data_7EAU # _entry.id 7EAU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7EAU pdb_00007eau 10.2210/pdb7eau/pdb WWPDB D_1300021037 ? ? BMRB 36412 ? 10.13018/BMR36412 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-11-03 2 'Structure model' 1 1 2022-02-23 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7EAU _pdbx_database_status.recvd_initial_deposition_date 2021-03-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'SIN1, an effector of Colletotrichum orbiculare' _pdbx_database_related.db_id 36412 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mori, M.' 1 0000-0002-9021-8104 'Ohki, S.' 2 0000-0002-5497-7277 'Kurita, J.' 3 0000-0002-7369-3130 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 297 _citation.language ? _citation.page_first 101370 _citation.page_last 101370 _citation.title ;Fungal effector SIB1 of Colletotrichum orbiculare has unique structural features and can suppress plant immunity in Nicotiana benthamiana. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2021.101370 _citation.pdbx_database_id_PubMed 34756891 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, R.' 1 ? primary 'Isozumi, N.' 2 ? primary 'Mori, M.' 3 ? primary 'Okuta, R.' 4 ? primary 'Singkaravanit-Ogawa, S.' 5 ? primary 'Imamura, T.' 6 ? primary 'Kurita, J.I.' 7 ? primary 'Gan, P.' 8 ? primary 'Shirasu, K.' 9 ? primary 'Ohki, S.' 10 ? primary 'Takano, Y.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description SIN1 _entity.formula_weight 5046.589 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)EGKCTAKGECQENTSGVKLFCTSGSCAKKEGQACTRNGPGSSNSASCPK' _entity_poly.pdbx_seq_one_letter_code_can QEGKCTAKGECQENTSGVKLFCTSGSCAKKEGQACTRNGPGSSNSASCPK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 GLU n 1 3 GLY n 1 4 LYS n 1 5 CYS n 1 6 THR n 1 7 ALA n 1 8 LYS n 1 9 GLY n 1 10 GLU n 1 11 CYS n 1 12 GLN n 1 13 GLU n 1 14 ASN n 1 15 THR n 1 16 SER n 1 17 GLY n 1 18 VAL n 1 19 LYS n 1 20 LEU n 1 21 PHE n 1 22 CYS n 1 23 THR n 1 24 SER n 1 25 GLY n 1 26 SER n 1 27 CYS n 1 28 ALA n 1 29 LYS n 1 30 LYS n 1 31 GLU n 1 32 GLY n 1 33 GLN n 1 34 ALA n 1 35 CYS n 1 36 THR n 1 37 ARG n 1 38 ASN n 1 39 GLY n 1 40 PRO n 1 41 GLY n 1 42 SER n 1 43 SER n 1 44 ASN n 1 45 SER n 1 46 ALA n 1 47 SER n 1 48 CYS n 1 49 PRO n 1 50 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 50 _entity_src_gen.gene_src_common_name 'Cucumber anthracnose fungus, Colletotrichum lagenarium' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cob_06621, Cob_v007924' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1213857 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Nicotiana tabacum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4097 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell BY2 _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LYS 50 50 50 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7EAU _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7EAU _struct.title 'SIB1, an effector of Colletotrichum orbiculare' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7EAU _struct_keywords.text 'STRUCTURE FROM XPLOR-NIH, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code N4VVN8_COLOR _struct_ref.pdbx_db_accession N4VVN8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QEGKCTAKGECQENTSGVKLFCTSGSCAKKEGQACTRNGPGSSNSASCPK _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7EAU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession N4VVN8 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 50 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 5 A CYS 11 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 22 A CYS 27 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 35 A CYS 48 1_555 ? ? ? ? ? ? ? 2.032 ? ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A GLU 2 N ? ? A PCA 1 A GLU 2 1_555 ? ? ? ? ? ? ? 1.334 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PCA A 1 ? . . . . PCA A 1 ? 1_555 . . . . . . . GLN 1 PCA 'Pyrrolidone carboxylic acid' 'Named protein modification' 2 CYS A 5 ? CYS A 11 ? CYS A 5 ? 1_555 CYS A 11 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 22 ? CYS A 27 ? CYS A 22 ? 1_555 CYS A 27 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 35 ? CYS A 48 ? CYS A 35 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 3 ? CYS A 5 ? GLY A 3 CYS A 5 AA1 2 CYS A 11 ? GLU A 13 ? CYS A 11 GLU A 13 AA1 3 LYS A 19 ? CYS A 22 ? LYS A 19 CYS A 22 AA1 4 SER A 45 ? SER A 47 ? SER A 45 SER A 47 AA1 5 THR A 36 ? ASN A 38 ? THR A 36 ASN A 38 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 4 ? N LYS A 4 O GLN A 12 ? O GLN A 12 AA1 2 3 N CYS A 11 ? N CYS A 11 O LEU A 20 ? O LEU A 20 AA1 3 4 N PHE A 21 ? N PHE A 21 O ALA A 46 ? O ALA A 46 AA1 4 5 O SER A 45 ? O SER A 45 N ASN A 38 ? N ASN A 38 # _pdbx_entry_details.entry_id 7EAU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 121.33 114.20 7.13 1.10 N 2 4 CA A CYS 27 ? ? CB A CYS 27 ? ? SG A CYS 27 ? ? 121.42 114.20 7.22 1.10 N 3 6 CA A CYS 27 ? ? CB A CYS 27 ? ? SG A CYS 27 ? ? 122.66 114.20 8.46 1.10 N 4 6 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 121.07 114.20 6.87 1.10 N 5 7 CA A CYS 27 ? ? CB A CYS 27 ? ? SG A CYS 27 ? ? 121.95 114.20 7.75 1.10 N 6 7 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 120.97 114.20 6.77 1.10 N 7 8 CA A CYS 27 ? ? CB A CYS 27 ? ? SG A CYS 27 ? ? 121.40 114.20 7.20 1.10 N 8 8 CA A CYS 35 ? ? CB A CYS 35 ? ? SG A CYS 35 ? ? 121.20 114.20 7.00 1.10 N 9 9 CA A CYS 27 ? ? CB A CYS 27 ? ? SG A CYS 27 ? ? 122.47 114.20 8.27 1.10 N 10 10 CA A CYS 27 ? ? CB A CYS 27 ? ? SG A CYS 27 ? ? 122.48 114.20 8.28 1.10 N 11 10 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 121.78 114.20 7.58 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? 67.77 146.00 2 1 SER A 26 ? ? 75.59 123.90 3 1 LYS A 29 ? ? 57.02 97.29 4 1 LYS A 30 ? ? -133.63 -62.13 5 1 ALA A 34 ? ? 78.84 77.81 6 2 SER A 24 ? ? 75.34 -3.71 7 2 LYS A 29 ? ? 62.92 95.25 8 2 LYS A 30 ? ? -126.51 -74.92 9 2 GLU A 31 ? ? 61.16 88.77 10 2 ALA A 34 ? ? 74.90 95.62 11 3 SER A 26 ? ? 58.18 106.99 12 3 LYS A 29 ? ? 65.20 93.54 13 3 LYS A 30 ? ? -116.59 -72.44 14 3 GLU A 31 ? ? 58.25 92.00 15 3 ALA A 34 ? ? 70.33 87.44 16 4 SER A 26 ? ? 76.16 135.18 17 4 ALA A 28 ? ? -26.80 84.88 18 4 LYS A 29 ? ? 55.86 98.38 19 4 LYS A 30 ? ? -127.41 -73.40 20 4 GLU A 31 ? ? 61.23 106.79 21 4 ALA A 34 ? ? 78.97 86.82 22 4 ASN A 44 ? ? 65.23 63.46 23 5 GLU A 2 ? ? 69.66 130.90 24 5 THR A 15 ? ? -149.95 -56.59 25 5 SER A 24 ? ? 80.02 -51.66 26 5 LYS A 29 ? ? 63.57 87.78 27 5 LYS A 30 ? ? -124.33 -62.91 28 5 GLU A 31 ? ? 52.17 94.91 29 5 ALA A 34 ? ? 79.62 86.73 30 6 SER A 26 ? ? 78.19 121.36 31 6 ALA A 28 ? ? -62.03 91.50 32 6 LYS A 29 ? ? 56.29 95.92 33 6 LYS A 30 ? ? -128.96 -72.87 34 6 GLU A 31 ? ? 57.73 98.32 35 6 ALA A 34 ? ? 79.33 85.01 36 7 SER A 26 ? ? 67.31 143.31 37 7 LYS A 29 ? ? 52.54 79.44 38 7 LYS A 30 ? ? -120.58 -74.40 39 7 GLU A 31 ? ? 55.54 76.46 40 7 ALA A 34 ? ? 74.59 104.70 41 8 SER A 26 ? ? 78.80 107.73 42 8 ALA A 28 ? ? -53.22 93.39 43 8 LYS A 29 ? ? 54.47 98.41 44 8 LYS A 30 ? ? -127.58 -73.61 45 8 GLU A 31 ? ? 61.32 86.63 46 8 ALA A 34 ? ? 71.19 106.28 47 9 GLU A 2 ? ? 69.42 153.61 48 9 SER A 26 ? ? 76.67 135.78 49 9 ALA A 28 ? ? -51.57 93.23 50 9 LYS A 29 ? ? 54.21 92.52 51 9 LYS A 30 ? ? -129.78 -71.31 52 9 GLU A 31 ? ? 62.22 88.72 53 9 ALA A 34 ? ? 77.59 102.28 54 10 ALA A 28 ? ? -53.00 99.39 55 10 LYS A 29 ? ? 54.98 87.35 56 10 LYS A 30 ? ? -125.87 -73.86 57 10 GLU A 31 ? ? 58.75 85.43 58 10 ALA A 34 ? ? 81.11 97.86 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 7 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 37 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.083 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_nmr_ensemble.entry_id 7EAU _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7EAU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 3 '0.8 mM Unlabeled SIN1, 90% H2O/10% D2O' '90% H2O/10% D2O' Unlabeled solution ? 4 '0.8 mM [U-100% 15N] SIN1, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N-labeled solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 3 SIN1 0.8 ? mM Unlabeled 4 SIN1 0.8 ? mM '[U-100% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'KCL 100 mM' _pdbx_nmr_exptl_sample_conditions.details 'both (15N-labeled and unlabeled) samples' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 4 '3D 1H-15N NOESY' 1 isotropic 2 1 4 '3D 1H-15N TOCSY' 1 isotropic 3 1 3 '2D 1H-1H NOESY' 1 isotropic 4 1 3 '2D 1H-1H TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 7EAU _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'data analysis' Sparky ? Goddard 4 refinement ARIA ? 'Rieping W, Habeck M, Bardiaux B, Bernard A, Malliavin TE, Nilges M' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 LEU N N N N 121 LEU CA C N S 122 LEU C C N N 123 LEU O O N N 124 LEU CB C N N 125 LEU CG C N N 126 LEU CD1 C N N 127 LEU CD2 C N N 128 LEU OXT O N N 129 LEU H H N N 130 LEU H2 H N N 131 LEU HA H N N 132 LEU HB2 H N N 133 LEU HB3 H N N 134 LEU HG H N N 135 LEU HD11 H N N 136 LEU HD12 H N N 137 LEU HD13 H N N 138 LEU HD21 H N N 139 LEU HD22 H N N 140 LEU HD23 H N N 141 LEU HXT H N N 142 LYS N N N N 143 LYS CA C N S 144 LYS C C N N 145 LYS O O N N 146 LYS CB C N N 147 LYS CG C N N 148 LYS CD C N N 149 LYS CE C N N 150 LYS NZ N N N 151 LYS OXT O N N 152 LYS H H N N 153 LYS H2 H N N 154 LYS HA H N N 155 LYS HB2 H N N 156 LYS HB3 H N N 157 LYS HG2 H N N 158 LYS HG3 H N N 159 LYS HD2 H N N 160 LYS HD3 H N N 161 LYS HE2 H N N 162 LYS HE3 H N N 163 LYS HZ1 H N N 164 LYS HZ2 H N N 165 LYS HZ3 H N N 166 LYS HXT H N N 167 PCA N N N N 168 PCA CA C N S 169 PCA CB C N N 170 PCA CG C N N 171 PCA CD C N N 172 PCA OE O N N 173 PCA C C N N 174 PCA O O N N 175 PCA OXT O N N 176 PCA H H N N 177 PCA HA H N N 178 PCA HB2 H N N 179 PCA HB3 H N N 180 PCA HG2 H N N 181 PCA HG3 H N N 182 PCA HXT H N N 183 PHE N N N N 184 PHE CA C N S 185 PHE C C N N 186 PHE O O N N 187 PHE CB C N N 188 PHE CG C Y N 189 PHE CD1 C Y N 190 PHE CD2 C Y N 191 PHE CE1 C Y N 192 PHE CE2 C Y N 193 PHE CZ C Y N 194 PHE OXT O N N 195 PHE H H N N 196 PHE H2 H N N 197 PHE HA H N N 198 PHE HB2 H N N 199 PHE HB3 H N N 200 PHE HD1 H N N 201 PHE HD2 H N N 202 PHE HE1 H N N 203 PHE HE2 H N N 204 PHE HZ H N N 205 PHE HXT H N N 206 PRO N N N N 207 PRO CA C N S 208 PRO C C N N 209 PRO O O N N 210 PRO CB C N N 211 PRO CG C N N 212 PRO CD C N N 213 PRO OXT O N N 214 PRO H H N N 215 PRO HA H N N 216 PRO HB2 H N N 217 PRO HB3 H N N 218 PRO HG2 H N N 219 PRO HG3 H N N 220 PRO HD2 H N N 221 PRO HD3 H N N 222 PRO HXT H N N 223 SER N N N N 224 SER CA C N S 225 SER C C N N 226 SER O O N N 227 SER CB C N N 228 SER OG O N N 229 SER OXT O N N 230 SER H H N N 231 SER H2 H N N 232 SER HA H N N 233 SER HB2 H N N 234 SER HB3 H N N 235 SER HG H N N 236 SER HXT H N N 237 THR N N N N 238 THR CA C N S 239 THR C C N N 240 THR O O N N 241 THR CB C N R 242 THR OG1 O N N 243 THR CG2 C N N 244 THR OXT O N N 245 THR H H N N 246 THR H2 H N N 247 THR HA H N N 248 THR HB H N N 249 THR HG1 H N N 250 THR HG21 H N N 251 THR HG22 H N N 252 THR HG23 H N N 253 THR HXT H N N 254 VAL N N N N 255 VAL CA C N S 256 VAL C C N N 257 VAL O O N N 258 VAL CB C N N 259 VAL CG1 C N N 260 VAL CG2 C N N 261 VAL OXT O N N 262 VAL H H N N 263 VAL H2 H N N 264 VAL HA H N N 265 VAL HB H N N 266 VAL HG11 H N N 267 VAL HG12 H N N 268 VAL HG13 H N N 269 VAL HG21 H N N 270 VAL HG22 H N N 271 VAL HG23 H N N 272 VAL HXT H N N 273 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 LEU N CA sing N N 114 LEU N H sing N N 115 LEU N H2 sing N N 116 LEU CA C sing N N 117 LEU CA CB sing N N 118 LEU CA HA sing N N 119 LEU C O doub N N 120 LEU C OXT sing N N 121 LEU CB CG sing N N 122 LEU CB HB2 sing N N 123 LEU CB HB3 sing N N 124 LEU CG CD1 sing N N 125 LEU CG CD2 sing N N 126 LEU CG HG sing N N 127 LEU CD1 HD11 sing N N 128 LEU CD1 HD12 sing N N 129 LEU CD1 HD13 sing N N 130 LEU CD2 HD21 sing N N 131 LEU CD2 HD22 sing N N 132 LEU CD2 HD23 sing N N 133 LEU OXT HXT sing N N 134 LYS N CA sing N N 135 LYS N H sing N N 136 LYS N H2 sing N N 137 LYS CA C sing N N 138 LYS CA CB sing N N 139 LYS CA HA sing N N 140 LYS C O doub N N 141 LYS C OXT sing N N 142 LYS CB CG sing N N 143 LYS CB HB2 sing N N 144 LYS CB HB3 sing N N 145 LYS CG CD sing N N 146 LYS CG HG2 sing N N 147 LYS CG HG3 sing N N 148 LYS CD CE sing N N 149 LYS CD HD2 sing N N 150 LYS CD HD3 sing N N 151 LYS CE NZ sing N N 152 LYS CE HE2 sing N N 153 LYS CE HE3 sing N N 154 LYS NZ HZ1 sing N N 155 LYS NZ HZ2 sing N N 156 LYS NZ HZ3 sing N N 157 LYS OXT HXT sing N N 158 PCA N CA sing N N 159 PCA N CD sing N N 160 PCA N H sing N N 161 PCA CA CB sing N N 162 PCA CA C sing N N 163 PCA CA HA sing N N 164 PCA CB CG sing N N 165 PCA CB HB2 sing N N 166 PCA CB HB3 sing N N 167 PCA CG CD sing N N 168 PCA CG HG2 sing N N 169 PCA CG HG3 sing N N 170 PCA CD OE doub N N 171 PCA C O doub N N 172 PCA C OXT sing N N 173 PCA OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 PRO N CA sing N N 198 PRO N CD sing N N 199 PRO N H sing N N 200 PRO CA C sing N N 201 PRO CA CB sing N N 202 PRO CA HA sing N N 203 PRO C O doub N N 204 PRO C OXT sing N N 205 PRO CB CG sing N N 206 PRO CB HB2 sing N N 207 PRO CB HB3 sing N N 208 PRO CG CD sing N N 209 PRO CG HG2 sing N N 210 PRO CG HG3 sing N N 211 PRO CD HD2 sing N N 212 PRO CD HD3 sing N N 213 PRO OXT HXT sing N N 214 SER N CA sing N N 215 SER N H sing N N 216 SER N H2 sing N N 217 SER CA C sing N N 218 SER CA CB sing N N 219 SER CA HA sing N N 220 SER C O doub N N 221 SER C OXT sing N N 222 SER CB OG sing N N 223 SER CB HB2 sing N N 224 SER CB HB3 sing N N 225 SER OG HG sing N N 226 SER OXT HXT sing N N 227 THR N CA sing N N 228 THR N H sing N N 229 THR N H2 sing N N 230 THR CA C sing N N 231 THR CA CB sing N N 232 THR CA HA sing N N 233 THR C O doub N N 234 THR C OXT sing N N 235 THR CB OG1 sing N N 236 THR CB CG2 sing N N 237 THR CB HB sing N N 238 THR OG1 HG1 sing N N 239 THR CG2 HG21 sing N N 240 THR CG2 HG22 sing N N 241 THR CG2 HG23 sing N N 242 THR OXT HXT sing N N 243 VAL N CA sing N N 244 VAL N H sing N N 245 VAL N H2 sing N N 246 VAL CA C sing N N 247 VAL CA CB sing N N 248 VAL CA HA sing N N 249 VAL C O doub N N 250 VAL C OXT sing N N 251 VAL CB CG1 sing N N 252 VAL CB CG2 sing N N 253 VAL CB HB sing N N 254 VAL CG1 HG11 sing N N 255 VAL CG1 HG12 sing N N 256 VAL CG1 HG13 sing N N 257 VAL CG2 HG21 sing N N 258 VAL CG2 HG22 sing N N 259 VAL CG2 HG23 sing N N 260 VAL OXT HXT sing N N 261 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 17K08194 1 'Japan Society for the Promotion of Science (JSPS)' Japan 18H02204 2 'Japan Society for the Promotion of Science (JSPS)' Japan 18H04780 3 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details 'TCI-cryogenic probe' # _atom_sites.entry_id 7EAU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #