data_7DYX # _entry.id 7DYX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DYX pdb_00007dyx 10.2210/pdb7dyx/pdb WWPDB D_1300020473 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DYX _pdbx_database_status.recvd_initial_deposition_date 2021-01-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nakashima, Y.' 1 ? 'Brewitz, L.' 2 ? 'Schofield, C.J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 10849 _citation.page_last 10865 _citation.title ;5-Substituted Pyridine-2,4-dicarboxylate Derivatives Have Potential for Selective Inhibition of Human Jumonji-C Domain-Containing Protein 5. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.3c01114 _citation.pdbx_database_id_PubMed 37527664 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brewitz, L.' 1 0000-0002-9465-777X primary 'Nakashima, Y.' 2 ? primary 'Piasecka, S.K.' 3 ? primary 'Salah, E.' 4 ? primary 'Fletcher, S.C.' 5 ? primary 'Tumber, A.' 6 ? primary 'Corner, T.P.' 7 ? primary 'Kennedy, T.J.' 8 ? primary 'Fiorini, G.' 9 ? primary 'Thalhammer, A.' 10 ? primary 'Christensen, K.E.' 11 ? primary 'Coleman, M.L.' 12 ? primary 'Schofield, C.J.' 13 0000-0002-0290-6565 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7DYX _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.920 _cell.length_a_esd ? _cell.length_b 64.750 _cell.length_b_esd ? _cell.length_c 78.649 _cell.length_c_esd ? _cell.volume 249126.213 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DYX _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bifunctional peptidase and arginyl-hydroxylase JMJD5' 27261.873 1 1.14.11.-,3.4.-.- ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 3 non-polymer syn '5-((2-cyclopropylbenzyl)amino)pyridine-2,4-dicarboxylic acid' 312.320 1 ? ? ? ? 4 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'JmjC domain-containing protein 5,Jumonji C domain-containing protein 5,L-arginine (3R)-hydroxylase KDM8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISK YIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLY SPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS ; _entity_poly.pdbx_seq_one_letter_code_can ;STVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISK YIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLY SPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 VAL n 1 4 PRO n 1 5 ARG n 1 6 LEU n 1 7 HIS n 1 8 ARG n 1 9 PRO n 1 10 SER n 1 11 LEU n 1 12 GLN n 1 13 HIS n 1 14 PHE n 1 15 ARG n 1 16 GLU n 1 17 GLN n 1 18 PHE n 1 19 LEU n 1 20 VAL n 1 21 PRO n 1 22 GLY n 1 23 ARG n 1 24 PRO n 1 25 VAL n 1 26 ILE n 1 27 LEU n 1 28 LYS n 1 29 GLY n 1 30 VAL n 1 31 ALA n 1 32 ASP n 1 33 HIS n 1 34 TRP n 1 35 PRO n 1 36 CYS n 1 37 MET n 1 38 GLN n 1 39 LYS n 1 40 TRP n 1 41 SER n 1 42 LEU n 1 43 GLU n 1 44 TYR n 1 45 ILE n 1 46 GLN n 1 47 GLU n 1 48 ILE n 1 49 ALA n 1 50 GLY n 1 51 CYS n 1 52 ARG n 1 53 THR n 1 54 VAL n 1 55 PRO n 1 56 VAL n 1 57 GLU n 1 58 VAL n 1 59 GLY n 1 60 SER n 1 61 ARG n 1 62 TYR n 1 63 THR n 1 64 ASP n 1 65 GLU n 1 66 GLU n 1 67 TRP n 1 68 SER n 1 69 GLN n 1 70 THR n 1 71 LEU n 1 72 MET n 1 73 THR n 1 74 VAL n 1 75 ASN n 1 76 GLU n 1 77 PHE n 1 78 ILE n 1 79 SER n 1 80 LYS n 1 81 TYR n 1 82 ILE n 1 83 VAL n 1 84 ASN n 1 85 GLU n 1 86 PRO n 1 87 ARG n 1 88 ASP n 1 89 VAL n 1 90 GLY n 1 91 TYR n 1 92 LEU n 1 93 ALA n 1 94 GLN n 1 95 HIS n 1 96 GLN n 1 97 LEU n 1 98 PHE n 1 99 ASP n 1 100 GLN n 1 101 ILE n 1 102 PRO n 1 103 GLU n 1 104 LEU n 1 105 LYS n 1 106 GLN n 1 107 ASP n 1 108 ILE n 1 109 SER n 1 110 ILE n 1 111 PRO n 1 112 ASP n 1 113 TYR n 1 114 CYS n 1 115 SER n 1 116 LEU n 1 117 GLY n 1 118 ASP n 1 119 GLY n 1 120 GLU n 1 121 GLU n 1 122 GLU n 1 123 GLU n 1 124 ILE n 1 125 THR n 1 126 ILE n 1 127 ASN n 1 128 ALA n 1 129 TRP n 1 130 PHE n 1 131 GLY n 1 132 PRO n 1 133 GLN n 1 134 GLY n 1 135 THR n 1 136 ILE n 1 137 SER n 1 138 PRO n 1 139 LEU n 1 140 HIS n 1 141 GLN n 1 142 ASP n 1 143 PRO n 1 144 GLN n 1 145 GLN n 1 146 ASN n 1 147 PHE n 1 148 LEU n 1 149 VAL n 1 150 GLN n 1 151 VAL n 1 152 MET n 1 153 GLY n 1 154 ARG n 1 155 LYS n 1 156 TYR n 1 157 ILE n 1 158 ARG n 1 159 LEU n 1 160 TYR n 1 161 SER n 1 162 PRO n 1 163 GLN n 1 164 GLU n 1 165 SER n 1 166 GLY n 1 167 ALA n 1 168 LEU n 1 169 TYR n 1 170 PRO n 1 171 HIS n 1 172 ASP n 1 173 THR n 1 174 HIS n 1 175 LEU n 1 176 LEU n 1 177 HIS n 1 178 ASN n 1 179 THR n 1 180 SER n 1 181 GLN n 1 182 VAL n 1 183 ASP n 1 184 VAL n 1 185 GLU n 1 186 ASN n 1 187 PRO n 1 188 ASP n 1 189 LEU n 1 190 GLU n 1 191 LYS n 1 192 PHE n 1 193 PRO n 1 194 LYS n 1 195 PHE n 1 196 ALA n 1 197 LYS n 1 198 ALA n 1 199 PRO n 1 200 PHE n 1 201 LEU n 1 202 SER n 1 203 CYS n 1 204 ILE n 1 205 LEU n 1 206 SER n 1 207 PRO n 1 208 GLY n 1 209 GLU n 1 210 ILE n 1 211 LEU n 1 212 PHE n 1 213 ILE n 1 214 PRO n 1 215 VAL n 1 216 LYS n 1 217 TYR n 1 218 TRP n 1 219 HIS n 1 220 TYR n 1 221 VAL n 1 222 ARG n 1 223 ALA n 1 224 LEU n 1 225 ASP n 1 226 LEU n 1 227 SER n 1 228 PHE n 1 229 SER n 1 230 VAL n 1 231 SER n 1 232 PHE n 1 233 TRP n 1 234 TRP n 1 235 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 235 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KDM8, JMJD5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KDM8_HUMAN _struct_ref.pdbx_db_accession Q8N371 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKY IVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYS PQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS ; _struct_ref.pdbx_align_begin 183 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7DYX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 235 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8N371 _struct_ref_seq.db_align_beg 183 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 416 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 183 _struct_ref_seq.pdbx_auth_seq_align_end 416 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7DYX _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8N371 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 182 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 HRR non-polymer . '5-((2-cyclopropylbenzyl)amino)pyridine-2,4-dicarboxylic acid' ? 'C17 H16 N2 O4' 312.320 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DYX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM HEPES sodium, 200mM magnesium chloride hexahydrate, 25% w/v PEG 3350, 1mM manganese chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.965459 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.965459 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 38.22 _reflns.entry_id 7DYX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.27 _reflns.d_resolution_low 48.92 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21676 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.32 _reflns.pdbx_Rmerge_I_obs 0.435 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 2.69 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.943 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.27 _reflns_shell.d_res_low 2.41 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.35 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 215 _reflns_shell.percent_possible_all 98.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.966 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.098 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 48.82 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DYX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.27 _refine.ls_d_res_low 41.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21662 _refine.ls_number_reflns_R_free 1066 _refine.ls_number_reflns_R_work 20596 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.06 _refine.ls_percent_reflns_R_free 4.92 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2436 _refine.ls_R_factor_R_free 0.2801 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2417 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.97 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6F4P _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.1170 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3556 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.27 _refine_hist.d_res_low 41.54 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 1968 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1911 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0041 ? 2106 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5829 ? 2895 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0470 ? 300 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0033 ? 384 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.6954 ? 776 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.27 2.37 . . 134 2590 97.95 . . . 0.3244 . 0.3394 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.37 2.50 . . 136 2602 98.10 . . . 0.3802 . 0.3472 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.50 2.65 . . 133 2592 97.60 . . . 0.3397 . 0.3317 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.65 2.86 . . 135 2541 96.50 . . . 0.3251 . 0.3112 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.86 3.15 . . 128 2502 93.93 . . . 0.3308 . 0.2816 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.15 3.60 . . 138 2611 98.35 . . . 0.2325 . 0.2298 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.60 4.54 . . 130 2617 98.21 . . . 0.2550 . 0.1733 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.54 41.54 . . 132 2541 95.81 . . . 0.2503 . 0.2062 . . . . . . . . . . . # _struct.entry_id 7DYX _struct.title 'Human JMJD5 in complex with MN and 5-((2-cyclopropylbenzyl)amino)pyridine-2,4-dicarboxylic acid.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DYX _struct_keywords.text 'JmjC domain-containing protein 5, JMJD5, dioxygenase, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 10 ? PHE A 18 ? SER A 191 PHE A 199 1 ? 9 HELX_P HELX_P2 AA2 PRO A 35 ? TRP A 40 ? PRO A 216 TRP A 221 1 ? 6 HELX_P HELX_P3 AA3 SER A 41 ? GLY A 50 ? SER A 222 GLY A 231 1 ? 10 HELX_P HELX_P4 AA4 VAL A 74 ? ILE A 82 ? VAL A 255 ILE A 263 1 ? 9 HELX_P HELX_P5 AA5 GLN A 96 ? ILE A 101 ? GLN A 277 ILE A 282 1 ? 6 HELX_P HELX_P6 AA6 ILE A 101 ? GLN A 106 ? ILE A 282 GLN A 287 1 ? 6 HELX_P HELX_P7 AA7 PRO A 111 ? GLY A 117 ? PRO A 292 GLY A 298 5 ? 7 HELX_P HELX_P8 AA8 GLU A 120 ? ILE A 124 ? GLU A 301 ILE A 305 5 ? 5 HELX_P HELX_P9 AA9 SER A 161 ? TYR A 169 ? SER A 342 TYR A 350 5 ? 9 HELX_P HELX_P10 AB1 THR A 173 ? HIS A 177 ? THR A 354 HIS A 358 5 ? 5 HELX_P HELX_P11 AB2 PHE A 192 ? ALA A 196 ? PHE A 373 ALA A 377 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 140 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 321 A MN 501 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc2 metalc ? ? A ASP 142 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 323 A MN 501 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc3 metalc ? ? A HIS 219 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 400 A MN 501 1_555 ? ? ? ? ? ? ? 2.161 ? ? metalc4 metalc ? ? B MN . MN ? ? ? 1_555 C HRR . O3 ? ? A MN 501 A HRR 502 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc5 metalc ? ? B MN . MN ? ? ? 1_555 C HRR . N23 ? ? A MN 501 A HRR 502 1_555 ? ? ? ? ? ? ? 2.252 ? ? metalc6 metalc ? ? B MN . MN ? ? ? 1_555 D HOH . O ? ? A MN 501 A HOH 615 1_555 ? ? ? ? ? ? ? 1.782 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 5 ? HIS A 7 ? ARG A 186 HIS A 188 AA1 2 VAL A 25 ? LYS A 28 ? VAL A 206 LYS A 209 AA1 3 ILE A 210 ? ILE A 213 ? ILE A 391 ILE A 394 AA1 4 GLN A 145 ? MET A 152 ? GLN A 326 MET A 333 AA1 5 SER A 227 ? TRP A 234 ? SER A 408 TRP A 415 AA1 6 THR A 125 ? GLY A 131 ? THR A 306 GLY A 312 AA1 7 VAL A 89 ? HIS A 95 ? VAL A 270 HIS A 276 AA1 8 THR A 53 ? GLY A 59 ? THR A 234 GLY A 240 AA1 9 SER A 68 ? THR A 73 ? SER A 249 THR A 254 AA2 1 LEU A 201 ? LEU A 205 ? LEU A 382 LEU A 386 AA2 2 LYS A 155 ? TYR A 160 ? LYS A 336 TYR A 341 AA2 3 TRP A 218 ? ALA A 223 ? TRP A 399 ALA A 404 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 6 ? N LEU A 187 O LYS A 28 ? O LYS A 209 AA1 2 3 N VAL A 25 ? N VAL A 206 O PHE A 212 ? O PHE A 393 AA1 3 4 O LEU A 211 ? O LEU A 392 N LEU A 148 ? N LEU A 329 AA1 4 5 N VAL A 149 ? N VAL A 330 O VAL A 230 ? O VAL A 411 AA1 5 6 O SER A 229 ? O SER A 410 N TRP A 129 ? N TRP A 310 AA1 6 7 O ALA A 128 ? O ALA A 309 N HIS A 95 ? N HIS A 276 AA1 7 8 O TYR A 91 ? O TYR A 272 N GLU A 57 ? N GLU A 238 AA1 8 9 N VAL A 58 ? N VAL A 239 O SER A 68 ? O SER A 249 AA2 1 2 O LEU A 201 ? O LEU A 382 N LEU A 159 ? N LEU A 340 AA2 2 3 N TYR A 156 ? N TYR A 337 O ARG A 222 ? O ARG A 403 # _atom_sites.entry_id 7DYX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020442 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015444 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012715 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 182 182 SER SER A . n A 1 2 THR 2 183 183 THR THR A . n A 1 3 VAL 3 184 184 VAL VAL A . n A 1 4 PRO 4 185 185 PRO PRO A . n A 1 5 ARG 5 186 186 ARG ARG A . n A 1 6 LEU 6 187 187 LEU LEU A . n A 1 7 HIS 7 188 188 HIS HIS A . n A 1 8 ARG 8 189 189 ARG ARG A . n A 1 9 PRO 9 190 190 PRO PRO A . n A 1 10 SER 10 191 191 SER SER A . n A 1 11 LEU 11 192 192 LEU LEU A . n A 1 12 GLN 12 193 193 GLN GLN A . n A 1 13 HIS 13 194 194 HIS HIS A . n A 1 14 PHE 14 195 195 PHE PHE A . n A 1 15 ARG 15 196 196 ARG ARG A . n A 1 16 GLU 16 197 197 GLU GLU A . n A 1 17 GLN 17 198 198 GLN GLN A . n A 1 18 PHE 18 199 199 PHE PHE A . n A 1 19 LEU 19 200 200 LEU LEU A . n A 1 20 VAL 20 201 201 VAL VAL A . n A 1 21 PRO 21 202 202 PRO PRO A . n A 1 22 GLY 22 203 203 GLY GLY A . n A 1 23 ARG 23 204 204 ARG ARG A . n A 1 24 PRO 24 205 205 PRO PRO A . n A 1 25 VAL 25 206 206 VAL VAL A . n A 1 26 ILE 26 207 207 ILE ILE A . n A 1 27 LEU 27 208 208 LEU LEU A . n A 1 28 LYS 28 209 209 LYS LYS A . n A 1 29 GLY 29 210 210 GLY GLY A . n A 1 30 VAL 30 211 211 VAL VAL A . n A 1 31 ALA 31 212 212 ALA ALA A . n A 1 32 ASP 32 213 213 ASP ASP A . n A 1 33 HIS 33 214 214 HIS HIS A . n A 1 34 TRP 34 215 215 TRP TRP A . n A 1 35 PRO 35 216 216 PRO PRO A . n A 1 36 CYS 36 217 217 CYS CYS A . n A 1 37 MET 37 218 218 MET MET A . n A 1 38 GLN 38 219 219 GLN GLN A . n A 1 39 LYS 39 220 220 LYS LYS A . n A 1 40 TRP 40 221 221 TRP TRP A . n A 1 41 SER 41 222 222 SER SER A . n A 1 42 LEU 42 223 223 LEU LEU A . n A 1 43 GLU 43 224 224 GLU GLU A . n A 1 44 TYR 44 225 225 TYR TYR A . n A 1 45 ILE 45 226 226 ILE ILE A . n A 1 46 GLN 46 227 227 GLN GLN A . n A 1 47 GLU 47 228 228 GLU GLU A . n A 1 48 ILE 48 229 229 ILE ILE A . n A 1 49 ALA 49 230 230 ALA ALA A . n A 1 50 GLY 50 231 231 GLY GLY A . n A 1 51 CYS 51 232 232 CYS CYS A . n A 1 52 ARG 52 233 233 ARG ARG A . n A 1 53 THR 53 234 234 THR THR A . n A 1 54 VAL 54 235 235 VAL VAL A . n A 1 55 PRO 55 236 236 PRO PRO A . n A 1 56 VAL 56 237 237 VAL VAL A . n A 1 57 GLU 57 238 238 GLU GLU A . n A 1 58 VAL 58 239 239 VAL VAL A . n A 1 59 GLY 59 240 240 GLY GLY A . n A 1 60 SER 60 241 241 SER SER A . n A 1 61 ARG 61 242 242 ARG ARG A . n A 1 62 TYR 62 243 ? ? ? A . n A 1 63 THR 63 244 ? ? ? A . n A 1 64 ASP 64 245 245 ASP ASP A . n A 1 65 GLU 65 246 246 GLU GLU A . n A 1 66 GLU 66 247 247 GLU GLU A . n A 1 67 TRP 67 248 248 TRP TRP A . n A 1 68 SER 68 249 249 SER SER A . n A 1 69 GLN 69 250 250 GLN GLN A . n A 1 70 THR 70 251 251 THR THR A . n A 1 71 LEU 71 252 252 LEU LEU A . n A 1 72 MET 72 253 253 MET MET A . n A 1 73 THR 73 254 254 THR THR A . n A 1 74 VAL 74 255 255 VAL VAL A . n A 1 75 ASN 75 256 256 ASN ASN A . n A 1 76 GLU 76 257 257 GLU GLU A . n A 1 77 PHE 77 258 258 PHE PHE A . n A 1 78 ILE 78 259 259 ILE ILE A . n A 1 79 SER 79 260 260 SER SER A . n A 1 80 LYS 80 261 261 LYS LYS A . n A 1 81 TYR 81 262 262 TYR TYR A . n A 1 82 ILE 82 263 263 ILE ILE A . n A 1 83 VAL 83 264 264 VAL VAL A . n A 1 84 ASN 84 265 265 ASN ASN A . n A 1 85 GLU 85 266 266 GLU GLU A . n A 1 86 PRO 86 267 267 PRO PRO A . n A 1 87 ARG 87 268 268 ARG ARG A . n A 1 88 ASP 88 269 269 ASP ASP A . n A 1 89 VAL 89 270 270 VAL VAL A . n A 1 90 GLY 90 271 271 GLY GLY A . n A 1 91 TYR 91 272 272 TYR TYR A . n A 1 92 LEU 92 273 273 LEU LEU A . n A 1 93 ALA 93 274 274 ALA ALA A . n A 1 94 GLN 94 275 275 GLN GLN A . n A 1 95 HIS 95 276 276 HIS HIS A . n A 1 96 GLN 96 277 277 GLN GLN A . n A 1 97 LEU 97 278 278 LEU LEU A . n A 1 98 PHE 98 279 279 PHE PHE A . n A 1 99 ASP 99 280 280 ASP ASP A . n A 1 100 GLN 100 281 281 GLN GLN A . n A 1 101 ILE 101 282 282 ILE ILE A . n A 1 102 PRO 102 283 283 PRO PRO A . n A 1 103 GLU 103 284 284 GLU GLU A . n A 1 104 LEU 104 285 285 LEU LEU A . n A 1 105 LYS 105 286 286 LYS LYS A . n A 1 106 GLN 106 287 287 GLN GLN A . n A 1 107 ASP 107 288 288 ASP ASP A . n A 1 108 ILE 108 289 289 ILE ILE A . n A 1 109 SER 109 290 290 SER SER A . n A 1 110 ILE 110 291 291 ILE ILE A . n A 1 111 PRO 111 292 292 PRO PRO A . n A 1 112 ASP 112 293 293 ASP ASP A . n A 1 113 TYR 113 294 294 TYR TYR A . n A 1 114 CYS 114 295 295 CYS CYS A . n A 1 115 SER 115 296 296 SER SER A . n A 1 116 LEU 116 297 297 LEU LEU A . n A 1 117 GLY 117 298 298 GLY GLY A . n A 1 118 ASP 118 299 299 ASP ASP A . n A 1 119 GLY 119 300 300 GLY GLY A . n A 1 120 GLU 120 301 301 GLU GLU A . n A 1 121 GLU 121 302 302 GLU GLU A . n A 1 122 GLU 122 303 303 GLU GLU A . n A 1 123 GLU 123 304 304 GLU GLU A . n A 1 124 ILE 124 305 305 ILE ILE A . n A 1 125 THR 125 306 306 THR THR A . n A 1 126 ILE 126 307 307 ILE ILE A . n A 1 127 ASN 127 308 308 ASN ASN A . n A 1 128 ALA 128 309 309 ALA ALA A . n A 1 129 TRP 129 310 310 TRP TRP A . n A 1 130 PHE 130 311 311 PHE PHE A . n A 1 131 GLY 131 312 312 GLY GLY A . n A 1 132 PRO 132 313 313 PRO PRO A . n A 1 133 GLN 133 314 314 GLN GLN A . n A 1 134 GLY 134 315 315 GLY GLY A . n A 1 135 THR 135 316 316 THR THR A . n A 1 136 ILE 136 317 317 ILE ILE A . n A 1 137 SER 137 318 318 SER SER A . n A 1 138 PRO 138 319 319 PRO PRO A . n A 1 139 LEU 139 320 320 LEU LEU A . n A 1 140 HIS 140 321 321 HIS HIS A . n A 1 141 GLN 141 322 322 GLN GLN A . n A 1 142 ASP 142 323 323 ASP ASP A . n A 1 143 PRO 143 324 324 PRO PRO A . n A 1 144 GLN 144 325 325 GLN GLN A . n A 1 145 GLN 145 326 326 GLN GLN A . n A 1 146 ASN 146 327 327 ASN ASN A . n A 1 147 PHE 147 328 328 PHE PHE A . n A 1 148 LEU 148 329 329 LEU LEU A . n A 1 149 VAL 149 330 330 VAL VAL A . n A 1 150 GLN 150 331 331 GLN GLN A . n A 1 151 VAL 151 332 332 VAL VAL A . n A 1 152 MET 152 333 333 MET MET A . n A 1 153 GLY 153 334 334 GLY GLY A . n A 1 154 ARG 154 335 335 ARG ARG A . n A 1 155 LYS 155 336 336 LYS LYS A . n A 1 156 TYR 156 337 337 TYR TYR A . n A 1 157 ILE 157 338 338 ILE ILE A . n A 1 158 ARG 158 339 339 ARG ARG A . n A 1 159 LEU 159 340 340 LEU LEU A . n A 1 160 TYR 160 341 341 TYR TYR A . n A 1 161 SER 161 342 342 SER SER A . n A 1 162 PRO 162 343 343 PRO PRO A . n A 1 163 GLN 163 344 344 GLN GLN A . n A 1 164 GLU 164 345 345 GLU GLU A . n A 1 165 SER 165 346 346 SER SER A . n A 1 166 GLY 166 347 347 GLY GLY A . n A 1 167 ALA 167 348 348 ALA ALA A . n A 1 168 LEU 168 349 349 LEU LEU A . n A 1 169 TYR 169 350 350 TYR TYR A . n A 1 170 PRO 170 351 351 PRO PRO A . n A 1 171 HIS 171 352 352 HIS HIS A . n A 1 172 ASP 172 353 353 ASP ASP A . n A 1 173 THR 173 354 354 THR THR A . n A 1 174 HIS 174 355 355 HIS HIS A . n A 1 175 LEU 175 356 356 LEU LEU A . n A 1 176 LEU 176 357 357 LEU LEU A . n A 1 177 HIS 177 358 358 HIS HIS A . n A 1 178 ASN 178 359 359 ASN ASN A . n A 1 179 THR 179 360 360 THR THR A . n A 1 180 SER 180 361 361 SER SER A . n A 1 181 GLN 181 362 362 GLN GLN A . n A 1 182 VAL 182 363 363 VAL VAL A . n A 1 183 ASP 183 364 364 ASP ASP A . n A 1 184 VAL 184 365 365 VAL VAL A . n A 1 185 GLU 185 366 366 GLU GLU A . n A 1 186 ASN 186 367 367 ASN ASN A . n A 1 187 PRO 187 368 368 PRO PRO A . n A 1 188 ASP 188 369 369 ASP ASP A . n A 1 189 LEU 189 370 370 LEU LEU A . n A 1 190 GLU 190 371 371 GLU GLU A . n A 1 191 LYS 191 372 372 LYS LYS A . n A 1 192 PHE 192 373 373 PHE PHE A . n A 1 193 PRO 193 374 374 PRO PRO A . n A 1 194 LYS 194 375 375 LYS LYS A . n A 1 195 PHE 195 376 376 PHE PHE A . n A 1 196 ALA 196 377 377 ALA ALA A . n A 1 197 LYS 197 378 378 LYS LYS A . n A 1 198 ALA 198 379 379 ALA ALA A . n A 1 199 PRO 199 380 380 PRO PRO A . n A 1 200 PHE 200 381 381 PHE PHE A . n A 1 201 LEU 201 382 382 LEU LEU A . n A 1 202 SER 202 383 383 SER SER A . n A 1 203 CYS 203 384 384 CYS CYS A . n A 1 204 ILE 204 385 385 ILE ILE A . n A 1 205 LEU 205 386 386 LEU LEU A . n A 1 206 SER 206 387 387 SER SER A . n A 1 207 PRO 207 388 388 PRO PRO A . n A 1 208 GLY 208 389 389 GLY GLY A . n A 1 209 GLU 209 390 390 GLU GLU A . n A 1 210 ILE 210 391 391 ILE ILE A . n A 1 211 LEU 211 392 392 LEU LEU A . n A 1 212 PHE 212 393 393 PHE PHE A . n A 1 213 ILE 213 394 394 ILE ILE A . n A 1 214 PRO 214 395 395 PRO PRO A . n A 1 215 VAL 215 396 396 VAL VAL A . n A 1 216 LYS 216 397 397 LYS LYS A . n A 1 217 TYR 217 398 398 TYR TYR A . n A 1 218 TRP 218 399 399 TRP TRP A . n A 1 219 HIS 219 400 400 HIS HIS A . n A 1 220 TYR 220 401 401 TYR TYR A . n A 1 221 VAL 221 402 402 VAL VAL A . n A 1 222 ARG 222 403 403 ARG ARG A . n A 1 223 ALA 223 404 404 ALA ALA A . n A 1 224 LEU 224 405 405 LEU LEU A . n A 1 225 ASP 225 406 406 ASP ASP A . n A 1 226 LEU 226 407 407 LEU LEU A . n A 1 227 SER 227 408 408 SER SER A . n A 1 228 PHE 228 409 409 PHE PHE A . n A 1 229 SER 229 410 410 SER SER A . n A 1 230 VAL 230 411 411 VAL VAL A . n A 1 231 SER 231 412 412 SER SER A . n A 1 232 PHE 232 413 413 PHE PHE A . n A 1 233 TRP 233 414 414 TRP TRP A . n A 1 234 TRP 234 415 415 TRP TRP A . n A 1 235 SER 235 416 416 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 501 501 MN MN A . C 3 HRR 1 502 601 HRR LIG A . D 4 HOH 1 601 57 HOH HOH A . D 4 HOH 2 602 40 HOH HOH A . D 4 HOH 3 603 14 HOH HOH A . D 4 HOH 4 604 30 HOH HOH A . D 4 HOH 5 605 28 HOH HOH A . D 4 HOH 6 606 31 HOH HOH A . D 4 HOH 7 607 17 HOH HOH A . D 4 HOH 8 608 27 HOH HOH A . D 4 HOH 9 609 58 HOH HOH A . D 4 HOH 10 610 13 HOH HOH A . D 4 HOH 11 611 38 HOH HOH A . D 4 HOH 12 612 1 HOH HOH A . D 4 HOH 13 613 23 HOH HOH A . D 4 HOH 14 614 11 HOH HOH A . D 4 HOH 15 615 62 HOH HOH A . D 4 HOH 16 616 2 HOH HOH A . D 4 HOH 17 617 3 HOH HOH A . D 4 HOH 18 618 18 HOH HOH A . D 4 HOH 19 619 4 HOH HOH A . D 4 HOH 20 620 12 HOH HOH A . D 4 HOH 21 621 55 HOH HOH A . D 4 HOH 22 622 7 HOH HOH A . D 4 HOH 23 623 25 HOH HOH A . D 4 HOH 24 624 42 HOH HOH A . D 4 HOH 25 625 5 HOH HOH A . D 4 HOH 26 626 10 HOH HOH A . D 4 HOH 27 627 26 HOH HOH A . D 4 HOH 28 628 36 HOH HOH A . D 4 HOH 29 629 9 HOH HOH A . D 4 HOH 30 630 20 HOH HOH A . D 4 HOH 31 631 49 HOH HOH A . D 4 HOH 32 632 46 HOH HOH A . D 4 HOH 33 633 16 HOH HOH A . D 4 HOH 34 634 22 HOH HOH A . D 4 HOH 35 635 61 HOH HOH A . D 4 HOH 36 636 45 HOH HOH A . D 4 HOH 37 637 34 HOH HOH A . D 4 HOH 38 638 35 HOH HOH A . D 4 HOH 39 639 15 HOH HOH A . D 4 HOH 40 640 48 HOH HOH A . D 4 HOH 41 641 32 HOH HOH A . D 4 HOH 42 642 41 HOH HOH A . D 4 HOH 43 643 19 HOH HOH A . D 4 HOH 44 644 21 HOH HOH A . D 4 HOH 45 645 56 HOH HOH A . D 4 HOH 46 646 59 HOH HOH A . D 4 HOH 47 647 54 HOH HOH A . D 4 HOH 48 648 37 HOH HOH A . D 4 HOH 49 649 39 HOH HOH A . D 4 HOH 50 650 47 HOH HOH A . D 4 HOH 51 651 44 HOH HOH A . D 4 HOH 52 652 50 HOH HOH A . D 4 HOH 53 653 29 HOH HOH A . D 4 HOH 54 654 53 HOH HOH A . D 4 HOH 55 655 43 HOH HOH A . D 4 HOH 56 656 60 HOH HOH A . D 4 HOH 57 657 6 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 120 ? 1 MORE -6 ? 1 'SSA (A^2)' 11430 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 140 ? A HIS 321 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 OD2 ? A ASP 142 ? A ASP 323 ? 1_555 117.2 ? 2 NE2 ? A HIS 140 ? A HIS 321 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 NE2 ? A HIS 219 ? A HIS 400 ? 1_555 86.5 ? 3 OD2 ? A ASP 142 ? A ASP 323 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 NE2 ? A HIS 219 ? A HIS 400 ? 1_555 89.3 ? 4 NE2 ? A HIS 140 ? A HIS 321 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 O3 ? C HRR . ? A HRR 502 ? 1_555 157.4 ? 5 OD2 ? A ASP 142 ? A ASP 323 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 O3 ? C HRR . ? A HRR 502 ? 1_555 80.7 ? 6 NE2 ? A HIS 219 ? A HIS 400 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 O3 ? C HRR . ? A HRR 502 ? 1_555 79.8 ? 7 NE2 ? A HIS 140 ? A HIS 321 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 N23 ? C HRR . ? A HRR 502 ? 1_555 90.2 ? 8 OD2 ? A ASP 142 ? A ASP 323 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 N23 ? C HRR . ? A HRR 502 ? 1_555 149.4 ? 9 NE2 ? A HIS 219 ? A HIS 400 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 N23 ? C HRR . ? A HRR 502 ? 1_555 106.7 ? 10 O3 ? C HRR . ? A HRR 502 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 N23 ? C HRR . ? A HRR 502 ? 1_555 76.9 ? 11 NE2 ? A HIS 140 ? A HIS 321 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 O ? D HOH . ? A HOH 615 ? 1_555 88.8 ? 12 OD2 ? A ASP 142 ? A ASP 323 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 O ? D HOH . ? A HOH 615 ? 1_555 83.2 ? 13 NE2 ? A HIS 219 ? A HIS 400 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 O ? D HOH . ? A HOH 615 ? 1_555 168.2 ? 14 O3 ? C HRR . ? A HRR 502 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 O ? D HOH . ? A HOH 615 ? 1_555 107.8 ? 15 N23 ? C HRR . ? A HRR 502 ? 1_555 MN ? B MN . ? A MN 501 ? 1_555 O ? D HOH . ? A HOH 615 ? 1_555 84.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-02 2 'Structure model' 1 1 2023-08-16 3 'Structure model' 1 2 2023-11-29 4 'Structure model' 1 3 2023-12-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 4 'Structure model' '_citation.journal_volume' 11 4 'Structure model' '_citation.page_first' 12 4 'Structure model' '_citation.page_last' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -13.1148255387 14.8208971611 -15.0764346809 0.268909082832 ? 0.00319782414343 ? 0.048741650718 ? 0.261658605056 ? -0.0317186494819 ? 0.325582787887 ? 3.30001099436 ? -0.761203879966 ? 1.64364428232 ? 2.95612548808 ? -1.58849531991 ? 2.06642998091 ? -0.379420861668 ? -0.229639620043 ? 0.369284769421 ? 0.24422958291 ? 0.162742976223 ? 0.119619241035 ? -0.265230553572 ? -0.252498155913 ? 0.0929332719011 ? 2 'X-RAY DIFFRACTION' ? refined -8.07126556555 12.9960925544 -23.0646073939 0.215330722927 ? 0.0279807170148 ? 0.0347817555839 ? 0.19476818306 ? -0.0293418824152 ? 0.364455189865 ? 1.10042816976 ? 0.301857009687 ? 0.463141051607 ? 1.75791596289 ? -0.890983703735 ? 2.63156991286 ? -0.00470295468263 ? 0.025440425663 ? -0.0838705775498 ? 0.0271286517774 ? -0.0142860608553 ? 0.0733366431114 ? 0.107353057201 ? -0.00701185265622 ? 0.0178883572425 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 182 through 248 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 249 through 416 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? pointless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7DYX _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 631 ? ? O A HOH 640 ? ? 2.03 2 1 O A HOH 609 ? ? O A HOH 654 ? ? 2.05 3 1 OE2 A GLU 224 ? A O A HOH 601 ? ? 2.05 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 199 ? ? -137.24 -54.23 2 1 VAL A 211 ? ? -105.80 -64.92 3 1 GLU A 246 ? ? -111.29 -131.97 4 1 GLU A 247 ? ? -170.97 133.38 5 1 TYR A 262 ? ? -142.74 -0.59 6 1 TYR A 262 ? ? -142.74 -1.81 7 1 ILE A 263 ? A -129.01 -51.84 8 1 ILE A 263 ? B -125.09 -56.50 9 1 GLU A 266 ? ? 26.37 70.19 10 1 TYR A 350 ? ? 48.11 70.65 11 1 ASN A 367 ? ? -164.22 62.17 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 196 ? CZ ? A ARG 15 CZ 2 1 Y 1 A ARG 196 ? NH1 ? A ARG 15 NH1 3 1 Y 1 A ARG 196 ? NH2 ? A ARG 15 NH2 4 1 Y 1 A GLN 219 ? CD ? A GLN 38 CD 5 1 Y 1 A GLN 219 ? OE1 ? A GLN 38 OE1 6 1 Y 1 A GLN 219 ? NE2 ? A GLN 38 NE2 7 1 Y 1 A SER 241 ? OG ? A SER 60 OG 8 1 Y 1 A GLU 246 ? CG ? A GLU 65 CG 9 1 Y 1 A GLU 246 ? CD ? A GLU 65 CD 10 1 Y 1 A GLU 246 ? OE1 ? A GLU 65 OE1 11 1 Y 1 A GLU 246 ? OE2 ? A GLU 65 OE2 12 1 Y 1 A GLU 247 ? CG ? A GLU 66 CG 13 1 Y 1 A GLU 247 ? CD ? A GLU 66 CD 14 1 Y 1 A GLU 247 ? OE1 ? A GLU 66 OE1 15 1 Y 1 A GLU 247 ? OE2 ? A GLU 66 OE2 16 1 Y 1 A ASN 265 ? CG ? A ASN 84 CG 17 1 Y 1 A ASN 265 ? OD1 ? A ASN 84 OD1 18 1 Y 1 A ASN 265 ? ND2 ? A ASN 84 ND2 19 1 Y 1 A GLU 284 ? CD ? A GLU 103 CD 20 1 Y 1 A GLU 284 ? OE1 ? A GLU 103 OE1 21 1 Y 1 A GLU 284 ? OE2 ? A GLU 103 OE2 22 1 Y 1 A LYS 286 ? NZ ? A LYS 105 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR 243 ? A TYR 62 2 1 Y 1 A THR 244 ? A THR 63 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 HRR C10 C Y N 161 HRR C13 C Y N 162 HRR C15 C Y N 163 HRR C17 C Y N 164 HRR C20 C N N 165 HRR C21 C N N 166 HRR C22 C Y N 167 HRR C2 C N N 168 HRR C4 C Y N 169 HRR C5 C Y N 170 HRR C6 C Y N 171 HRR C7 C N N 172 HRR C12 C N N 173 HRR C14 C Y N 174 HRR C16 C Y N 175 HRR C18 C Y N 176 HRR C19 C N N 177 HRR N11 N N N 178 HRR N23 N Y N 179 HRR O1 O N N 180 HRR O3 O N N 181 HRR O8 O N N 182 HRR O9 O N N 183 HRR H151 H N N 184 HRR H171 H N N 185 HRR H201 H N N 186 HRR H202 H N N 187 HRR H212 H N N 188 HRR H211 H N N 189 HRR H221 H N N 190 HRR H051 H N N 191 HRR H122 H N N 192 HRR H121 H N N 193 HRR H141 H N N 194 HRR H161 H N N 195 HRR H191 H N N 196 HRR H111 H N N 197 HRR H1 H N N 198 HRR H2 H N N 199 ILE N N N N 200 ILE CA C N S 201 ILE C C N N 202 ILE O O N N 203 ILE CB C N S 204 ILE CG1 C N N 205 ILE CG2 C N N 206 ILE CD1 C N N 207 ILE OXT O N N 208 ILE H H N N 209 ILE H2 H N N 210 ILE HA H N N 211 ILE HB H N N 212 ILE HG12 H N N 213 ILE HG13 H N N 214 ILE HG21 H N N 215 ILE HG22 H N N 216 ILE HG23 H N N 217 ILE HD11 H N N 218 ILE HD12 H N N 219 ILE HD13 H N N 220 ILE HXT H N N 221 LEU N N N N 222 LEU CA C N S 223 LEU C C N N 224 LEU O O N N 225 LEU CB C N N 226 LEU CG C N N 227 LEU CD1 C N N 228 LEU CD2 C N N 229 LEU OXT O N N 230 LEU H H N N 231 LEU H2 H N N 232 LEU HA H N N 233 LEU HB2 H N N 234 LEU HB3 H N N 235 LEU HG H N N 236 LEU HD11 H N N 237 LEU HD12 H N N 238 LEU HD13 H N N 239 LEU HD21 H N N 240 LEU HD22 H N N 241 LEU HD23 H N N 242 LEU HXT H N N 243 LYS N N N N 244 LYS CA C N S 245 LYS C C N N 246 LYS O O N N 247 LYS CB C N N 248 LYS CG C N N 249 LYS CD C N N 250 LYS CE C N N 251 LYS NZ N N N 252 LYS OXT O N N 253 LYS H H N N 254 LYS H2 H N N 255 LYS HA H N N 256 LYS HB2 H N N 257 LYS HB3 H N N 258 LYS HG2 H N N 259 LYS HG3 H N N 260 LYS HD2 H N N 261 LYS HD3 H N N 262 LYS HE2 H N N 263 LYS HE3 H N N 264 LYS HZ1 H N N 265 LYS HZ2 H N N 266 LYS HZ3 H N N 267 LYS HXT H N N 268 MET N N N N 269 MET CA C N S 270 MET C C N N 271 MET O O N N 272 MET CB C N N 273 MET CG C N N 274 MET SD S N N 275 MET CE C N N 276 MET OXT O N N 277 MET H H N N 278 MET H2 H N N 279 MET HA H N N 280 MET HB2 H N N 281 MET HB3 H N N 282 MET HG2 H N N 283 MET HG3 H N N 284 MET HE1 H N N 285 MET HE2 H N N 286 MET HE3 H N N 287 MET HXT H N N 288 MN MN MN N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 HRR C21 C19 sing N N 152 HRR C21 C20 sing N N 153 HRR C19 C18 sing N N 154 HRR C19 C20 sing N N 155 HRR C18 C17 doub Y N 156 HRR C18 C13 sing Y N 157 HRR C17 C16 sing Y N 158 HRR C12 C13 sing N N 159 HRR C12 N11 sing N N 160 HRR C13 C14 doub Y N 161 HRR C22 N23 doub Y N 162 HRR C22 C10 sing Y N 163 HRR N23 C4 sing Y N 164 HRR C16 C15 doub Y N 165 HRR O3 C2 doub N N 166 HRR C14 C15 sing Y N 167 HRR N11 C10 sing N N 168 HRR C10 C6 doub Y N 169 HRR C4 C2 sing N N 170 HRR C4 C5 doub Y N 171 HRR C2 O1 sing N N 172 HRR C6 C5 sing Y N 173 HRR C6 C7 sing N N 174 HRR O9 C7 doub N N 175 HRR C7 O8 sing N N 176 HRR C15 H151 sing N N 177 HRR C17 H171 sing N N 178 HRR C20 H201 sing N N 179 HRR C20 H202 sing N N 180 HRR C21 H212 sing N N 181 HRR C21 H211 sing N N 182 HRR C22 H221 sing N N 183 HRR C5 H051 sing N N 184 HRR C12 H122 sing N N 185 HRR C12 H121 sing N N 186 HRR C14 H141 sing N N 187 HRR C16 H161 sing N N 188 HRR C19 H191 sing N N 189 HRR N11 H111 sing N N 190 HRR O1 H1 sing N N 191 HRR O8 H2 sing N N 192 ILE N CA sing N N 193 ILE N H sing N N 194 ILE N H2 sing N N 195 ILE CA C sing N N 196 ILE CA CB sing N N 197 ILE CA HA sing N N 198 ILE C O doub N N 199 ILE C OXT sing N N 200 ILE CB CG1 sing N N 201 ILE CB CG2 sing N N 202 ILE CB HB sing N N 203 ILE CG1 CD1 sing N N 204 ILE CG1 HG12 sing N N 205 ILE CG1 HG13 sing N N 206 ILE CG2 HG21 sing N N 207 ILE CG2 HG22 sing N N 208 ILE CG2 HG23 sing N N 209 ILE CD1 HD11 sing N N 210 ILE CD1 HD12 sing N N 211 ILE CD1 HD13 sing N N 212 ILE OXT HXT sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HRR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HRR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 '5-((2-cyclopropylbenzyl)amino)pyridine-2,4-dicarboxylic acid' HRR 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6F4P _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 #