 1 Y 1 B TYR 18 ? CZ ? B TYR 23 CZ 160 1 Y 1 B TYR 18 ? OH ? B TYR 23 OH 161 1 Y 1 B LYS 19 ? CG ? B LYS 24 CG 162 1 Y 1 B LYS 19 ? CD ? B LYS 24 CD 163 1 Y 1 B LYS 19 ? CE ? B LYS 24 CE 164 1 Y 1 B LYS 19 ? NZ ? B LYS 24 NZ 165 1 Y 1 B ASP 20 ? CG ? B ASP 25 CG 166 1 Y 1 B ASP 20 ? OD1 ? B ASP 25 OD1 167 1 Y 1 B ASP 20 ? OD2 ? B ASP 25 OD2 168 1 Y 1 B GLU 22 ? CG ? B GLU 27 CG 169 1 Y 1 B GLU 22 ? CD ? B GLU 27 CD 170 1 Y 1 B GLU 22 ? OE1 ? B GLU 27 OE1 171 1 Y 1 B GLU 22 ? OE2 ? B GLU 27 OE2 172 1 Y 1 B TYR 25 ? CG ? B TYR 30 CG 173 1 Y 1 B TYR 25 ? CD1 ? B TYR 30 CD1 174 1 Y 1 B TYR 25 ? CD2 ? B TYR 30 CD2 175 1 Y 1 B TYR 25 ? CE1 ? B TYR 30 CE1 176 1 Y 1 B TYR 25 ? CE2 ? B TYR 30 CE2 177 1 Y 1 B TYR 25 ? CZ ? B TYR 30 CZ 178 1 Y 1 B TYR 25 ? OH ? B TYR 30 OH 179 1 Y 1 B LYS 60 ? CG ? B LYS 65 CG 180 1 Y 1 B LYS 60 ? CD ? B LYS 65 CD 181 1 Y 1 B LYS 60 ? CE ? B LYS 65 CE 182 1 Y 1 B LYS 60 ? NZ ? B LYS 65 NZ 183 1 Y 1 B LYS 83 ? CG ? B LYS 88 CG 184 1 Y 1 B LYS 83 ? CD ? B LYS 88 CD 185 1 Y 1 B LYS 83 ? CE ? B LYS 88 CE 186 1 Y 1 B LYS 83 ? NZ ? B LYS 88 NZ 187 1 Y 1 B LEU 91 ? CG ? B LEU 96 CG 188 1 Y 1 B LEU 91 ? CD1 ? B LEU 96 CD1 189 1 Y 1 B LEU 91 ? CD2 ? B LEU 96 CD2 190 1 Y 1 B ARG 95 ? CG ? B ARG 100 CG 191 1 Y 1 B ARG 95 ? CD ? B ARG 100 CD 192 1 Y 1 B ARG 95 ? NE ? B ARG 100 NE 193 1 Y 1 B ARG 95 ? CZ ? B ARG 100 CZ 194 1 Y 1 B ARG 95 ? NH1 ? B ARG 100 NH1 195 1 Y 1 B ARG 95 ? NH2 ? B ARG 100 NH2 196 1 Y 1 B ASN 101 ? CG ? B ASN 106 CG 197 1 Y 1 B ASN 101 ? OD1 ? B ASN 106 OD1 198 1 Y 1 B ASN 101 ? ND2 ? B ASN 106 ND2 199 1 Y 1 B THR 115 ? OG1 ? B THR 120 OG1 200 1 Y 1 B THR 115 ? CG2 ? B THR 120 CG2 201 1 Y 1 B GLN 122 ? CG ? B GLN 127 CG 202 1 Y 1 B GLN 122 ? CD ? B GLN 127 CD 203 1 Y 1 B GLN 122 ? OE1 ? B GLN 127 OE1 204 1 Y 1 B GLN 122 ? NE2 ? B GLN 127 NE2 205 1 Y 1 B GLN 123 ? CG ? B GLN 128 CG 206 1 Y 1 B GLN 123 ? CD ? B GLN 128 CD 207 1 Y 1 B GLN 123 ? OE1 ? B GLN 128 OE1 208 1 Y 1 B GLN 123 ? NE2 ? B GLN 128 NE2 209 1 Y 1 B LYS 124 ? CG ? B LYS 129 CG 210 1 Y 1 B LYS 124 ? CD ? B LYS 129 CD 211 1 Y 1 B LYS 124 ? CE ? B LYS 129 CE 212 1 Y 1 B LYS 124 ? NZ ? B LYS 129 NZ 213 1 Y 1 B ASP 127 ? CG ? B ASP 132 CG 214 1 Y 1 B ASP 127 ? OD1 ? B ASP 132 OD1 215 1 Y 1 B ASP 127 ? OD2 ? B ASP 132 OD2 216 1 Y 1 B ARG 137 ? CG ? B ARG 142 CG 217 1 Y 1 B ARG 137 ? CD ? B ARG 142 CD 218 1 Y 1 B ARG 137 ? NE ? B ARG 142 NE 219 1 Y 1 B ARG 137 ? CZ ? B ARG 142 CZ 220 1 Y 1 B ARG 137 ? NH1 ? B ARG 142 NH1 221 1 Y 1 B ARG 137 ? NH2 ? B ARG 142 NH2 222 1 Y 1 B TYR 139 ? CG ? B TYR 144 CG 223 1 Y 1 B TYR 139 ? CD1 ? B TYR 144 CD1 224 1 Y 1 B TYR 139 ? CD2 ? B TYR 144 CD2 225 1 Y 1 B TYR 139 ? CE1 ? B TYR 144 CE1 226 1 Y 1 B TYR 139 ? CE2 ? B TYR 144 CE2 227 1 Y 1 B TYR 139 ? CZ ? B TYR 144 CZ 228 1 Y 1 B TYR 139 ? OH ? B TYR 144 OH 229 1 Y 1 B GLN 141 ? CG ? B GLN 146 CG 230 1 Y 1 B GLN 141 ? CD ? B GLN 146 CD 231 1 Y 1 B GLN 141 ? OE1 ? B GLN 146 OE1 232 1 Y 1 B GLN 141 ? NE2 ? B GLN 146 NE2 233 1 Y 1 B ASN 144 ? CG ? B ASN 149 CG 234 1 Y 1 B ASN 144 ? OD1 ? B ASN 149 OD1 235 1 Y 1 B ASN 144 ? ND2 ? B ASN 149 ND2 236 1 Y 1 B LYS 147 ? CG ? B LYS 152 CG 237 1 Y 1 B LYS 147 ? CD ? B LYS 152 CD 238 1 Y 1 B LYS 147 ? CE ? B LYS 152 CE 239 1 Y 1 B LYS 147 ? NZ ? B LYS 152 NZ 240 1 Y 1 B ARG 148 ? CG ? B ARG 153 CG 241 1 Y 1 B ARG 148 ? CD ? B ARG 153 CD 242 1 Y 1 B ARG 148 ? NE ? B ARG 153 NE 243 1 Y 1 B ARG 148 ? CZ ? B ARG 153 CZ 244 1 Y 1 B ARG 148 ? NH1 ? B ARG 153 NH1 245 1 Y 1 B ARG 148 ? NH2 ? B ARG 153 NH2 246 1 Y 1 B ARG 154 ? CG ? B ARG 159 CG 247 1 Y 1 B ARG 154 ? CD ? B ARG 159 CD 248 1 Y 1 B ARG 154 ? NE ? B ARG 159 NE 249 1 Y 1 B ARG 154 ? CZ ? B ARG 159 CZ 250 1 Y 1 B ARG 154 ? NH1 ? B ARG 159 NH1 251 1 Y 1 B ARG 154 ? NH2 ? B ARG 159 NH2 252 1 Y 1 B TRP 158 ? CG ? B TRP 163 CG 253 1 Y 1 B TRP 158 ? CD1 ? B TRP 163 CD1 254 1 Y 1 B TRP 158 ? CD2 ? B TRP 163 CD2 255 1 Y 1 B TRP 158 ? NE1 ? B TRP 163 NE1 256 1 Y 1 B TRP 158 ? CE2 ? B TRP 163 CE2 257 1 Y 1 B TRP 158 ? CE3 ? B TRP 163 CE3 258 1 Y 1 B TRP 158 ? CZ2 ? B TRP 163 CZ2 259 1 Y 1 B TRP 158 ? CZ3 ? B TRP 163 CZ3 260 1 Y 1 B TRP 158 ? CH2 ? B TRP 163 CH2 261 1 Y 1 B ASP 159 ? CG ? B ASP 164 CG 262 1 Y 1 B ASP 159 ? OD1 ? B ASP 164 OD1 263 1 Y 1 B ASP 159 ? OD2 ? B ASP 164 OD2 264 1 Y 1 C ARG 8 ? CG ? C ARG 13 CG 265 1 Y 1 C ARG 8 ? CD ? C ARG 13 CD 266 1 Y 1 C ARG 8 ? NE ? C ARG 13 NE 267 1 Y 1 C ARG 8 ? CZ ? C ARG 13 CZ 268 1 Y 1 C ARG 8 ? NH1 ? C ARG 13 NH1 269 1 Y 1 C ARG 8 ? NH2 ? C ARG 13 NH2 270 1 Y 1 C LEU 13 ? CG ? C LEU 18 CG 271 1 Y 1 C LEU 13 ? CD1 ? C LEU 18 CD1 272 1 Y 1 C LEU 13 ? CD2 ? C LEU 18 CD2 273 1 Y 1 C LEU 15 ? CG ? C LEU 20 CG 274 1 Y 1 C LEU 15 ? CD1 ? C LEU 20 CD1 275 1 Y 1 C LEU 15 ? CD2 ? C LEU 20 CD2 276 1 Y 1 C LYS 16 ? CG ? C LYS 21 CG 277 1 Y 1 C LYS 16 ? CD ? C LYS 21 CD 278 1 Y 1 C LYS 16 ? CE ? C LYS 21 CE 279 1 Y 1 C LYS 16 ? NZ ? C LYS 21 NZ 280 1 Y 1 C THR 59 ? OG1 ? C THR 64 OG1 281 1 Y 1 C THR 59 ? CG2 ? C THR 64 CG2 282 1 Y 1 C LYS 60 ? CG ? C LYS 65 CG 283 1 Y 1 C LYS 60 ? CD ? C LYS 65 CD 284 1 Y 1 C LYS 60 ? CE ? C LYS 65 CE 285 1 Y 1 C LYS 60 ? NZ ? C LYS 65 NZ 286 1 Y 1 C ASP 61 ? CG ? C ASP 66 CG 287 1 Y 1 C ASP 61 ? OD1 ? C ASP 66 OD1 288 1 Y 1 C ASP 61 ? OD2 ? C ASP 66 OD2 289 1 Y 1 C GLU 62 ? CG ? C GLU 67 CG 290 1 Y 1 C GLU 62 ? CD ? C GLU 67 CD 291 1 Y 1 C GLU 62 ? OE1 ? C GLU 67 OE1 292 1 Y 1 C GLU 62 ? OE2 ? C GLU 67 OE2 293 1 Y 1 C LEU 66 ? CG ? C LEU 71 CG 294 1 Y 1 C LEU 66 ? CD1 ? C LEU 71 CD1 295 1 Y 1 C LEU 66 ? CD2 ? C LEU 71 CD2 296 1 Y 1 C ASN 68 ? CG ? C ASN 73 CG 297 1 Y 1 C ASN 68 ? OD1 ? C ASN 73 OD1 298 1 Y 1 C ASN 68 ? ND2 ? C ASN 73 ND2 299 1 Y 1 C GLN 69 ? CG ? C GLN 74 CG 300 1 Y 1 C GLN 69 ? CD ? C GLN 74 CD 301 1 Y 1 C GLN 69 ? OE1 ? C GLN 74 OE1 302 1 Y 1 C GLN 69 ? NE2 ? C GLN 74 NE2 303 1 Y 1 C ARG 76 ? CG ? C ARG 81 CG 304 1 Y 1 C ARG 76 ? CD ? C ARG 81 CD 305 1 Y 1 C ARG 76 ? NE ? C ARG 81 NE 306 1 Y 1 C ARG 76 ? CZ ? C ARG 81 CZ 307 1 Y 1 C ARG 76 ? NH1 ? C ARG 81 NH1 308 1 Y 1 C ARG 76 ? NH2 ? C ARG 81 NH2 309 1 Y 1 C ARG 80 ? CG ? C ARG 85 CG 310 1 Y 1 C ARG 80 ? CD ? C ARG 85 CD 311 1 Y 1 C ARG 80 ? NE ? C ARG 85 NE 312 1 Y 1 C ARG 80 ? CZ ? C ARG 85 CZ 313 1 Y 1 C ARG 80 ? NH1 ? C ARG 85 NH1 314 1 Y 1 C ARG 80 ? NH2 ? C ARG 85 NH2 315 1 Y 1 C ASN 81 ? CG ? C ASN 86 CG 316 1 Y 1 C ASN 81 ? OD1 ? C ASN 86 OD1 317 1 Y 1 C ASN 81 ? ND2 ? C ASN 86 ND2 318 1 Y 1 C LYS 83 ? CG ? C LYS 88 CG 319 1 Y 1 C LYS 83 ? CD ? C LYS 88 CD 320 1 Y 1 C LYS 83 ? CE ? C LYS 88 CE 321 1 Y 1 C LYS 83 ? NZ ? C LYS 88 NZ 322 1 Y 1 C LEU 91 ? CG ? C LEU 96 CG 323 1 Y 1 C LEU 91 ? CD1 ? C LEU 96 CD1 324 1 Y 1 C LEU 91 ? CD2 ? C LEU 96 CD2 325 1 Y 1 C ARG 95 ? CG ? C ARG 100 CG 326 1 Y 1 C ARG 95 ? CD ? C ARG 100 CD 327 1 Y 1 C ARG 95 ? NE ? C ARG 100 NE 328 1 Y 1 C ARG 95 ? CZ ? C ARG 100 CZ 329 1 Y 1 C ARG 95 ? NH1 ? C ARG 100 NH1 330 1 Y 1 C ARG 95 ? NH2 ? C ARG 100 NH2 331 1 Y 1 C ARG 96 ? CG ? C ARG 101 CG 332 1 Y 1 C ARG 96 ? CD ? C ARG 101 CD 333 1 Y 1 C ARG 96 ? NE ? C ARG 101 NE 334 1 Y 1 C ARG 96 ? CZ ? C ARG 101 CZ 335 1 Y 1 C ARG 96 ? NH1 ? C ARG 101 NH1 336 1 Y 1 C ARG 96 ? NH2 ? C ARG 101 NH2 337 1 Y 1 C THR 115 ? OG1 ? C THR 120 OG1 338 1 Y 1 C THR 115 ? CG2 ? C THR 120 CG2 339 1 Y 1 C ARG 119 ? CG ? C ARG 124 CG 340 1 Y 1 C ARG 119 ? CD ? C ARG 124 CD 341 1 Y 1 C ARG 119 ? NE ? C ARG 124 NE 342 1 Y 1 C ARG 119 ? CZ ? C ARG 124 CZ 343 1 Y 1 C ARG 119 ? NH1 ? C ARG 124 NH1 344 1 Y 1 C ARG 119 ? NH2 ? C ARG 124 NH2 345 1 Y 1 C LYS 124 ? CG ? C LYS 129 CG 346 1 Y 1 C LYS 124 ? CD ? C LYS 129 CD 347 1 Y 1 C LYS 124 ? CE ? C LYS 129 CE 348 1 Y 1 C LYS 124 ? NZ ? C LYS 129 NZ 349 1 Y 1 C ASP 127 ? CG ? C ASP 132 CG 350 1 Y 1 C ASP 127 ? OD1 ? C ASP 132 OD1 351 1 Y 1 C ASP 127 ? OD2 ? C ASP 132 OD2 352 1 Y 1 C LEU 133 ? CG ? C LEU 138 CG 353 1 Y 1 C LEU 133 ? CD1 ? C LEU 138 CD1 354 1 Y 1 C LEU 133 ? CD2 ? C LEU 138 CD2 355 1 Y 1 C LYS 135 ? CG ? C LYS 140 CG 356 1 Y 1 C LYS 135 ? CD ? C LYS 140 CD 357 1 Y 1 C LYS 135 ? CE ? C LYS 140 CE 358 1 Y 1 C LYS 135 ? NZ ? C LYS 140 NZ 359 1 Y 1 C ARG 137 ? CG ? C ARG 142 CG 360 1 Y 1 C ARG 137 ? CD ? C ARG 142 CD 361 1 Y 1 C ARG 137 ? NE ? C ARG 142 NE 362 1 Y 1 C ARG 137 ? CZ ? C ARG 142 CZ 363 1 Y 1 C ARG 137 ? NH1 ? C ARG 142 NH1 364 1 Y 1 C ARG 137 ? NH2 ? C ARG 142 NH2 365 1 Y 1 C ASN 140 ? CG ? C ASN 145 CG 366 1 Y 1 C ASN 140 ? OD1 ? C ASN 145 OD1 367 1 Y 1 C ASN 140 ? ND2 ? C ASN 145 ND2 368 1 Y 1 C GLN 141 ? CG ? C GLN 146 CG 369 1 Y 1 C GLN 141 ? CD ? C GLN 146 CD 370 1 Y 1 C GLN 141 ? OE1 ? C GLN 146 OE1 371 1 Y 1 C GLN 141 ? NE2 ? C GLN 146 NE2 372 1 Y 1 C ASN 144 ? CG ? C ASN 149 CG 373 1 Y 1 C ASN 144 ? OD1 ? C ASN 149 OD1 374 1 Y 1 C ASN 144 ? ND2 ? C ASN 149 ND2 375 1 Y 1 C LYS 162 ? CG ? C LYS 167 CG 376 1 Y 1 C LYS 162 ? CD ? C LYS 167 CD 377 1 Y 1 C LYS 162 ? CE ? C LYS 167 CE 378 1 Y 1 C LYS 162 ? NZ ? C LYS 167 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A PRO -3 ? A PRO 2 3 1 Y 1 A LEU -2 ? A LEU 3 4 1 Y 1 A GLY 163 ? A GLY 168 5 1 Y 1 A GLY 164 ? A GLY 169 6 1 Y 1 A GLY 165 ? A GLY 170 7 1 Y 1 A GLY 166 ? A GLY 171 8 1 Y 1 A ARG 167 ? A ARG 172 9 1 Y 1 A GLY 168 ? A GLY 173 10 1 Y 1 A ASP 169 ? A ASP 174 11 1 Y 1 A SER 170 ? A SER 175 12 1 Y 1 A PRO 171 ? A PRO 176 13 1 Y 1 B GLY -4 ? B GLY 1 14 1 Y 1 B PRO -3 ? B PRO 2 15 1 Y 1 B LEU -2 ? B LEU 3 16 1 Y 1 B GLY 23 ? B GLY 28 17 1 Y 1 B TYR 24 ? B TYR 29 18 1 Y 1 B ILE 27 ? B ILE 32 19 1 Y 1 B GLY 28 ? B GLY 33 20 1 Y 1 B ILE 29 ? B ILE 34 21 1 Y 1 B LEU 33 ? B LEU 38 22 1 Y 1 B THR 34 ? B THR 39 23 1 Y 1 B LYS 35 ? B LYS 40 24 1 Y 1 B SER 36 ? B SER 41 25 1 Y 1 B PRO 37 ? B PRO 42 26 1 Y 1 B SER 38 ? B SER 43 27 1 Y 1 B LEU 39 ? B LEU 44 28 1 Y 1 B ASN 40 ? B ASN 45 29 1 Y 1 B ALA 41 ? B ALA 46 30 1 Y 1 B ALA 42 ? B ALA 47 31 1 Y 1 B LYS 43 ? B LYS 48 32 1 Y 1 B SER 44 ? B SER 49 33 1 Y 1 B GLU 45 ? B GLU 50 34 1 Y 1 B LEU 46 ? B LEU 51 35 1 Y 1 B ASP 47 ? B ASP 52 36 1 Y 1 B LYS 48 ? B LYS 53 37 1 Y 1 B ALA 49 ? B ALA 54 38 1 Y 1 B ILE 50 ? B ILE 55 39 1 Y 1 B GLY 51 ? B GLY 56 40 1 Y 1 B ARG 52 ? B ARG 57 41 1 Y 1 B ASN 53 ? B ASN 58 42 1 Y 1 B THR 54 ? B THR 59 43 1 Y 1 B ASN 55 ? B ASN 60 44 1 Y 1 B GLY 56 ? B GLY 61 45 1 Y 1 B VAL 57 ? B VAL 62 46 1 Y 1 B LYS 162 ? B LYS 167 47 1 Y 1 B GLY 163 ? B GLY 168 48 1 Y 1 B GLY 164 ? B GLY 169 49 1 Y 1 B GLY 165 ? B GLY 170 50 1 Y 1 B GLY 166 ? B GLY 171 51 1 Y 1 B ARG 167 ? B ARG 172 52 1 Y 1 B GLY 168 ? B GLY 173 53 1 Y 1 B ASP 169 ? B ASP 174 54 1 Y 1 B SER 170 ? B SER 175 55 1 Y 1 B PRO 171 ? B PRO 176 56 1 Y 1 C GLY -4 ? C GLY 1 57 1 Y 1 C PRO -3 ? C PRO 2 58 1 Y 1 C LEU -2 ? C LEU 3 59 1 Y 1 C GLY -1 ? C GLY 4 60 1 Y 1 C ILE 17 ? C ILE 22 61 1 Y 1 C TYR 18 ? C TYR 23 62 1 Y 1 C LYS 19 ? C LYS 24 63 1 Y 1 C ASP 20 ? C ASP 25 64 1 Y 1 C THR 21 ? C THR 26 65 1 Y 1 C GLU 22 ? C GLU 27 66 1 Y 1 C GLY 23 ? C GLY 28 67 1 Y 1 C TYR 24 ? C TYR 29 68 1 Y 1 C TYR 25 ? C TYR 30 69 1 Y 1 C THR 26 ? C THR 31 70 1 Y 1 C ILE 27 ? C ILE 32 71 1 Y 1 C HIS 31 ? C HIS 36 72 1 Y 1 C LEU 32 ? C LEU 37 73 1 Y 1 C LEU 33 ? C LEU 38 74 1 Y 1 C THR 34 ? C THR 39 75 1 Y 1 C LYS 35 ? C LYS 40 76 1 Y 1 C SER 36 ? C SER 41 77 1 Y 1 C PRO 37 ? C PRO 42 78 1 Y 1 C SER 38 ? C SER 43 79 1 Y 1 C LEU 39 ? C LEU 44 80 1 Y 1 C ASN 40 ? C ASN 45 81 1 Y 1 C ALA 41 ? C ALA 46 82 1 Y 1 C ALA 42 ? C ALA 47 83 1 Y 1 C LYS 43 ? C LYS 48 84 1 Y 1 C SER 44 ? C SER 49 85 1 Y 1 C GLU 45 ? C GLU 50 86 1 Y 1 C LEU 46 ? C LEU 51 87 1 Y 1 C ASP 47 ? C ASP 52 88 1 Y 1 C LYS 48 ? C LYS 53 89 1 Y 1 C ALA 49 ? C ALA 54 90 1 Y 1 C ILE 50 ? C ILE 55 91 1 Y 1 C GLY 51 ? C GLY 56 92 1 Y 1 C ARG 52 ? C ARG 57 93 1 Y 1 C ASN 53 ? C ASN 58 94 1 Y 1 C THR 54 ? C THR 59 95 1 Y 1 C ASN 55 ? C ASN 60 96 1 Y 1 C GLY 56 ? C GLY 61 97 1 Y 1 C VAL 57 ? C VAL 62 98 1 Y 1 C ILE 58 ? C ILE 63 99 1 Y 1 C GLY 163 ? C GLY 168 100 1 Y 1 C GLY 164 ? C GLY 169 101 1 Y 1 C GLY 165 ? C GLY 170 102 1 Y 1 C GLY 166 ? C GLY 171 103 1 Y 1 C ARG 167 ? C ARG 172 104 1 Y 1 C GLY 168 ? C GLY 173 105 1 Y 1 C ASP 169 ? C ASP 174 106 1 Y 1 C SER 170 ? C SER 175 107 1 Y 1 C PRO 171 ? C PRO 176 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 81902199 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3SB5 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #