data_7E6X
# 
_entry.id   7E6X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7E6X         pdb_00007e6x 10.2210/pdb7e6x/pdb 
WWPDB D_1300020900 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-04-07 
2 'Structure model' 1 1 2023-09-06 
3 'Structure model' 1 2 2023-11-29 
4 'Structure model' 1 3 2024-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 3 'Structure model' 'Refinement description' 
4 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' database_2                    
4 2 'Structure model' pdbx_related_exp_data_set     
5 3 'Structure model' pdbx_initial_refinement_model 
6 4 'Structure model' pdbx_entry_details            
7 4 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                         
2 2 'Structure model' '_database_2.pdbx_database_accession'          
3 4 'Structure model' '_pdbx_entry_details.has_protein_modification' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7E6X 
_pdbx_database_status.recvd_initial_deposition_date   2021-02-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Oda, K.'        1  0000-0003-0996-0393 
'Nomura, T.'     2  ?                   
'Nakane, T.'     3  0000-0003-2697-2767 
'Yamashita, K.'  4  ?                   
'Inoue, K.'      5  0000-0002-6898-4347 
'Ito, S.'        6  ?                   
'Vierock, J.'    7  0000-0001-7368-5539 
'Hirata, K.'     8  ?                   
'Maturana, A.D.' 9  ?                   
'Katayama, K.'   10 ?                   
'Ikuta, T.'      11 ?                   
'Ishigami, I.'   12 ?                   
'Izume, T.'      13 ?                   
'Umeda, R.'      14 ?                   
'Eguma, R.'      15 ?                   
'Oishi, S.'      16 ?                   
'Kasuya, G.'     17 0000-0003-1756-5764 
'Kato, T.'       18 ?                   
'Kusakizako, T.' 19 ?                   
'Shihoya, W.'    20 ?                   
'Shimada, H.'    21 ?                   
'Takatsuji, T.'  22 ?                   
'Takemoto, M.'   23 0000-0002-6339-6431 
'Taniguchi, R.'  24 ?                   
'Tomita, A.'     25 ?                   
'Nakamura, R.'   26 ?                   
'Fukuda, M.'     27 ?                   
'Miyauchi, H.'   28 ?                   
'Lee, Y.'        29 ?                   
'Nango, E.'      30 0000-0001-9851-7355 
'Tanaka, R.'     31 ?                   
'Tanaka, T.'     32 ?                   
'Sugahara, M.'   33 ?                   
'Kimura, T.'     34 ?                   
'Shimamura, T.'  35 ?                   
'Fujiwara, T.'   36 ?                   
'Yamanaka, Y.'   37 ?                   
'Owada, S.'      38 ?                   
'Joti, Y.'       39 ?                   
'Tono, K.'       40 ?                   
'Ishitani, R.'   41 0000-0002-4136-5685 
'Hayashi, S.'    42 ?                   
'Kandori, H.'    43 ?                   
'Hegemann, P.'   44 0000-0003-3589-6452 
'Iwata, S.'      45 ?                   
'Kubo, M.'       46 ?                   
'Nishizawa, T.'  47 0000-0001-7463-8398 
'Nureki, O.'     48 0000-0003-1813-7008 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Time-resolved serial femtosecond crystallography reveals early structural changes in channelrhodopsin.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.62389 
_citation.pdbx_database_id_PubMed   33752801 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Oda, K.'        1  0000-0003-0996-0393 
primary 'Nomura, T.'     2  ?                   
primary 'Nakane, T.'     3  0000-0003-2697-2767 
primary 'Yamashita, K.'  4  ?                   
primary 'Inoue, K.'      5  0000-0002-6898-4347 
primary 'Ito, S.'        6  ?                   
primary 'Vierock, J.'    7  0000-0001-7368-5539 
primary 'Hirata, K.'     8  ?                   
primary 'Maturana, A.D.' 9  ?                   
primary 'Katayama, K.'   10 ?                   
primary 'Ikuta, T.'      11 ?                   
primary 'Ishigami, I.'   12 ?                   
primary 'Izume, T.'      13 ?                   
primary 'Umeda, R.'      14 ?                   
primary 'Eguma, R.'      15 ?                   
primary 'Oishi, S.'      16 ?                   
primary 'Kasuya, G.'     17 0000-0003-1756-5764 
primary 'Kato, T.'       18 ?                   
primary 'Kusakizako, T.' 19 ?                   
primary 'Shihoya, W.'    20 ?                   
primary 'Shimada, H.'    21 ?                   
primary 'Takatsuji, T.'  22 ?                   
primary 'Takemoto, M.'   23 0000-0002-6339-6431 
primary 'Taniguchi, R.'  24 ?                   
primary 'Tomita, A.'     25 ?                   
primary 'Nakamura, R.'   26 ?                   
primary 'Fukuda, M.'     27 ?                   
primary 'Miyauchi, H.'   28 ?                   
primary 'Lee, Y.'        29 ?                   
primary 'Nango, E.'      30 0000-0001-9851-7355 
primary 'Tanaka, R.'     31 ?                   
primary 'Tanaka, T.'     32 ?                   
primary 'Sugahara, M.'   33 ?                   
primary 'Kimura, T.'     34 ?                   
primary 'Shimamura, T.'  35 ?                   
primary 'Fujiwara, T.'   36 ?                   
primary 'Yamanaka, Y.'   37 ?                   
primary 'Owada, S.'      38 ?                   
primary 'Joti, Y.'       39 ?                   
primary 'Tono, K.'       40 ?                   
primary 'Ishitani, R.'   41 0000-0002-4136-5685 
primary 'Hayashi, S.'    42 ?                   
primary 'Kandori, H.'    43 ?                   
primary 'Hegemann, P.'   44 0000-0003-3589-6452 
primary 'Iwata, S.'      45 ?                   
primary 'Kubo, M.'       46 ?                   
primary 'Nishizawa, T.'  47 0000-0001-7463-8398 
primary 'Nureki, O.'     48 0000-0003-1813-7008 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Archaeal-type opsin 1,Archaeal-type opsin 2'                                             39692.688 1  ? ? ? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1  ? ? ? ? 
3 non-polymer syn RETINAL                                                                                   284.436   1  ? ? ? ? 
4 non-polymer syn '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate'                                          356.540   9  ? ? ? ? 
5 water       nat water                                                                                     18.015    38 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Channelopsin-1,Chlamyopsin 4 light-gated ion channel,Retinal binding protein,Sensory opsin B' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCFCLAWLK
SNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMIKFIIEYFHEFDEPAVIYSSNGNKTVWLRY
AEWLLTCPVILIHLSNLTGLANDYNKRTMGLLVSDIGTIVWGTTAALSKGYVRVIFFLMGLCYGIYTFFNAAKVYIEAYH
TVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDI
RKTTKLNIGGTEIEVETLVEDEAEAGAVSSEDLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCFCLAWLK
SNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMIKFIIEYFHEFDEPAVIYSSNGNKTVWLRY
AEWLLTCPVILIHLSNLTGLANDYNKRTMGLLVSDIGTIVWGTTAALSKGYVRVIFFLMGLCYGIYTFFNAAKVYIEAYH
TVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDI
RKTTKLNIGGTEIEVETLVEDEAEAGAVSSEDLYFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 RETINAL                                          RET 
4 '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' OLC 
5 water                                            HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ARG n 
1 4   ARG n 
1 5   PRO n 
1 6   TRP n 
1 7   LEU n 
1 8   LEU n 
1 9   ALA n 
1 10  LEU n 
1 11  ALA n 
1 12  LEU n 
1 13  ALA n 
1 14  VAL n 
1 15  ALA n 
1 16  LEU n 
1 17  ALA n 
1 18  ALA n 
1 19  GLY n 
1 20  SER n 
1 21  ALA n 
1 22  GLY n 
1 23  ALA n 
1 24  SER n 
1 25  THR n 
1 26  GLY n 
1 27  SER n 
1 28  ASP n 
1 29  ALA n 
1 30  THR n 
1 31  VAL n 
1 32  PRO n 
1 33  VAL n 
1 34  ALA n 
1 35  THR n 
1 36  GLN n 
1 37  ASP n 
1 38  GLY n 
1 39  PRO n 
1 40  ASP n 
1 41  TYR n 
1 42  VAL n 
1 43  PHE n 
1 44  HIS n 
1 45  ARG n 
1 46  ALA n 
1 47  HIS n 
1 48  GLU n 
1 49  ARG n 
1 50  MET n 
1 51  LEU n 
1 52  PHE n 
1 53  GLN n 
1 54  THR n 
1 55  SER n 
1 56  TYR n 
1 57  THR n 
1 58  LEU n 
1 59  GLU n 
1 60  ASN n 
1 61  ASN n 
1 62  GLY n 
1 63  SER n 
1 64  VAL n 
1 65  ILE n 
1 66  CYS n 
1 67  ILE n 
1 68  PRO n 
1 69  ASN n 
1 70  ASN n 
1 71  GLY n 
1 72  GLN n 
1 73  CYS n 
1 74  PHE n 
1 75  CYS n 
1 76  LEU n 
1 77  ALA n 
1 78  TRP n 
1 79  LEU n 
1 80  LYS n 
1 81  SER n 
1 82  ASN n 
1 83  GLY n 
1 84  THR n 
1 85  ASN n 
1 86  ALA n 
1 87  GLU n 
1 88  LYS n 
1 89  LEU n 
1 90  ALA n 
1 91  ALA n 
1 92  ASN n 
1 93  ILE n 
1 94  LEU n 
1 95  GLN n 
1 96  TRP n 
1 97  ILE n 
1 98  THR n 
1 99  PHE n 
1 100 ALA n 
1 101 LEU n 
1 102 SER n 
1 103 ALA n 
1 104 LEU n 
1 105 CYS n 
1 106 LEU n 
1 107 MET n 
1 108 PHE n 
1 109 TYR n 
1 110 GLY n 
1 111 TYR n 
1 112 GLN n 
1 113 THR n 
1 114 TRP n 
1 115 LYS n 
1 116 SER n 
1 117 THR n 
1 118 CYS n 
1 119 GLY n 
1 120 TRP n 
1 121 GLU n 
1 122 GLU n 
1 123 ILE n 
1 124 TYR n 
1 125 VAL n 
1 126 ALA n 
1 127 THR n 
1 128 ILE n 
1 129 GLU n 
1 130 MET n 
1 131 ILE n 
1 132 LYS n 
1 133 PHE n 
1 134 ILE n 
1 135 ILE n 
1 136 GLU n 
1 137 TYR n 
1 138 PHE n 
1 139 HIS n 
1 140 GLU n 
1 141 PHE n 
1 142 ASP n 
1 143 GLU n 
1 144 PRO n 
1 145 ALA n 
1 146 VAL n 
1 147 ILE n 
1 148 TYR n 
1 149 SER n 
1 150 SER n 
1 151 ASN n 
1 152 GLY n 
1 153 ASN n 
1 154 LYS n 
1 155 THR n 
1 156 VAL n 
1 157 TRP n 
1 158 LEU n 
1 159 ARG n 
1 160 TYR n 
1 161 ALA n 
1 162 GLU n 
1 163 TRP n 
1 164 LEU n 
1 165 LEU n 
1 166 THR n 
1 167 CYS n 
1 168 PRO n 
1 169 VAL n 
1 170 ILE n 
1 171 LEU n 
1 172 ILE n 
1 173 HIS n 
1 174 LEU n 
1 175 SER n 
1 176 ASN n 
1 177 LEU n 
1 178 THR n 
1 179 GLY n 
1 180 LEU n 
1 181 ALA n 
1 182 ASN n 
1 183 ASP n 
1 184 TYR n 
1 185 ASN n 
1 186 LYS n 
1 187 ARG n 
1 188 THR n 
1 189 MET n 
1 190 GLY n 
1 191 LEU n 
1 192 LEU n 
1 193 VAL n 
1 194 SER n 
1 195 ASP n 
1 196 ILE n 
1 197 GLY n 
1 198 THR n 
1 199 ILE n 
1 200 VAL n 
1 201 TRP n 
1 202 GLY n 
1 203 THR n 
1 204 THR n 
1 205 ALA n 
1 206 ALA n 
1 207 LEU n 
1 208 SER n 
1 209 LYS n 
1 210 GLY n 
1 211 TYR n 
1 212 VAL n 
1 213 ARG n 
1 214 VAL n 
1 215 ILE n 
1 216 PHE n 
1 217 PHE n 
1 218 LEU n 
1 219 MET n 
1 220 GLY n 
1 221 LEU n 
1 222 CYS n 
1 223 TYR n 
1 224 GLY n 
1 225 ILE n 
1 226 TYR n 
1 227 THR n 
1 228 PHE n 
1 229 PHE n 
1 230 ASN n 
1 231 ALA n 
1 232 ALA n 
1 233 LYS n 
1 234 VAL n 
1 235 TYR n 
1 236 ILE n 
1 237 GLU n 
1 238 ALA n 
1 239 TYR n 
1 240 HIS n 
1 241 THR n 
1 242 VAL n 
1 243 PRO n 
1 244 LYS n 
1 245 GLY n 
1 246 ARG n 
1 247 CYS n 
1 248 ARG n 
1 249 GLN n 
1 250 VAL n 
1 251 VAL n 
1 252 THR n 
1 253 GLY n 
1 254 MET n 
1 255 ALA n 
1 256 TRP n 
1 257 LEU n 
1 258 PHE n 
1 259 PHE n 
1 260 VAL n 
1 261 SER n 
1 262 TRP n 
1 263 GLY n 
1 264 MET n 
1 265 PHE n 
1 266 PRO n 
1 267 ILE n 
1 268 LEU n 
1 269 PHE n 
1 270 ILE n 
1 271 LEU n 
1 272 GLY n 
1 273 PRO n 
1 274 GLU n 
1 275 GLY n 
1 276 PHE n 
1 277 GLY n 
1 278 VAL n 
1 279 LEU n 
1 280 SER n 
1 281 VAL n 
1 282 TYR n 
1 283 GLY n 
1 284 SER n 
1 285 THR n 
1 286 VAL n 
1 287 GLY n 
1 288 HIS n 
1 289 THR n 
1 290 ILE n 
1 291 ILE n 
1 292 ASP n 
1 293 LEU n 
1 294 MET n 
1 295 SER n 
1 296 LYS n 
1 297 ASN n 
1 298 CYS n 
1 299 TRP n 
1 300 GLY n 
1 301 LEU n 
1 302 LEU n 
1 303 GLY n 
1 304 HIS n 
1 305 TYR n 
1 306 LEU n 
1 307 ARG n 
1 308 VAL n 
1 309 LEU n 
1 310 ILE n 
1 311 HIS n 
1 312 GLU n 
1 313 HIS n 
1 314 ILE n 
1 315 LEU n 
1 316 ILE n 
1 317 HIS n 
1 318 GLY n 
1 319 ASP n 
1 320 ILE n 
1 321 ARG n 
1 322 LYS n 
1 323 THR n 
1 324 THR n 
1 325 LYS n 
1 326 LEU n 
1 327 ASN n 
1 328 ILE n 
1 329 GLY n 
1 330 GLY n 
1 331 THR n 
1 332 GLU n 
1 333 ILE n 
1 334 GLU n 
1 335 VAL n 
1 336 GLU n 
1 337 THR n 
1 338 LEU n 
1 339 VAL n 
1 340 GLU n 
1 341 ASP n 
1 342 GLU n 
1 343 ALA n 
1 344 GLU n 
1 345 ALA n 
1 346 GLY n 
1 347 ALA n 
1 348 VAL n 
1 349 SER n 
1 350 SER n 
1 351 GLU n 
1 352 ASP n 
1 353 LEU n 
1 354 TYR n 
1 355 PHE n 
1 356 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   245 'Chlamydomonas smithii' ? acop1                                                           
? ? ? ? ? ? 'Chlamydomonas reinhardtii' 3055 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? 
1 2 sample 'Biological sequence' 246 356 'Chlamydomonas smithii' ? 'cop4, acop2, COP4, CSOB, CHLRE_02g085257v5, CHLREDRAFT_182032' 
? ? ? ? ? ? 'Chlamydomonas reinhardtii' 3055 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? 
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-ROH                            'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[][D-1-deoxy-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}'       LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                            ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                       ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose         
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
OLC non-polymer                  . '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' 1-Oleoyl-R-glycerol 'C21 H40 O4'     356.540 
PHE 'L-peptide linking'          y PHENYLALANINE                                    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                          ? 'C5 H9 N O2'     115.130 
RET non-polymer                  . RETINAL                                          ? 'C20 H28 O'      284.436 
SER 'L-peptide linking'          y SERINE                                           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   ?   ?   ?   A . n 
A 1 6   TRP 6   6   ?   ?   ?   A . n 
A 1 7   LEU 7   7   ?   ?   ?   A . n 
A 1 8   LEU 8   8   ?   ?   ?   A . n 
A 1 9   ALA 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  LEU 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  VAL 14  14  ?   ?   ?   A . n 
A 1 15  ALA 15  15  ?   ?   ?   A . n 
A 1 16  LEU 16  16  ?   ?   ?   A . n 
A 1 17  ALA 17  17  ?   ?   ?   A . n 
A 1 18  ALA 18  18  ?   ?   ?   A . n 
A 1 19  GLY 19  19  ?   ?   ?   A . n 
A 1 20  SER 20  20  ?   ?   ?   A . n 
A 1 21  ALA 21  21  ?   ?   ?   A . n 
A 1 22  GLY 22  22  ?   ?   ?   A . n 
A 1 23  ALA 23  23  ?   ?   ?   A . n 
A 1 24  SER 24  24  ?   ?   ?   A . n 
A 1 25  THR 25  25  ?   ?   ?   A . n 
A 1 26  GLY 26  26  ?   ?   ?   A . n 
A 1 27  SER 27  27  ?   ?   ?   A . n 
A 1 28  ASP 28  28  ?   ?   ?   A . n 
A 1 29  ALA 29  29  ?   ?   ?   A . n 
A 1 30  THR 30  30  ?   ?   ?   A . n 
A 1 31  VAL 31  31  ?   ?   ?   A . n 
A 1 32  PRO 32  32  ?   ?   ?   A . n 
A 1 33  VAL 33  33  ?   ?   ?   A . n 
A 1 34  ALA 34  34  ?   ?   ?   A . n 
A 1 35  THR 35  35  ?   ?   ?   A . n 
A 1 36  GLN 36  36  ?   ?   ?   A . n 
A 1 37  ASP 37  37  ?   ?   ?   A . n 
A 1 38  GLY 38  38  ?   ?   ?   A . n 
A 1 39  PRO 39  39  ?   ?   ?   A . n 
A 1 40  ASP 40  40  ?   ?   ?   A . n 
A 1 41  TYR 41  41  ?   ?   ?   A . n 
A 1 42  VAL 42  42  ?   ?   ?   A . n 
A 1 43  PHE 43  43  ?   ?   ?   A . n 
A 1 44  HIS 44  44  ?   ?   ?   A . n 
A 1 45  ARG 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  HIS 47  47  ?   ?   ?   A . n 
A 1 48  GLU 48  48  ?   ?   ?   A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  MET 50  50  50  MET MET A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  CYS 73  73  73  CYS CYS A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  CYS 75  75  75  CYS CYS A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  TRP 78  78  78  TRP TRP A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  ASN 82  82  82  ASN ASN A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  TRP 96  96  96  TRP TRP A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 MET 107 107 107 MET MET A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 GLN 112 112 ?   ?   ?   A . n 
A 1 113 THR 113 113 ?   ?   ?   A . n 
A 1 114 TRP 114 114 ?   ?   ?   A . n 
A 1 115 LYS 115 115 ?   ?   ?   A . n 
A 1 116 SER 116 116 ?   ?   ?   A . n 
A 1 117 THR 117 117 ?   ?   ?   A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 PHE 138 138 138 PHE PHE A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 SER 150 150 150 SER SER A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 TRP 157 157 157 TRP TRP A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 TRP 163 163 163 TRP TRP A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 THR 166 166 166 THR THR A . n 
A 1 167 CYS 167 167 167 CYS CYS A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 ARG 187 187 187 ARG ARG A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 MET 189 189 189 MET MET A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 TRP 201 201 201 TRP TRP A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 TYR 211 211 211 TYR TYR A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 ARG 213 213 213 ARG ARG A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 MET 219 219 219 MET MET A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 CYS 222 222 222 CYS CYS A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 TYR 226 226 226 TYR TYR A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 VAL 234 234 234 VAL VAL A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 HIS 240 240 240 HIS HIS A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 VAL 242 242 242 VAL VAL A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 CYS 247 247 247 CYS CYS A . n 
A 1 248 ARG 248 248 248 ARG ARG A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 THR 252 252 252 THR THR A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 MET 254 254 254 MET MET A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 TRP 256 256 256 TRP TRP A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 PHE 259 259 259 PHE PHE A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 TRP 262 262 262 TRP TRP A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 MET 264 264 264 MET MET A . n 
A 1 265 PHE 265 265 265 PHE PHE A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 PHE 269 269 269 PHE PHE A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 PRO 273 273 273 PRO PRO A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 GLY 275 275 275 GLY GLY A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 GLY 277 277 277 GLY GLY A . n 
A 1 278 VAL 278 278 278 VAL VAL A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 HIS 288 288 288 HIS HIS A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 ILE 290 290 290 ILE ILE A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 MET 294 294 294 MET MET A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 CYS 298 298 298 CYS CYS A . n 
A 1 299 TRP 299 299 299 TRP TRP A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 HIS 304 304 304 HIS HIS A . n 
A 1 305 TYR 305 305 305 TYR TYR A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ILE 310 310 310 ILE ILE A . n 
A 1 311 HIS 311 311 311 HIS HIS A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 HIS 313 313 313 HIS HIS A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 HIS 317 317 317 HIS HIS A . n 
A 1 318 GLY 318 318 318 GLY GLY A . n 
A 1 319 ASP 319 319 319 ASP ASP A . n 
A 1 320 ILE 320 320 320 ILE ILE A . n 
A 1 321 ARG 321 321 321 ARG ARG A . n 
A 1 322 LYS 322 322 322 LYS LYS A . n 
A 1 323 THR 323 323 323 THR THR A . n 
A 1 324 THR 324 324 324 THR THR A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 LEU 326 326 326 LEU LEU A . n 
A 1 327 ASN 327 327 327 ASN ASN A . n 
A 1 328 ILE 328 328 328 ILE ILE A . n 
A 1 329 GLY 329 329 ?   ?   ?   A . n 
A 1 330 GLY 330 330 ?   ?   ?   A . n 
A 1 331 THR 331 331 331 THR ALA A . n 
A 1 332 GLU 332 332 332 GLU GLU A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 VAL 335 335 335 VAL VAL A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 THR 337 337 337 THR THR A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 VAL 339 339 339 VAL VAL A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 ASP 341 341 341 ASP ASP A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 GLY 346 346 346 GLY GLY A . n 
A 1 347 ALA 347 347 347 ALA ALA A . n 
A 1 348 VAL 348 348 348 VAL VAL A . n 
A 1 349 SER 349 349 349 SER SER A . n 
A 1 350 SER 350 350 350 SER SER A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 ASP 352 352 352 ASP ASP A . n 
A 1 353 LEU 353 353 ?   ?   ?   A . n 
A 1 354 TYR 354 354 ?   ?   ?   A . n 
A 1 355 PHE 355 355 ?   ?   ?   A . n 
A 1 356 GLN 356 356 ?   ?   ?   A . n 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 E NAG 1 E NAG 701 n 
B 2 NAG 2 E NAG 2 E NAG 702 n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 RET 1  401 401 RET RET A . 
D 4 OLC 1  402 1   OLC OLC A . 
E 4 OLC 1  403 2   OLC OLC A . 
F 4 OLC 1  404 3   OLC OLC A . 
G 4 OLC 1  405 4   OLC OLC A . 
H 4 OLC 1  406 5   OLC OLC A . 
I 4 OLC 1  407 1   OLC OLC A . 
J 4 OLC 1  408 2   OLC OLC A . 
K 4 OLC 1  409 3   OLC OLC A . 
L 4 OLC 1  410 4   OLC OLC A . 
M 5 HOH 1  501 14  HOH HOH A . 
M 5 HOH 2  502 31  HOH HOH A . 
M 5 HOH 3  503 37  HOH HOH A . 
M 5 HOH 4  504 32  HOH HOH A . 
M 5 HOH 5  505 12  HOH HOH A . 
M 5 HOH 6  506 16  HOH HOH A . 
M 5 HOH 7  507 8   HOH HOH A . 
M 5 HOH 8  508 6   HOH HOH A . 
M 5 HOH 9  509 2   HOH HOH A . 
M 5 HOH 10 510 18  HOH HOH A . 
M 5 HOH 11 511 34  HOH HOH A . 
M 5 HOH 12 512 41  HOH HOH A . 
M 5 HOH 13 513 11  HOH HOH A . 
M 5 HOH 14 514 17  HOH HOH A . 
M 5 HOH 15 515 15  HOH HOH A . 
M 5 HOH 16 516 28  HOH HOH A . 
M 5 HOH 17 517 23  HOH HOH A . 
M 5 HOH 18 518 5   HOH HOH A . 
M 5 HOH 19 519 25  HOH HOH A . 
M 5 HOH 20 520 29  HOH HOH A . 
M 5 HOH 21 521 24  HOH HOH A . 
M 5 HOH 22 522 1   HOH HOH A . 
M 5 HOH 23 523 38  HOH HOH A . 
M 5 HOH 24 524 33  HOH HOH A . 
M 5 HOH 25 525 21  HOH HOH A . 
M 5 HOH 26 526 3   HOH HOH A . 
M 5 HOH 27 527 7   HOH HOH A . 
M 5 HOH 28 528 30  HOH HOH A . 
M 5 HOH 29 529 19  HOH HOH A . 
M 5 HOH 30 530 36  HOH HOH A . 
M 5 HOH 31 531 40  HOH HOH A . 
M 5 HOH 32 532 4   HOH HOH A . 
M 5 HOH 33 533 35  HOH HOH A . 
M 5 HOH 34 534 27  HOH HOH A . 
M 5 HOH 35 535 20  HOH HOH A . 
M 5 HOH 36 536 22  HOH HOH A . 
M 5 HOH 37 537 39  HOH HOH A . 
M 5 HOH 38 538 26  HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 49  ? CG  ? A ARG 49  CG  
2   1 Y 1 A ARG 49  ? CD  ? A ARG 49  CD  
3   1 Y 1 A ARG 49  ? NE  ? A ARG 49  NE  
4   1 Y 1 A ARG 49  ? CZ  ? A ARG 49  CZ  
5   1 Y 1 A ARG 49  ? NH1 ? A ARG 49  NH1 
6   1 Y 1 A ARG 49  ? NH2 ? A ARG 49  NH2 
7   1 Y 1 A MET 50  ? CG  ? A MET 50  CG  
8   1 Y 1 A MET 50  ? SD  ? A MET 50  SD  
9   1 Y 1 A MET 50  ? CE  ? A MET 50  CE  
10  1 Y 1 A CYS 118 ? SG  ? A CYS 118 SG  
11  1 Y 1 A LYS 186 ? CG  ? A LYS 186 CG  
12  1 Y 1 A LYS 186 ? CD  ? A LYS 186 CD  
13  1 Y 1 A LYS 186 ? CE  ? A LYS 186 CE  
14  1 Y 1 A LYS 186 ? NZ  ? A LYS 186 NZ  
15  1 Y 1 A LYS 244 ? CG  ? A LYS 244 CG  
16  1 Y 1 A LYS 244 ? CD  ? A LYS 244 CD  
17  1 Y 1 A LYS 244 ? CE  ? A LYS 244 CE  
18  1 Y 1 A LYS 244 ? NZ  ? A LYS 244 NZ  
19  1 Y 1 A ASN 327 ? CG  ? A ASN 327 CG  
20  1 Y 1 A ASN 327 ? OD1 ? A ASN 327 OD1 
21  1 Y 1 A ASN 327 ? ND2 ? A ASN 327 ND2 
22  1 Y 1 A ILE 328 ? CG1 ? A ILE 328 CG1 
23  1 Y 1 A ILE 328 ? CG2 ? A ILE 328 CG2 
24  1 Y 1 A ILE 328 ? CD1 ? A ILE 328 CD1 
25  1 Y 1 A THR 331 ? OG1 ? A THR 331 OG1 
26  1 Y 1 A THR 331 ? CG2 ? A THR 331 CG2 
27  1 Y 1 A GLU 332 ? CG  ? A GLU 332 CG  
28  1 Y 1 A GLU 332 ? CD  ? A GLU 332 CD  
29  1 Y 1 A GLU 332 ? OE1 ? A GLU 332 OE1 
30  1 Y 1 A GLU 332 ? OE2 ? A GLU 332 OE2 
31  1 Y 1 A GLU 342 ? CG  ? A GLU 342 CG  
32  1 Y 1 A GLU 342 ? CD  ? A GLU 342 CD  
33  1 Y 1 A GLU 342 ? OE1 ? A GLU 342 OE1 
34  1 Y 1 A GLU 342 ? OE2 ? A GLU 342 OE2 
35  1 N 1 A OLC 403 ? C18 ? E OLC 1   C18 
36  1 N 1 A OLC 403 ? C17 ? E OLC 1   C17 
37  1 N 1 A OLC 403 ? C24 ? E OLC 1   C24 
38  1 N 1 A OLC 403 ? C16 ? E OLC 1   C16 
39  1 N 1 A OLC 403 ? C15 ? E OLC 1   C15 
40  1 N 1 A OLC 403 ? C21 ? E OLC 1   C21 
41  1 N 1 A OLC 403 ? C22 ? E OLC 1   C22 
42  1 N 1 A OLC 403 ? O25 ? E OLC 1   O25 
43  1 N 1 A OLC 403 ? O23 ? E OLC 1   O23 
44  1 N 1 A OLC 404 ? C18 ? F OLC 1   C18 
45  1 N 1 A OLC 404 ? C10 ? F OLC 1   C10 
46  1 N 1 A OLC 404 ? C9  ? F OLC 1   C9  
47  1 N 1 A OLC 404 ? C17 ? F OLC 1   C17 
48  1 N 1 A OLC 404 ? C11 ? F OLC 1   C11 
49  1 N 1 A OLC 404 ? C8  ? F OLC 1   C8  
50  1 N 1 A OLC 404 ? C16 ? F OLC 1   C16 
51  1 N 1 A OLC 404 ? C12 ? F OLC 1   C12 
52  1 N 1 A OLC 404 ? C15 ? F OLC 1   C15 
53  1 N 1 A OLC 404 ? C13 ? F OLC 1   C13 
54  1 N 1 A OLC 404 ? C14 ? F OLC 1   C14 
55  1 N 1 A OLC 405 ? C18 ? G OLC 1   C18 
56  1 N 1 A OLC 405 ? C10 ? G OLC 1   C10 
57  1 N 1 A OLC 405 ? C17 ? G OLC 1   C17 
58  1 N 1 A OLC 405 ? C11 ? G OLC 1   C11 
59  1 N 1 A OLC 405 ? C16 ? G OLC 1   C16 
60  1 N 1 A OLC 405 ? C12 ? G OLC 1   C12 
61  1 N 1 A OLC 405 ? C15 ? G OLC 1   C15 
62  1 N 1 A OLC 405 ? C13 ? G OLC 1   C13 
63  1 N 1 A OLC 405 ? C14 ? G OLC 1   C14 
64  1 N 1 A OLC 406 ? C18 ? H OLC 1   C18 
65  1 N 1 A OLC 406 ? C17 ? H OLC 1   C17 
66  1 N 1 A OLC 406 ? C16 ? H OLC 1   C16 
67  1 N 1 A OLC 406 ? C12 ? H OLC 1   C12 
68  1 N 1 A OLC 406 ? C15 ? H OLC 1   C15 
69  1 N 1 A OLC 406 ? C13 ? H OLC 1   C13 
70  1 N 1 A OLC 406 ? C14 ? H OLC 1   C14 
71  1 N 1 A OLC 407 ? C18 ? I OLC 1   C18 
72  1 N 1 A OLC 407 ? C10 ? I OLC 1   C10 
73  1 N 1 A OLC 407 ? C9  ? I OLC 1   C9  
74  1 N 1 A OLC 407 ? C17 ? I OLC 1   C17 
75  1 N 1 A OLC 407 ? C11 ? I OLC 1   C11 
76  1 N 1 A OLC 407 ? C24 ? I OLC 1   C24 
77  1 N 1 A OLC 407 ? C16 ? I OLC 1   C16 
78  1 N 1 A OLC 407 ? C12 ? I OLC 1   C12 
79  1 N 1 A OLC 407 ? C15 ? I OLC 1   C15 
80  1 N 1 A OLC 407 ? C13 ? I OLC 1   C13 
81  1 N 1 A OLC 407 ? C14 ? I OLC 1   C14 
82  1 N 1 A OLC 407 ? C21 ? I OLC 1   C21 
83  1 N 1 A OLC 407 ? C22 ? I OLC 1   C22 
84  1 N 1 A OLC 407 ? O25 ? I OLC 1   O25 
85  1 N 1 A OLC 407 ? O23 ? I OLC 1   O23 
86  1 N 1 A OLC 408 ? C18 ? J OLC 1   C18 
87  1 N 1 A OLC 408 ? C10 ? J OLC 1   C10 
88  1 N 1 A OLC 408 ? C9  ? J OLC 1   C9  
89  1 N 1 A OLC 408 ? C17 ? J OLC 1   C17 
90  1 N 1 A OLC 408 ? C11 ? J OLC 1   C11 
91  1 N 1 A OLC 408 ? C24 ? J OLC 1   C24 
92  1 N 1 A OLC 408 ? C16 ? J OLC 1   C16 
93  1 N 1 A OLC 408 ? C12 ? J OLC 1   C12 
94  1 N 1 A OLC 408 ? C15 ? J OLC 1   C15 
95  1 N 1 A OLC 408 ? C13 ? J OLC 1   C13 
96  1 N 1 A OLC 408 ? C14 ? J OLC 1   C14 
97  1 N 1 A OLC 408 ? C21 ? J OLC 1   C21 
98  1 N 1 A OLC 408 ? C22 ? J OLC 1   C22 
99  1 N 1 A OLC 408 ? O25 ? J OLC 1   O25 
100 1 N 1 A OLC 408 ? O23 ? J OLC 1   O23 
101 1 N 1 A OLC 409 ? C18 ? K OLC 1   C18 
102 1 N 1 A OLC 409 ? C17 ? K OLC 1   C17 
103 1 N 1 A OLC 409 ? C11 ? K OLC 1   C11 
104 1 N 1 A OLC 409 ? C24 ? K OLC 1   C24 
105 1 N 1 A OLC 409 ? C16 ? K OLC 1   C16 
106 1 N 1 A OLC 409 ? C12 ? K OLC 1   C12 
107 1 N 1 A OLC 409 ? C15 ? K OLC 1   C15 
108 1 N 1 A OLC 409 ? C13 ? K OLC 1   C13 
109 1 N 1 A OLC 409 ? C14 ? K OLC 1   C14 
110 1 N 1 A OLC 409 ? C21 ? K OLC 1   C21 
111 1 N 1 A OLC 409 ? C1  ? K OLC 1   C1  
112 1 N 1 A OLC 409 ? C22 ? K OLC 1   C22 
113 1 N 1 A OLC 409 ? O19 ? K OLC 1   O19 
114 1 N 1 A OLC 409 ? O25 ? K OLC 1   O25 
115 1 N 1 A OLC 409 ? O23 ? K OLC 1   O23 
116 1 N 1 A OLC 409 ? O20 ? K OLC 1   O20 
117 1 N 1 A OLC 410 ? C18 ? L OLC 1   C18 
118 1 N 1 A OLC 410 ? C10 ? L OLC 1   C10 
119 1 N 1 A OLC 410 ? C17 ? L OLC 1   C17 
120 1 N 1 A OLC 410 ? C11 ? L OLC 1   C11 
121 1 N 1 A OLC 410 ? C24 ? L OLC 1   C24 
122 1 N 1 A OLC 410 ? C16 ? L OLC 1   C16 
123 1 N 1 A OLC 410 ? C12 ? L OLC 1   C12 
124 1 N 1 A OLC 410 ? C15 ? L OLC 1   C15 
125 1 N 1 A OLC 410 ? C13 ? L OLC 1   C13 
126 1 N 1 A OLC 410 ? C14 ? L OLC 1   C14 
127 1 N 1 A OLC 410 ? C21 ? L OLC 1   C21 
128 1 N 1 A OLC 410 ? C1  ? L OLC 1   C1  
129 1 N 1 A OLC 410 ? C22 ? L OLC 1   C22 
130 1 N 1 A OLC 410 ? O19 ? L OLC 1   O19 
131 1 N 1 A OLC 410 ? O25 ? L OLC 1   O25 
132 1 N 1 A OLC 410 ? O23 ? L OLC 1   O23 
133 1 N 1 A OLC 410 ? O20 ? L OLC 1   O20 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0267 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27     2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? CrystFEL    ? ? ? 0.6.3    3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? CrystFEL    ? ? ? 0.6.3    4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7E6X 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     61.800 
_cell.length_a_esd                 ? 
_cell.length_b                     142.200 
_cell.length_b_esd                 ? 
_cell.length_c                     94.700 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7E6X 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7E6X 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.62 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.07 
_exptl_crystal.description                 
;This is a time-resolved study and two sets of structure factors are deposited: extrapolated and observed data. Data collection statistics is about the latter but we used the former for refinement, where some reflections were rejected.
;
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.9 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM MES, pH 6.9, 100 mM Na formate, and 30% PEG500DM' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     293 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         MPCCD 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-10-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.77 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'FREE ELECTRON LASER' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SACLA BEAMLINE BL3' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.77 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL3 
_diffrn_source.pdbx_synchrotron_site       SACLA 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         7E6X 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.40 
_reflns.d_resolution_low                 39.41 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       16730 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.00 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  159.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.61 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.9925 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     0.089 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
6.506 39.526 ? 15.66 ? ? ? ? 916 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 433.7 ? ? ? ? ? ? ? 1  1 0.9900 ? 0.0648 
5.168 6.506  ? 14.03 ? ? ? ? 865 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 288.9 ? ? ? ? ? ? ? 2  1 0.9856 ? 0.0739 
4.515 5.168  ? 15.76 ? ? ? ? 860 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 253.8 ? ? ? ? ? ? ? 3  1 0.9887 ? 0.0649 
4.103 4.515  ? 15.33 ? ? ? ? 847 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 230.3 ? ? ? ? ? ? ? 4  1 0.9909 ? 0.0613 
3.810 4.103  ? 13.25 ? ? ? ? 846 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 209.2 ? ? ? ? ? ? ? 5  1 0.9912 ? 0.0719 
3.584 3.810  ? 11.32 ? ? ? ? 834 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 180.1 ? ? ? ? ? ? ? 6  1 0.9894 ? 0.0787 
3.405 3.584  ? 8.48  ? ? ? ? 830 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 157.1 ? ? ? ? ? ? ? 7  1 0.9822 ? 0.1100 
3.257 3.405  ? 6.78  ? ? ? ? 831 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 155.5 ? ? ? ? ? ? ? 8  1 0.9788 ? 0.1411 
3.132 3.257  ? 5.66  ? ? ? ? 836 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 153.4 ? ? ? ? ? ? ? 9  1 0.9646 ? 0.1782 
3.024 3.132  ? 4.82  ? ? ? ? 843 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 148.1 ? ? ? ? ? ? ? 10 1 0.9690 ? 0.1892 
2.929 3.024  ? 3.58  ? ? ? ? 812 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 142.4 ? ? ? ? ? ? ? 11 1 0.9443 ? 0.2642 
2.846 2.929  ? 2.95  ? ? ? ? 820 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 136.0 ? ? ? ? ? ? ? 12 1 0.9163 ? 0.3406 
2.771 2.846  ? 2.61  ? ? ? ? 824 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 126.0 ? ? ? ? ? ? ? 13 1 0.9113 ? 0.3835 
2.703 2.771  ? 2.16  ? ? ? ? 839 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 116.4 ? ? ? ? ? ? ? 14 1 0.8382 ? 0.4782 
2.641 2.703  ? 1.83  ? ? ? ? 827 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 103.0 ? ? ? ? ? ? ? 15 1 0.8087 ? 0.5895 
2.585 2.641  ? 1.51  ? ? ? ? 804 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 89.9  ? ? ? ? ? ? ? 16 1 0.7669 ? 0.6753 
2.534 2.585  ? 1.28  ? ? ? ? 850 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 74.3  ? ? ? ? ? ? ? 17 1 0.7434 ? 0.8203 
2.486 2.534  ? 1.22  ? ? ? ? 815 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 59.5  ? ? ? ? ? ? ? 18 1 0.6242 ? 0.9240 
2.441 2.486  ? 0.88  ? ? ? ? 823 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 47.3  ? ? ? ? ? ? ? 19 1 0.4845 ? 1.2784 
2.400 2.441  ? 0.87  ? ? ? ? 808 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 38.1  ? ? ? ? ? ? ? 20 1 0.4237 ? 1.2569 
# 
_refine.aniso_B[1][1]                            1.8900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -4.2800 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            2.3900 
_refine.B_iso_max                                138.190 
_refine.B_iso_mean                               49.2730 
_refine.B_iso_min                                3.710 
_refine.correlation_coeff_Fo_to_Fc               0.8030 
_refine.correlation_coeff_Fo_to_Fc_free          0.7140 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7E6X 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5000 
_refine.ls_d_res_low                             14.9600 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     11400 
_refine.ls_number_reflns_R_free                  592 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    80.9600 
_refine.ls_percent_reflns_R_free                 4.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.4089 
_refine.ls_R_factor_R_free                       0.4869 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.4048 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3ug9 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       1.5500 
_refine.pdbx_overall_ESU_R_Free                  0.6260 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             72.1980 
_refine.overall_SU_ML                            1.4300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.5000 
_refine_hist.d_res_low                        14.9600 
_refine_hist.number_atoms_solvent             38 
_refine_hist.number_atoms_total               2529 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       296 
_refine_hist.pdbx_B_iso_mean_ligand           65.51 
_refine_hist.pdbx_B_iso_mean_solvent          28.59 
_refine_hist.pdbx_number_atoms_protein        2317 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         174 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  0.013  2545 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.017  2439 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.478  1.648  3426 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.213  1.573  5598 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 5.785  4.993  294  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 36.894 21.579 114  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 19.844 15.000 371  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 19.411 15.000 7    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.066  0.200  329  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  2754 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  586  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.5000 
_refine_ls_shell.d_res_low                        2.5650 
_refine_ls_shell.number_reflns_all                855 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_R_work             812 
_refine_ls_shell.percent_reflns_obs               80.2100 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.6320 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.6200 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     7E6X 
_struct.title                        
'Time-resolved serial femtosecond crystallography reveals early structural changes in channelrhodopsin: 4 ms structure' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7E6X 
_struct_keywords.text            'Channelrhodopsin, Rhodopsin, Membrane Protein' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q93WP2_CHLRE Q93WP2 ? 1 
;MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCFCLAWLK
SNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMIKFIIEYFHEFDEPAVIYSSNGNKTVWLRY
AEWLLTCPVILIHLSNLTGLANDYNKRTMGLLVSDIGTIVWGTTAALSKGYVRVIFFLMGLCYGIYTFFNAAKVYIEAYH
TVPKG
;
1   
2 UNP Q8RUT8_CHLRE Q8RUT8 ? 1 
;RCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTK
LNIGGTEIEVETLVEDEAEAGAV
;
207 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7E6X A 1   ? 245 ? Q93WP2 1   ? 245 ? 1   245 
2 2 7E6X A 246 ? 348 ? Q8RUT8 207 ? 309 ? 246 348 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 7E6X SER A 349 ? UNP Q8RUT8 ? ? 'expression tag' 349 1 
2 7E6X SER A 350 ? UNP Q8RUT8 ? ? 'expression tag' 350 2 
2 7E6X GLU A 351 ? UNP Q8RUT8 ? ? 'expression tag' 351 3 
2 7E6X ASP A 352 ? UNP Q8RUT8 ? ? 'expression tag' 352 4 
2 7E6X LEU A 353 ? UNP Q8RUT8 ? ? 'expression tag' 353 5 
2 7E6X TYR A 354 ? UNP Q8RUT8 ? ? 'expression tag' 354 6 
2 7E6X PHE A 355 ? UNP Q8RUT8 ? ? 'expression tag' 355 7 
2 7E6X GLN A 356 ? UNP Q8RUT8 ? ? 'expression tag' 356 8 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8160  ? 
1 MORE         -52   ? 
1 'SSA (A^2)'  26640 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 47.3500000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 CYS A 75  ? LYS A 80  ? CYS A 75  LYS A 80  5 ? 6  
HELX_P HELX_P2 AA2 THR A 84  ? GLY A 110 ? THR A 84  GLY A 110 1 ? 27 
HELX_P HELX_P3 AA3 GLY A 119 ? GLU A 140 ? GLY A 119 GLU A 140 1 ? 22 
HELX_P HELX_P4 AA4 VAL A 156 ? SER A 175 ? VAL A 156 SER A 175 1 ? 20 
HELX_P HELX_P5 AA5 ASN A 185 ? SER A 208 ? ASN A 185 SER A 208 1 ? 24 
HELX_P HELX_P6 AA6 LYS A 209 ? VAL A 242 ? LYS A 209 VAL A 242 1 ? 34 
HELX_P HELX_P7 AA7 GLY A 245 ? GLY A 272 ? GLY A 245 GLY A 272 1 ? 28 
HELX_P HELX_P8 AA8 SER A 280 ? LYS A 296 ? SER A 280 LYS A 296 1 ? 17 
HELX_P HELX_P9 AA9 LYS A 296 ? HIS A 317 ? LYS A 296 HIS A 317 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 66  SG  ? ? ? 1_555 A CYS 66 SG  ? ? A CYS 66  A CYS 66  3_555 ? ? ? ? ? ? ? 2.063 ? ?               
disulf2 disulf ?    ? A CYS 73  SG  ? ? ? 1_555 A CYS 75 SG  ? ? A CYS 73  A CYS 75  3_555 ? ? ? ? ? ? ? 2.266 ? ?               
covale1 covale one  ? A ASN 61  ND2 ? ? ? 1_555 B NAG .  C1  ? ? A ASN 61  E NAG 1   1_555 ? ? ? ? ? ? ? 1.416 ? N-Glycosylation 
covale2 covale one  ? A LYS 296 NZ  ? ? ? 1_555 C RET .  C15 ? ? A LYS 296 A RET 401 1_555 ? ? ? ? ? ? ? 1.330 ? ?               
covale3 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .  C1  ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.339 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 NAG B .  ? ASN A 61  ? NAG E 1   ? 1_555 ASN A 61  ? 1_555 C1  ND2 ASN 1 NAG N-Glycosylation Carbohydrate       
2 RET C .  ? LYS A 296 ? RET A 401 ? 1_555 LYS A 296 ? 1_555 C15 NZ  LYS 1 RET Retinoylation   Lipid/lipid-like   
3 CYS A 66 ? CYS A 66  ? CYS A 66  ? 1_555 CYS A 66  ? 3_555 SG  SG  .   . .   None            'Disulfide bridge' 
4 CYS A 73 ? CYS A 75  ? CYS A 73  ? 1_555 CYS A 75  ? 3_555 SG  SG  .   . .   None            'Disulfide bridge' 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           143 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            143 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    144 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     144 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       10.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 57  ? GLU A 59  ? THR A 57  GLU A 59  
AA1 2 VAL A 64  ? CYS A 66  ? VAL A 64  CYS A 66  
AA2 1 ILE A 147 ? TYR A 148 ? ILE A 147 TYR A 148 
AA2 2 LYS A 154 ? THR A 155 ? LYS A 154 THR A 155 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 59  ? N GLU A 59  O VAL A 64  ? O VAL A 64  
AA2 1 2 N ILE A 147 ? N ILE A 147 O THR A 155 ? O THR A 155 
# 
_pdbx_entry_details.entry_id                   7E6X 
_pdbx_entry_details.has_ligand_of_interest     N 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CB 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   PRO 
_pdbx_validate_close_contact.auth_seq_id_1    168 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    506 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.06 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 139 ? ? -145.28 36.80  
2 1 LYS A 296 ? ? -107.91 -77.02 
3 1 ASN A 327 ? ? -143.26 26.95  
4 1 ALA A 345 ? ? -162.21 46.42  
5 1 SER A 349 ? ? -65.13  91.49  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A ARG 3   ? A ARG 3   
4  1 Y 1 A ARG 4   ? A ARG 4   
5  1 Y 1 A PRO 5   ? A PRO 5   
6  1 Y 1 A TRP 6   ? A TRP 6   
7  1 Y 1 A LEU 7   ? A LEU 7   
8  1 Y 1 A LEU 8   ? A LEU 8   
9  1 Y 1 A ALA 9   ? A ALA 9   
10 1 Y 1 A LEU 10  ? A LEU 10  
11 1 Y 1 A ALA 11  ? A ALA 11  
12 1 Y 1 A LEU 12  ? A LEU 12  
13 1 Y 1 A ALA 13  ? A ALA 13  
14 1 Y 1 A VAL 14  ? A VAL 14  
15 1 Y 1 A ALA 15  ? A ALA 15  
16 1 Y 1 A LEU 16  ? A LEU 16  
17 1 Y 1 A ALA 17  ? A ALA 17  
18 1 Y 1 A ALA 18  ? A ALA 18  
19 1 Y 1 A GLY 19  ? A GLY 19  
20 1 Y 1 A SER 20  ? A SER 20  
21 1 Y 1 A ALA 21  ? A ALA 21  
22 1 Y 1 A GLY 22  ? A GLY 22  
23 1 Y 1 A ALA 23  ? A ALA 23  
24 1 Y 1 A SER 24  ? A SER 24  
25 1 Y 1 A THR 25  ? A THR 25  
26 1 Y 1 A GLY 26  ? A GLY 26  
27 1 Y 1 A SER 27  ? A SER 27  
28 1 Y 1 A ASP 28  ? A ASP 28  
29 1 Y 1 A ALA 29  ? A ALA 29  
30 1 Y 1 A THR 30  ? A THR 30  
31 1 Y 1 A VAL 31  ? A VAL 31  
32 1 Y 1 A PRO 32  ? A PRO 32  
33 1 Y 1 A VAL 33  ? A VAL 33  
34 1 Y 1 A ALA 34  ? A ALA 34  
35 1 Y 1 A THR 35  ? A THR 35  
36 1 Y 1 A GLN 36  ? A GLN 36  
37 1 Y 1 A ASP 37  ? A ASP 37  
38 1 Y 1 A GLY 38  ? A GLY 38  
39 1 Y 1 A PRO 39  ? A PRO 39  
40 1 Y 1 A ASP 40  ? A ASP 40  
41 1 Y 1 A TYR 41  ? A TYR 41  
42 1 Y 1 A VAL 42  ? A VAL 42  
43 1 Y 1 A PHE 43  ? A PHE 43  
44 1 Y 1 A HIS 44  ? A HIS 44  
45 1 Y 1 A ARG 45  ? A ARG 45  
46 1 Y 1 A ALA 46  ? A ALA 46  
47 1 Y 1 A HIS 47  ? A HIS 47  
48 1 Y 1 A GLU 48  ? A GLU 48  
49 1 Y 1 A GLN 112 ? A GLN 112 
50 1 Y 1 A THR 113 ? A THR 113 
51 1 Y 1 A TRP 114 ? A TRP 114 
52 1 Y 1 A LYS 115 ? A LYS 115 
53 1 Y 1 A SER 116 ? A SER 116 
54 1 Y 1 A THR 117 ? A THR 117 
55 1 Y 1 A GLY 329 ? A GLY 329 
56 1 Y 1 A GLY 330 ? A GLY 330 
57 1 Y 1 A LEU 353 ? A LEU 353 
58 1 Y 1 A TYR 354 ? A TYR 354 
59 1 Y 1 A PHE 355 ? A PHE 355 
60 1 Y 1 A GLN 356 ? A GLN 356 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
HOH O    O N N 158 
HOH H1   H N N 159 
HOH H2   H N N 160 
ILE N    N N N 161 
ILE CA   C N S 162 
ILE C    C N N 163 
ILE O    O N N 164 
ILE CB   C N S 165 
ILE CG1  C N N 166 
ILE CG2  C N N 167 
ILE CD1  C N N 168 
ILE OXT  O N N 169 
ILE H    H N N 170 
ILE H2   H N N 171 
ILE HA   H N N 172 
ILE HB   H N N 173 
ILE HG12 H N N 174 
ILE HG13 H N N 175 
ILE HG21 H N N 176 
ILE HG22 H N N 177 
ILE HG23 H N N 178 
ILE HD11 H N N 179 
ILE HD12 H N N 180 
ILE HD13 H N N 181 
ILE HXT  H N N 182 
LEU N    N N N 183 
LEU CA   C N S 184 
LEU C    C N N 185 
LEU O    O N N 186 
LEU CB   C N N 187 
LEU CG   C N N 188 
LEU CD1  C N N 189 
LEU CD2  C N N 190 
LEU OXT  O N N 191 
LEU H    H N N 192 
LEU H2   H N N 193 
LEU HA   H N N 194 
LEU HB2  H N N 195 
LEU HB3  H N N 196 
LEU HG   H N N 197 
LEU HD11 H N N 198 
LEU HD12 H N N 199 
LEU HD13 H N N 200 
LEU HD21 H N N 201 
LEU HD22 H N N 202 
LEU HD23 H N N 203 
LEU HXT  H N N 204 
LYS N    N N N 205 
LYS CA   C N S 206 
LYS C    C N N 207 
LYS O    O N N 208 
LYS CB   C N N 209 
LYS CG   C N N 210 
LYS CD   C N N 211 
LYS CE   C N N 212 
LYS NZ   N N N 213 
LYS OXT  O N N 214 
LYS H    H N N 215 
LYS H2   H N N 216 
LYS HA   H N N 217 
LYS HB2  H N N 218 
LYS HB3  H N N 219 
LYS HG2  H N N 220 
LYS HG3  H N N 221 
LYS HD2  H N N 222 
LYS HD3  H N N 223 
LYS HE2  H N N 224 
LYS HE3  H N N 225 
LYS HZ1  H N N 226 
LYS HZ2  H N N 227 
LYS HZ3  H N N 228 
LYS HXT  H N N 229 
MET N    N N N 230 
MET CA   C N S 231 
MET C    C N N 232 
MET O    O N N 233 
MET CB   C N N 234 
MET CG   C N N 235 
MET SD   S N N 236 
MET CE   C N N 237 
MET OXT  O N N 238 
MET H    H N N 239 
MET H2   H N N 240 
MET HA   H N N 241 
MET HB2  H N N 242 
MET HB3  H N N 243 
MET HG2  H N N 244 
MET HG3  H N N 245 
MET HE1  H N N 246 
MET HE2  H N N 247 
MET HE3  H N N 248 
MET HXT  H N N 249 
NAG C1   C N R 250 
NAG C2   C N R 251 
NAG C3   C N R 252 
NAG C4   C N S 253 
NAG C5   C N R 254 
NAG C6   C N N 255 
NAG C7   C N N 256 
NAG C8   C N N 257 
NAG N2   N N N 258 
NAG O1   O N N 259 
NAG O3   O N N 260 
NAG O4   O N N 261 
NAG O5   O N N 262 
NAG O6   O N N 263 
NAG O7   O N N 264 
NAG H1   H N N 265 
NAG H2   H N N 266 
NAG H3   H N N 267 
NAG H4   H N N 268 
NAG H5   H N N 269 
NAG H61  H N N 270 
NAG H62  H N N 271 
NAG H81  H N N 272 
NAG H82  H N N 273 
NAG H83  H N N 274 
NAG HN2  H N N 275 
NAG HO1  H N N 276 
NAG HO3  H N N 277 
NAG HO4  H N N 278 
NAG HO6  H N N 279 
OLC C18  C N N 280 
OLC C10  C N N 281 
OLC C9   C N N 282 
OLC C17  C N N 283 
OLC C11  C N N 284 
OLC C8   C N N 285 
OLC C24  C N N 286 
OLC C16  C N N 287 
OLC C12  C N N 288 
OLC C7   C N N 289 
OLC C15  C N N 290 
OLC C13  C N N 291 
OLC C6   C N N 292 
OLC C14  C N N 293 
OLC C5   C N N 294 
OLC C4   C N N 295 
OLC C3   C N N 296 
OLC C2   C N N 297 
OLC C21  C N N 298 
OLC C1   C N N 299 
OLC C22  C N R 300 
OLC O19  O N N 301 
OLC O25  O N N 302 
OLC O23  O N N 303 
OLC O20  O N N 304 
OLC H18  H N N 305 
OLC H18A H N N 306 
OLC H18B H N N 307 
OLC H10  H N N 308 
OLC H9   H N N 309 
OLC H17  H N N 310 
OLC H17A H N N 311 
OLC H11  H N N 312 
OLC H11A H N N 313 
OLC H8   H N N 314 
OLC H8A  H N N 315 
OLC H24  H N N 316 
OLC H24A H N N 317 
OLC H16  H N N 318 
OLC H16A H N N 319 
OLC H12  H N N 320 
OLC H12A H N N 321 
OLC H7   H N N 322 
OLC H7A  H N N 323 
OLC H15  H N N 324 
OLC H15A H N N 325 
OLC H13  H N N 326 
OLC H13A H N N 327 
OLC H6   H N N 328 
OLC H6A  H N N 329 
OLC H14  H N N 330 
OLC H14A H N N 331 
OLC H5   H N N 332 
OLC H5A  H N N 333 
OLC H4   H N N 334 
OLC H4A  H N N 335 
OLC H3   H N N 336 
OLC H3A  H N N 337 
OLC H2   H N N 338 
OLC H2A  H N N 339 
OLC H21  H N N 340 
OLC H21A H N N 341 
OLC H22  H N N 342 
OLC HO25 H N N 343 
OLC HO23 H N N 344 
PHE N    N N N 345 
PHE CA   C N S 346 
PHE C    C N N 347 
PHE O    O N N 348 
PHE CB   C N N 349 
PHE CG   C Y N 350 
PHE CD1  C Y N 351 
PHE CD2  C Y N 352 
PHE CE1  C Y N 353 
PHE CE2  C Y N 354 
PHE CZ   C Y N 355 
PHE OXT  O N N 356 
PHE H    H N N 357 
PHE H2   H N N 358 
PHE HA   H N N 359 
PHE HB2  H N N 360 
PHE HB3  H N N 361 
PHE HD1  H N N 362 
PHE HD2  H N N 363 
PHE HE1  H N N 364 
PHE HE2  H N N 365 
PHE HZ   H N N 366 
PHE HXT  H N N 367 
PRO N    N N N 368 
PRO CA   C N S 369 
PRO C    C N N 370 
PRO O    O N N 371 
PRO CB   C N N 372 
PRO CG   C N N 373 
PRO CD   C N N 374 
PRO OXT  O N N 375 
PRO H    H N N 376 
PRO HA   H N N 377 
PRO HB2  H N N 378 
PRO HB3  H N N 379 
PRO HG2  H N N 380 
PRO HG3  H N N 381 
PRO HD2  H N N 382 
PRO HD3  H N N 383 
PRO HXT  H N N 384 
RET C1   C N N 385 
RET C2   C N N 386 
RET C3   C N N 387 
RET C4   C N N 388 
RET C5   C N N 389 
RET C6   C N N 390 
RET C7   C N N 391 
RET C8   C N N 392 
RET C9   C N N 393 
RET C10  C N N 394 
RET C11  C N N 395 
RET C12  C N N 396 
RET C13  C N N 397 
RET C14  C N N 398 
RET C15  C N N 399 
RET O1   O N N 400 
RET C16  C N N 401 
RET C17  C N N 402 
RET C18  C N N 403 
RET C19  C N N 404 
RET C20  C N N 405 
RET H21  H N N 406 
RET H22  H N N 407 
RET H31  H N N 408 
RET H32  H N N 409 
RET H41  H N N 410 
RET H42  H N N 411 
RET H7   H N N 412 
RET H8   H N N 413 
RET H10  H N N 414 
RET H11  H N N 415 
RET H12  H N N 416 
RET H14  H N N 417 
RET H15  H N N 418 
RET H161 H N N 419 
RET H162 H N N 420 
RET H163 H N N 421 
RET H171 H N N 422 
RET H172 H N N 423 
RET H173 H N N 424 
RET H181 H N N 425 
RET H182 H N N 426 
RET H183 H N N 427 
RET H191 H N N 428 
RET H192 H N N 429 
RET H193 H N N 430 
RET H201 H N N 431 
RET H202 H N N 432 
RET H203 H N N 433 
SER N    N N N 434 
SER CA   C N S 435 
SER C    C N N 436 
SER O    O N N 437 
SER CB   C N N 438 
SER OG   O N N 439 
SER OXT  O N N 440 
SER H    H N N 441 
SER H2   H N N 442 
SER HA   H N N 443 
SER HB2  H N N 444 
SER HB3  H N N 445 
SER HG   H N N 446 
SER HXT  H N N 447 
THR N    N N N 448 
THR CA   C N S 449 
THR C    C N N 450 
THR O    O N N 451 
THR CB   C N R 452 
THR OG1  O N N 453 
THR CG2  C N N 454 
THR OXT  O N N 455 
THR H    H N N 456 
THR H2   H N N 457 
THR HA   H N N 458 
THR HB   H N N 459 
THR HG1  H N N 460 
THR HG21 H N N 461 
THR HG22 H N N 462 
THR HG23 H N N 463 
THR HXT  H N N 464 
TRP N    N N N 465 
TRP CA   C N S 466 
TRP C    C N N 467 
TRP O    O N N 468 
TRP CB   C N N 469 
TRP CG   C Y N 470 
TRP CD1  C Y N 471 
TRP CD2  C Y N 472 
TRP NE1  N Y N 473 
TRP CE2  C Y N 474 
TRP CE3  C Y N 475 
TRP CZ2  C Y N 476 
TRP CZ3  C Y N 477 
TRP CH2  C Y N 478 
TRP OXT  O N N 479 
TRP H    H N N 480 
TRP H2   H N N 481 
TRP HA   H N N 482 
TRP HB2  H N N 483 
TRP HB3  H N N 484 
TRP HD1  H N N 485 
TRP HE1  H N N 486 
TRP HE3  H N N 487 
TRP HZ2  H N N 488 
TRP HZ3  H N N 489 
TRP HH2  H N N 490 
TRP HXT  H N N 491 
TYR N    N N N 492 
TYR CA   C N S 493 
TYR C    C N N 494 
TYR O    O N N 495 
TYR CB   C N N 496 
TYR CG   C Y N 497 
TYR CD1  C Y N 498 
TYR CD2  C Y N 499 
TYR CE1  C Y N 500 
TYR CE2  C Y N 501 
TYR CZ   C Y N 502 
TYR OH   O N N 503 
TYR OXT  O N N 504 
TYR H    H N N 505 
TYR H2   H N N 506 
TYR HA   H N N 507 
TYR HB2  H N N 508 
TYR HB3  H N N 509 
TYR HD1  H N N 510 
TYR HD2  H N N 511 
TYR HE1  H N N 512 
TYR HE2  H N N 513 
TYR HH   H N N 514 
TYR HXT  H N N 515 
VAL N    N N N 516 
VAL CA   C N S 517 
VAL C    C N N 518 
VAL O    O N N 519 
VAL CB   C N N 520 
VAL CG1  C N N 521 
VAL CG2  C N N 522 
VAL OXT  O N N 523 
VAL H    H N N 524 
VAL H2   H N N 525 
VAL HA   H N N 526 
VAL HB   H N N 527 
VAL HG11 H N N 528 
VAL HG12 H N N 529 
VAL HG13 H N N 530 
VAL HG21 H N N 531 
VAL HG22 H N N 532 
VAL HG23 H N N 533 
VAL HXT  H N N 534 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MET N   CA   sing N N 218 
MET N   H    sing N N 219 
MET N   H2   sing N N 220 
MET CA  C    sing N N 221 
MET CA  CB   sing N N 222 
MET CA  HA   sing N N 223 
MET C   O    doub N N 224 
MET C   OXT  sing N N 225 
MET CB  CG   sing N N 226 
MET CB  HB2  sing N N 227 
MET CB  HB3  sing N N 228 
MET CG  SD   sing N N 229 
MET CG  HG2  sing N N 230 
MET CG  HG3  sing N N 231 
MET SD  CE   sing N N 232 
MET CE  HE1  sing N N 233 
MET CE  HE2  sing N N 234 
MET CE  HE3  sing N N 235 
MET OXT HXT  sing N N 236 
NAG C1  C2   sing N N 237 
NAG C1  O1   sing N N 238 
NAG C1  O5   sing N N 239 
NAG C1  H1   sing N N 240 
NAG C2  C3   sing N N 241 
NAG C2  N2   sing N N 242 
NAG C2  H2   sing N N 243 
NAG C3  C4   sing N N 244 
NAG C3  O3   sing N N 245 
NAG C3  H3   sing N N 246 
NAG C4  C5   sing N N 247 
NAG C4  O4   sing N N 248 
NAG C4  H4   sing N N 249 
NAG C5  C6   sing N N 250 
NAG C5  O5   sing N N 251 
NAG C5  H5   sing N N 252 
NAG C6  O6   sing N N 253 
NAG C6  H61  sing N N 254 
NAG C6  H62  sing N N 255 
NAG C7  C8   sing N N 256 
NAG C7  N2   sing N N 257 
NAG C7  O7   doub N N 258 
NAG C8  H81  sing N N 259 
NAG C8  H82  sing N N 260 
NAG C8  H83  sing N N 261 
NAG N2  HN2  sing N N 262 
NAG O1  HO1  sing N N 263 
NAG O3  HO3  sing N N 264 
NAG O4  HO4  sing N N 265 
NAG O6  HO6  sing N N 266 
OLC C18 C17  sing N N 267 
OLC C10 C9   doub N N 268 
OLC C10 C11  sing N N 269 
OLC C9  C8   sing N N 270 
OLC C17 C16  sing N Z 271 
OLC C11 C12  sing N N 272 
OLC C8  C7   sing N N 273 
OLC C24 C22  sing N N 274 
OLC C24 O25  sing N N 275 
OLC C16 C15  sing N N 276 
OLC C12 C13  sing N N 277 
OLC C7  C6   sing N N 278 
OLC C15 C14  sing N N 279 
OLC C13 C14  sing N N 280 
OLC C6  C5   sing N N 281 
OLC C5  C4   sing N N 282 
OLC C4  C3   sing N N 283 
OLC C3  C2   sing N N 284 
OLC C2  C1   sing N N 285 
OLC C21 C22  sing N N 286 
OLC C21 O20  sing N N 287 
OLC C1  O19  doub N N 288 
OLC C1  O20  sing N N 289 
OLC C22 O23  sing N N 290 
OLC C18 H18  sing N N 291 
OLC C18 H18A sing N N 292 
OLC C18 H18B sing N N 293 
OLC C10 H10  sing N N 294 
OLC C9  H9   sing N N 295 
OLC C17 H17  sing N N 296 
OLC C17 H17A sing N N 297 
OLC C11 H11  sing N N 298 
OLC C11 H11A sing N N 299 
OLC C8  H8   sing N N 300 
OLC C8  H8A  sing N N 301 
OLC C24 H24  sing N N 302 
OLC C24 H24A sing N N 303 
OLC C16 H16  sing N N 304 
OLC C16 H16A sing N N 305 
OLC C12 H12  sing N N 306 
OLC C12 H12A sing N N 307 
OLC C7  H7   sing N N 308 
OLC C7  H7A  sing N N 309 
OLC C15 H15  sing N N 310 
OLC C15 H15A sing N N 311 
OLC C13 H13  sing N N 312 
OLC C13 H13A sing N N 313 
OLC C6  H6   sing N N 314 
OLC C6  H6A  sing N N 315 
OLC C14 H14  sing N N 316 
OLC C14 H14A sing N N 317 
OLC C5  H5   sing N N 318 
OLC C5  H5A  sing N N 319 
OLC C4  H4   sing N N 320 
OLC C4  H4A  sing N N 321 
OLC C3  H3   sing N N 322 
OLC C3  H3A  sing N N 323 
OLC C2  H2   sing N N 324 
OLC C2  H2A  sing N N 325 
OLC C21 H21  sing N N 326 
OLC C21 H21A sing N N 327 
OLC C22 H22  sing N N 328 
OLC O25 HO25 sing N N 329 
OLC O23 HO23 sing N N 330 
PHE N   CA   sing N N 331 
PHE N   H    sing N N 332 
PHE N   H2   sing N N 333 
PHE CA  C    sing N N 334 
PHE CA  CB   sing N N 335 
PHE CA  HA   sing N N 336 
PHE C   O    doub N N 337 
PHE C   OXT  sing N N 338 
PHE CB  CG   sing N N 339 
PHE CB  HB2  sing N N 340 
PHE CB  HB3  sing N N 341 
PHE CG  CD1  doub Y N 342 
PHE CG  CD2  sing Y N 343 
PHE CD1 CE1  sing Y N 344 
PHE CD1 HD1  sing N N 345 
PHE CD2 CE2  doub Y N 346 
PHE CD2 HD2  sing N N 347 
PHE CE1 CZ   doub Y N 348 
PHE CE1 HE1  sing N N 349 
PHE CE2 CZ   sing Y N 350 
PHE CE2 HE2  sing N N 351 
PHE CZ  HZ   sing N N 352 
PHE OXT HXT  sing N N 353 
PRO N   CA   sing N N 354 
PRO N   CD   sing N N 355 
PRO N   H    sing N N 356 
PRO CA  C    sing N N 357 
PRO CA  CB   sing N N 358 
PRO CA  HA   sing N N 359 
PRO C   O    doub N N 360 
PRO C   OXT  sing N N 361 
PRO CB  CG   sing N N 362 
PRO CB  HB2  sing N N 363 
PRO CB  HB3  sing N N 364 
PRO CG  CD   sing N N 365 
PRO CG  HG2  sing N N 366 
PRO CG  HG3  sing N N 367 
PRO CD  HD2  sing N N 368 
PRO CD  HD3  sing N N 369 
PRO OXT HXT  sing N N 370 
RET C1  C2   sing N N 371 
RET C1  C6   sing N N 372 
RET C1  C16  sing N N 373 
RET C1  C17  sing N N 374 
RET C2  C3   sing N N 375 
RET C2  H21  sing N N 376 
RET C2  H22  sing N N 377 
RET C3  C4   sing N N 378 
RET C3  H31  sing N N 379 
RET C3  H32  sing N N 380 
RET C4  C5   sing N N 381 
RET C4  H41  sing N N 382 
RET C4  H42  sing N N 383 
RET C5  C6   doub N N 384 
RET C5  C18  sing N N 385 
RET C6  C7   sing N N 386 
RET C7  C8   doub N E 387 
RET C7  H7   sing N N 388 
RET C8  C9   sing N N 389 
RET C8  H8   sing N N 390 
RET C9  C10  doub N E 391 
RET C9  C19  sing N N 392 
RET C10 C11  sing N N 393 
RET C10 H10  sing N N 394 
RET C11 C12  doub N E 395 
RET C11 H11  sing N N 396 
RET C12 C13  sing N N 397 
RET C12 H12  sing N N 398 
RET C13 C14  doub N E 399 
RET C13 C20  sing N N 400 
RET C14 C15  sing N N 401 
RET C14 H14  sing N N 402 
RET C15 O1   doub N N 403 
RET C15 H15  sing N N 404 
RET C16 H161 sing N N 405 
RET C16 H162 sing N N 406 
RET C16 H163 sing N N 407 
RET C17 H171 sing N N 408 
RET C17 H172 sing N N 409 
RET C17 H173 sing N N 410 
RET C18 H181 sing N N 411 
RET C18 H182 sing N N 412 
RET C18 H183 sing N N 413 
RET C19 H191 sing N N 414 
RET C19 H192 sing N N 415 
RET C19 H193 sing N N 416 
RET C20 H201 sing N N 417 
RET C20 H202 sing N N 418 
RET C20 H203 sing N N 419 
SER N   CA   sing N N 420 
SER N   H    sing N N 421 
SER N   H2   sing N N 422 
SER CA  C    sing N N 423 
SER CA  CB   sing N N 424 
SER CA  HA   sing N N 425 
SER C   O    doub N N 426 
SER C   OXT  sing N N 427 
SER CB  OG   sing N N 428 
SER CB  HB2  sing N N 429 
SER CB  HB3  sing N N 430 
SER OG  HG   sing N N 431 
SER OXT HXT  sing N N 432 
THR N   CA   sing N N 433 
THR N   H    sing N N 434 
THR N   H2   sing N N 435 
THR CA  C    sing N N 436 
THR CA  CB   sing N N 437 
THR CA  HA   sing N N 438 
THR C   O    doub N N 439 
THR C   OXT  sing N N 440 
THR CB  OG1  sing N N 441 
THR CB  CG2  sing N N 442 
THR CB  HB   sing N N 443 
THR OG1 HG1  sing N N 444 
THR CG2 HG21 sing N N 445 
THR CG2 HG22 sing N N 446 
THR CG2 HG23 sing N N 447 
THR OXT HXT  sing N N 448 
TRP N   CA   sing N N 449 
TRP N   H    sing N N 450 
TRP N   H2   sing N N 451 
TRP CA  C    sing N N 452 
TRP CA  CB   sing N N 453 
TRP CA  HA   sing N N 454 
TRP C   O    doub N N 455 
TRP C   OXT  sing N N 456 
TRP CB  CG   sing N N 457 
TRP CB  HB2  sing N N 458 
TRP CB  HB3  sing N N 459 
TRP CG  CD1  doub Y N 460 
TRP CG  CD2  sing Y N 461 
TRP CD1 NE1  sing Y N 462 
TRP CD1 HD1  sing N N 463 
TRP CD2 CE2  doub Y N 464 
TRP CD2 CE3  sing Y N 465 
TRP NE1 CE2  sing Y N 466 
TRP NE1 HE1  sing N N 467 
TRP CE2 CZ2  sing Y N 468 
TRP CE3 CZ3  doub Y N 469 
TRP CE3 HE3  sing N N 470 
TRP CZ2 CH2  doub Y N 471 
TRP CZ2 HZ2  sing N N 472 
TRP CZ3 CH2  sing Y N 473 
TRP CZ3 HZ3  sing N N 474 
TRP CH2 HH2  sing N N 475 
TRP OXT HXT  sing N N 476 
TYR N   CA   sing N N 477 
TYR N   H    sing N N 478 
TYR N   H2   sing N N 479 
TYR CA  C    sing N N 480 
TYR CA  CB   sing N N 481 
TYR CA  HA   sing N N 482 
TYR C   O    doub N N 483 
TYR C   OXT  sing N N 484 
TYR CB  CG   sing N N 485 
TYR CB  HB2  sing N N 486 
TYR CB  HB3  sing N N 487 
TYR CG  CD1  doub Y N 488 
TYR CG  CD2  sing Y N 489 
TYR CD1 CE1  sing Y N 490 
TYR CD1 HD1  sing N N 491 
TYR CD2 CE2  doub Y N 492 
TYR CD2 HD2  sing N N 493 
TYR CE1 CZ   doub Y N 494 
TYR CE1 HE1  sing N N 495 
TYR CE2 CZ   sing Y N 496 
TYR CE2 HE2  sing N N 497 
TYR CZ  OH   sing N N 498 
TYR OH  HH   sing N N 499 
TYR OXT HXT  sing N N 500 
VAL N   CA   sing N N 501 
VAL N   H    sing N N 502 
VAL N   H2   sing N N 503 
VAL CA  C    sing N N 504 
VAL CA  CB   sing N N 505 
VAL CA  HA   sing N N 506 
VAL C   O    doub N N 507 
VAL C   OXT  sing N N 508 
VAL CB  CG1  sing N N 509 
VAL CB  CG2  sing N N 510 
VAL CB  HB   sing N N 511 
VAL CG1 HG11 sing N N 512 
VAL CG1 HG12 sing N N 513 
VAL CG1 HG13 sing N N 514 
VAL CG2 HG21 sing N N 515 
VAL CG2 HG22 sing N N 516 
VAL CG2 HG23 sing N N 517 
VAL OXT HXT  sing N N 518 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   3UG9 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_related_exp_data_set.ordinal              1 
_pdbx_related_exp_data_set.data_set_type        'diffraction image data' 
_pdbx_related_exp_data_set.data_reference       10.11577/1768368 
_pdbx_related_exp_data_set.metadata_reference   ? 
_pdbx_related_exp_data_set.details              ? 
# 
_atom_sites.entry_id                    7E6X 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.016181 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007032 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010560 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_