data_7EEC # _entry.id 7EEC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7EEC pdb_00007eec 10.2210/pdb7eec/pdb WWPDB D_1300021233 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7EEC _pdbx_database_status.recvd_initial_deposition_date 2021-03-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chakraborty, S.' 1 0000-0002-9866-5590 'Varma, A.K.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 568 _citation.language ? _citation.page_first 62 _citation.page_last 67 _citation.title 'Crystal structure of clinically reported mutations Gly656Arg, Gly656Glu and Asp751His identified in the kinase domain of EphA7.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2021.06.048 _citation.pdbx_database_id_PubMed 34186436 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chakraborty, S.' 1 ? primary 'Varma, A.K.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7EEC _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.780 _cell.length_a_esd ? _cell.length_b 51.780 _cell.length_b_esd ? _cell.length_c 216.080 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7EEC _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ephrin type-A receptor 7' 34682.926 1 2.7.10.1 G656R ? ? 2 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EPH homology kinase 3,EHK-3,EPH-like kinase 11,EK11,hEK11' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPRKRDVAVAIKTLKVGYTEKQRRD FLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRD LAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYW DMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSAHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;HFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPRKRDVAVAIKTLKVGYTEKQRRD FLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRD LAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYW DMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSAHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 PHE n 1 3 LYS n 1 4 PHE n 1 5 PRO n 1 6 GLY n 1 7 THR n 1 8 LYS n 1 9 THR n 1 10 TYR n 1 11 ILE n 1 12 ASP n 1 13 PRO n 1 14 GLU n 1 15 THR n 1 16 TYR n 1 17 GLU n 1 18 ASP n 1 19 PRO n 1 20 ASN n 1 21 ARG n 1 22 ALA n 1 23 VAL n 1 24 HIS n 1 25 GLN n 1 26 PHE n 1 27 ALA n 1 28 LYS n 1 29 GLU n 1 30 LEU n 1 31 ASP n 1 32 ALA n 1 33 SER n 1 34 CYS n 1 35 ILE n 1 36 LYS n 1 37 ILE n 1 38 GLU n 1 39 ARG n 1 40 VAL n 1 41 ILE n 1 42 GLY n 1 43 ALA n 1 44 GLY n 1 45 GLU n 1 46 PHE n 1 47 GLY n 1 48 GLU n 1 49 VAL n 1 50 CYS n 1 51 SER n 1 52 GLY n 1 53 ARG n 1 54 LEU n 1 55 LYS n 1 56 LEU n 1 57 PRO n 1 58 ARG n 1 59 LYS n 1 60 ARG n 1 61 ASP n 1 62 VAL n 1 63 ALA n 1 64 VAL n 1 65 ALA n 1 66 ILE n 1 67 LYS n 1 68 THR n 1 69 LEU n 1 70 LYS n 1 71 VAL n 1 72 GLY n 1 73 TYR n 1 74 THR n 1 75 GLU n 1 76 LYS n 1 77 GLN n 1 78 ARG n 1 79 ARG n 1 80 ASP n 1 81 PHE n 1 82 LEU n 1 83 CYS n 1 84 GLU n 1 85 ALA n 1 86 SER n 1 87 ILE n 1 88 MET n 1 89 GLY n 1 90 GLN n 1 91 PHE n 1 92 ASP n 1 93 HIS n 1 94 PRO n 1 95 ASN n 1 96 VAL n 1 97 VAL n 1 98 HIS n 1 99 LEU n 1 100 GLU n 1 101 GLY n 1 102 VAL n 1 103 VAL n 1 104 THR n 1 105 ARG n 1 106 GLY n 1 107 LYS n 1 108 PRO n 1 109 VAL n 1 110 MET n 1 111 ILE n 1 112 VAL n 1 113 ILE n 1 114 GLU n 1 115 PHE n 1 116 MET n 1 117 GLU n 1 118 ASN n 1 119 GLY n 1 120 ALA n 1 121 LEU n 1 122 ASP n 1 123 ALA n 1 124 PHE n 1 125 LEU n 1 126 ARG n 1 127 LYS n 1 128 HIS n 1 129 ASP n 1 130 GLY n 1 131 GLN n 1 132 PHE n 1 133 THR n 1 134 VAL n 1 135 ILE n 1 136 GLN n 1 137 LEU n 1 138 VAL n 1 139 GLY n 1 140 MET n 1 141 LEU n 1 142 ARG n 1 143 GLY n 1 144 ILE n 1 145 ALA n 1 146 ALA n 1 147 GLY n 1 148 MET n 1 149 ARG n 1 150 TYR n 1 151 LEU n 1 152 ALA n 1 153 ASP n 1 154 MET n 1 155 GLY n 1 156 TYR n 1 157 VAL n 1 158 HIS n 1 159 ARG n 1 160 ASP n 1 161 LEU n 1 162 ALA n 1 163 ALA n 1 164 ARG n 1 165 ASN n 1 166 ILE n 1 167 LEU n 1 168 VAL n 1 169 ASN n 1 170 SER n 1 171 ASN n 1 172 LEU n 1 173 VAL n 1 174 CYS n 1 175 LYS n 1 176 VAL n 1 177 SER n 1 178 ASP n 1 179 PHE n 1 180 GLY n 1 181 LEU n 1 182 SER n 1 183 ARG n 1 184 VAL n 1 185 ILE n 1 186 GLU n 1 187 ASP n 1 188 ASP n 1 189 PRO n 1 190 GLU n 1 191 ALA n 1 192 VAL n 1 193 TYR n 1 194 THR n 1 195 THR n 1 196 THR n 1 197 GLY n 1 198 GLY n 1 199 LYS n 1 200 ILE n 1 201 PRO n 1 202 VAL n 1 203 ARG n 1 204 TRP n 1 205 THR n 1 206 ALA n 1 207 PRO n 1 208 GLU n 1 209 ALA n 1 210 ILE n 1 211 GLN n 1 212 TYR n 1 213 ARG n 1 214 LYS n 1 215 PHE n 1 216 THR n 1 217 SER n 1 218 ALA n 1 219 SER n 1 220 ASP n 1 221 VAL n 1 222 TRP n 1 223 SER n 1 224 TYR n 1 225 GLY n 1 226 ILE n 1 227 VAL n 1 228 MET n 1 229 TRP n 1 230 GLU n 1 231 VAL n 1 232 MET n 1 233 SER n 1 234 TYR n 1 235 GLY n 1 236 GLU n 1 237 ARG n 1 238 PRO n 1 239 TYR n 1 240 TRP n 1 241 ASP n 1 242 MET n 1 243 SER n 1 244 ASN n 1 245 GLN n 1 246 ASP n 1 247 VAL n 1 248 ILE n 1 249 LYS n 1 250 ALA n 1 251 ILE n 1 252 GLU n 1 253 GLU n 1 254 GLY n 1 255 TYR n 1 256 ARG n 1 257 LEU n 1 258 PRO n 1 259 ALA n 1 260 PRO n 1 261 MET n 1 262 ASP n 1 263 CYS n 1 264 PRO n 1 265 ALA n 1 266 GLY n 1 267 LEU n 1 268 HIS n 1 269 GLN n 1 270 LEU n 1 271 MET n 1 272 LEU n 1 273 ASP n 1 274 CYS n 1 275 TRP n 1 276 GLN n 1 277 LYS n 1 278 GLU n 1 279 ARG n 1 280 ALA n 1 281 GLU n 1 282 ARG n 1 283 PRO n 1 284 LYS n 1 285 PHE n 1 286 GLU n 1 287 GLN n 1 288 ILE n 1 289 VAL n 1 290 GLY n 1 291 ILE n 1 292 LEU n 1 293 ASP n 1 294 LYS n 1 295 MET n 1 296 ILE n 1 297 ARG n 1 298 ASN n 1 299 PRO n 1 300 ASN n 1 301 SER n 1 302 ALA n 1 303 HIS n 1 304 HIS n 1 305 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 305 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EPHA7, EHK3, HEK11' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EPHA7_HUMAN _struct_ref.pdbx_db_accession Q15375 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRD FLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRD LAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYW DMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNS ; _struct_ref.pdbx_align_begin 599 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7EEC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 301 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15375 _struct_ref_seq.db_align_beg 599 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 899 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 599 _struct_ref_seq.pdbx_auth_seq_align_end 899 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7EEC ARG A 58 ? UNP Q15375 GLY 656 'engineered mutation' 656 1 1 7EEC ALA A 302 ? UNP Q15375 ? ? 'expression tag' 900 2 1 7EEC HIS A 303 ? UNP Q15375 ? ? 'expression tag' 901 3 1 7EEC HIS A 304 ? UNP Q15375 ? ? 'expression tag' 902 4 1 7EEC HIS A 305 ? UNP Q15375 ? ? 'expression tag' 903 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7EEC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG3350, ammonium sulphate, HEPES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'BRUKER AXS MICROSTAR' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7EEC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.1 _reflns.d_resolution_low 72.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5944 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1 _reflns.pdbx_Rmerge_I_obs 0.175 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.984 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.1 _reflns_shell.d_res_low 3.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 874 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.175 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.056 _refine.aniso_B[1][2] 0.028 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.056 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.182 _refine.B_iso_max ? _refine.B_iso_mean 32.018 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.909 _refine.correlation_coeff_Fo_to_Fc_free 0.893 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7EEC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.100 _refine.ls_d_res_low 44.8428 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5944 _refine.ls_number_reflns_R_free 294 _refine.ls_number_reflns_R_work 5650 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.000 _refine.ls_percent_reflns_R_free 4.946 _refine.ls_R_factor_all 0.183 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2101 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1813 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2REI _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.415 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.647 _refine.overall_SU_ML 0.294 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.100 _refine_hist.d_res_low 44.8428 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 2216 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2211 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 2267 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2165 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.589 1.641 3062 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.209 1.582 4976 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.887 5.000 277 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.463 21.172 128 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.956 15.000 399 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.355 15.000 20 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.062 0.200 284 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2557 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 539 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.225 0.200 550 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.200 0.200 2096 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.169 0.200 1082 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.075 0.200 1053 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.186 0.200 57 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.090 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.162 0.200 22 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.219 0.200 79 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.322 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.015 0.200 1 ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.081 3.430 1111 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.081 3.430 1110 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 0.157 5.143 1387 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 0.157 5.144 1388 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.012 3.436 1156 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.012 3.437 1157 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 0.054 5.154 1675 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 0.054 5.155 1676 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 0.901 39.461 2572 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 0.901 39.458 2573 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.100 3.180 . . 28 409 100.0000 . . . 0.233 . 0.223 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.180 3.267 . . 21 408 100.0000 . . . 0.230 . 0.220 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.267 3.361 . . 25 377 100.0000 . . . 0.229 . 0.214 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.361 3.464 . . 22 404 100.0000 . . . 0.230 . 0.196 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.464 3.577 . . 15 353 100.0000 . . . 0.233 . 0.193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.577 3.702 . . 13 396 100.0000 . . . 0.160 . 0.180 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.702 3.840 . . 16 314 100.0000 . . . 0.270 . 0.184 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.840 3.996 . . 21 347 100.0000 . . . 0.096 . 0.187 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.996 4.172 . . 18 302 100.0000 . . . 0.220 . 0.161 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.172 4.374 . . 14 311 100.0000 . . . 0.240 . 0.167 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.374 4.608 . . 4 306 100.0000 . . . 0.225 . 0.161 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.608 4.884 . . 15 269 100.0000 . . . 0.184 . 0.169 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.884 5.217 . . 10 277 100.0000 . . . 0.129 . 0.177 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.217 5.629 . . 13 234 100.0000 . . . 0.203 . 0.201 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.629 6.156 . . 20 210 100.0000 . . . 0.290 . 0.186 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.156 6.867 . . 19 199 100.0000 . . . 0.278 . 0.181 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.867 7.898 . . 1 182 100.0000 . . . 0.109 . 0.143 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.898 9.599 . . 14 148 100.0000 . . . 0.168 . 0.124 . . . . . . . . . . . 'X-RAY DIFFRACTION' 9.599 13.275 . . 2 131 100.0000 . . . 0.317 . 0.139 . . . . . . . . . . . # _struct.entry_id 7EEC _struct.title 'Crystal structure of EphA7 mutant G656R' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7EEC _struct_keywords.text 'Kinase domain, Mutant, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 18 ? ALA A 27 ? ASP A 616 ALA A 625 1 ? 10 HELX_P HELX_P2 AA2 ASP A 31 ? SER A 33 ? ASP A 629 SER A 631 5 ? 3 HELX_P HELX_P3 AA3 THR A 74 ? GLY A 89 ? THR A 672 GLY A 687 1 ? 16 HELX_P HELX_P4 AA4 LEU A 121 ? HIS A 128 ? LEU A 719 HIS A 726 1 ? 8 HELX_P HELX_P5 AA5 THR A 133 ? GLY A 155 ? THR A 731 GLY A 753 1 ? 23 HELX_P HELX_P6 AA6 PRO A 201 ? THR A 205 ? PRO A 799 THR A 803 5 ? 5 HELX_P HELX_P7 AA7 ALA A 206 ? ARG A 213 ? ALA A 804 ARG A 811 1 ? 8 HELX_P HELX_P8 AA8 ALA A 218 ? SER A 233 ? ALA A 816 SER A 831 1 ? 16 HELX_P HELX_P9 AA9 SER A 243 ? GLY A 254 ? SER A 841 GLY A 852 1 ? 12 HELX_P HELX_P10 AB1 PRO A 264 ? TRP A 275 ? PRO A 862 TRP A 873 1 ? 12 HELX_P HELX_P11 AB2 GLU A 278 ? ARG A 282 ? GLU A 876 ARG A 880 5 ? 5 HELX_P HELX_P12 AB3 LYS A 284 ? ASN A 298 ? LYS A 882 ASN A 896 1 ? 15 HELX_P HELX_P13 AB4 PRO A 299 ? HIS A 304 ? PRO A 897 HIS A 902 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 35 ? ALA A 43 ? ILE A 633 ALA A 641 AA1 2 GLU A 48 ? LEU A 54 ? GLU A 646 LEU A 652 AA1 3 VAL A 62 ? THR A 68 ? VAL A 660 THR A 666 AA1 4 MET A 110 ? GLU A 114 ? MET A 708 GLU A 712 AA1 5 LEU A 99 ? VAL A 103 ? LEU A 697 VAL A 701 AA2 1 GLY A 119 ? ALA A 120 ? GLY A 717 ALA A 718 AA2 2 ILE A 166 ? VAL A 168 ? ILE A 764 VAL A 766 AA2 3 CYS A 174 ? VAL A 176 ? CYS A 772 VAL A 774 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 38 ? N GLU A 636 O SER A 51 ? O SER A 649 AA1 2 3 N GLY A 52 ? N GLY A 650 O VAL A 64 ? O VAL A 662 AA1 3 4 N ALA A 65 ? N ALA A 663 O ILE A 113 ? O ILE A 711 AA1 4 5 O VAL A 112 ? O VAL A 710 N GLU A 100 ? N GLU A 698 AA2 1 2 N GLY A 119 ? N GLY A 717 O VAL A 168 ? O VAL A 766 AA2 2 3 N LEU A 167 ? N LEU A 765 O LYS A 175 ? O LYS A 773 # _atom_sites.entry_id 7EEC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019312 _atom_sites.fract_transf_matrix[1][2] 0.011150 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022300 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004628 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.056 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 599 ? ? ? A . n A 1 2 PHE 2 600 ? ? ? A . n A 1 3 LYS 3 601 ? ? ? A . n A 1 4 PHE 4 602 ? ? ? A . n A 1 5 PRO 5 603 ? ? ? A . n A 1 6 GLY 6 604 ? ? ? A . n A 1 7 THR 7 605 ? ? ? A . n A 1 8 LYS 8 606 ? ? ? A . n A 1 9 THR 9 607 607 THR THR A . n A 1 10 TYR 10 608 608 TYR TYR A . n A 1 11 ILE 11 609 609 ILE ILE A . n A 1 12 ASP 12 610 610 ASP ASP A . n A 1 13 PRO 13 611 611 PRO PRO A . n A 1 14 GLU 14 612 612 GLU GLU A . n A 1 15 THR 15 613 613 THR THR A . n A 1 16 TYR 16 614 614 TYR TYR A . n A 1 17 GLU 17 615 615 GLU GLU A . n A 1 18 ASP 18 616 616 ASP ASP A . n A 1 19 PRO 19 617 617 PRO PRO A . n A 1 20 ASN 20 618 618 ASN ASN A . n A 1 21 ARG 21 619 619 ARG ARG A . n A 1 22 ALA 22 620 620 ALA ALA A . n A 1 23 VAL 23 621 621 VAL VAL A . n A 1 24 HIS 24 622 622 HIS HIS A . n A 1 25 GLN 25 623 623 GLN GLN A . n A 1 26 PHE 26 624 624 PHE PHE A . n A 1 27 ALA 27 625 625 ALA ALA A . n A 1 28 LYS 28 626 626 LYS LYS A . n A 1 29 GLU 29 627 627 GLU GLU A . n A 1 30 LEU 30 628 628 LEU LEU A . n A 1 31 ASP 31 629 629 ASP ASP A . n A 1 32 ALA 32 630 630 ALA ALA A . n A 1 33 SER 33 631 631 SER SER A . n A 1 34 CYS 34 632 632 CYS CYS A . n A 1 35 ILE 35 633 633 ILE ILE A . n A 1 36 LYS 36 634 634 LYS LYS A . n A 1 37 ILE 37 635 635 ILE ILE A . n A 1 38 GLU 38 636 636 GLU GLU A . n A 1 39 ARG 39 637 637 ARG ARG A . n A 1 40 VAL 40 638 638 VAL VAL A . n A 1 41 ILE 41 639 639 ILE ILE A . n A 1 42 GLY 42 640 640 GLY GLY A . n A 1 43 ALA 43 641 641 ALA ALA A . n A 1 44 GLY 44 642 642 GLY GLY A . n A 1 45 GLU 45 643 643 GLU GLU A . n A 1 46 PHE 46 644 644 PHE PHE A . n A 1 47 GLY 47 645 645 GLY GLY A . n A 1 48 GLU 48 646 646 GLU GLU A . n A 1 49 VAL 49 647 647 VAL VAL A . n A 1 50 CYS 50 648 648 CYS CYS A . n A 1 51 SER 51 649 649 SER SER A . n A 1 52 GLY 52 650 650 GLY GLY A . n A 1 53 ARG 53 651 651 ARG ARG A . n A 1 54 LEU 54 652 652 LEU LEU A . n A 1 55 LYS 55 653 653 LYS LYS A . n A 1 56 LEU 56 654 654 LEU LEU A . n A 1 57 PRO 57 655 655 PRO PRO A . n A 1 58 ARG 58 656 656 ARG ARG A . n A 1 59 LYS 59 657 657 LYS LYS A . n A 1 60 ARG 60 658 658 ARG ARG A . n A 1 61 ASP 61 659 659 ASP ASP A . n A 1 62 VAL 62 660 660 VAL VAL A . n A 1 63 ALA 63 661 661 ALA ALA A . n A 1 64 VAL 64 662 662 VAL VAL A . n A 1 65 ALA 65 663 663 ALA ALA A . n A 1 66 ILE 66 664 664 ILE ILE A . n A 1 67 LYS 67 665 665 LYS LYS A . n A 1 68 THR 68 666 666 THR THR A . n A 1 69 LEU 69 667 667 LEU LEU A . n A 1 70 LYS 70 668 668 LYS LYS A . n A 1 71 VAL 71 669 669 VAL VAL A . n A 1 72 GLY 72 670 670 GLY GLY A . n A 1 73 TYR 73 671 671 TYR TYR A . n A 1 74 THR 74 672 672 THR THR A . n A 1 75 GLU 75 673 673 GLU GLU A . n A 1 76 LYS 76 674 674 LYS LYS A . n A 1 77 GLN 77 675 675 GLN GLN A . n A 1 78 ARG 78 676 676 ARG ARG A . n A 1 79 ARG 79 677 677 ARG ARG A . n A 1 80 ASP 80 678 678 ASP ASP A . n A 1 81 PHE 81 679 679 PHE PHE A . n A 1 82 LEU 82 680 680 LEU LEU A . n A 1 83 CYS 83 681 681 CYS CYS A . n A 1 84 GLU 84 682 682 GLU GLU A . n A 1 85 ALA 85 683 683 ALA ALA A . n A 1 86 SER 86 684 684 SER SER A . n A 1 87 ILE 87 685 685 ILE ILE A . n A 1 88 MET 88 686 686 MET MET A . n A 1 89 GLY 89 687 687 GLY GLY A . n A 1 90 GLN 90 688 688 GLN GLN A . n A 1 91 PHE 91 689 689 PHE PHE A . n A 1 92 ASP 92 690 690 ASP ASP A . n A 1 93 HIS 93 691 691 HIS HIS A . n A 1 94 PRO 94 692 692 PRO PRO A . n A 1 95 ASN 95 693 693 ASN ASN A . n A 1 96 VAL 96 694 694 VAL VAL A . n A 1 97 VAL 97 695 695 VAL VAL A . n A 1 98 HIS 98 696 696 HIS HIS A . n A 1 99 LEU 99 697 697 LEU LEU A . n A 1 100 GLU 100 698 698 GLU GLU A . n A 1 101 GLY 101 699 699 GLY GLY A . n A 1 102 VAL 102 700 700 VAL VAL A . n A 1 103 VAL 103 701 701 VAL VAL A . n A 1 104 THR 104 702 702 THR THR A . n A 1 105 ARG 105 703 703 ARG ARG A . n A 1 106 GLY 106 704 704 GLY GLY A . n A 1 107 LYS 107 705 705 LYS LYS A . n A 1 108 PRO 108 706 706 PRO PRO A . n A 1 109 VAL 109 707 707 VAL VAL A . n A 1 110 MET 110 708 708 MET MET A . n A 1 111 ILE 111 709 709 ILE ILE A . n A 1 112 VAL 112 710 710 VAL VAL A . n A 1 113 ILE 113 711 711 ILE ILE A . n A 1 114 GLU 114 712 712 GLU GLU A . n A 1 115 PHE 115 713 713 PHE PHE A . n A 1 116 MET 116 714 714 MET MET A . n A 1 117 GLU 117 715 715 GLU GLU A . n A 1 118 ASN 118 716 716 ASN ASN A . n A 1 119 GLY 119 717 717 GLY GLY A . n A 1 120 ALA 120 718 718 ALA ALA A . n A 1 121 LEU 121 719 719 LEU LEU A . n A 1 122 ASP 122 720 720 ASP ASP A . n A 1 123 ALA 123 721 721 ALA ALA A . n A 1 124 PHE 124 722 722 PHE PHE A . n A 1 125 LEU 125 723 723 LEU LEU A . n A 1 126 ARG 126 724 724 ARG ARG A . n A 1 127 LYS 127 725 725 LYS LYS A . n A 1 128 HIS 128 726 726 HIS HIS A . n A 1 129 ASP 129 727 727 ASP ASP A . n A 1 130 GLY 130 728 728 GLY GLY A . n A 1 131 GLN 131 729 729 GLN GLN A . n A 1 132 PHE 132 730 730 PHE PHE A . n A 1 133 THR 133 731 731 THR THR A . n A 1 134 VAL 134 732 732 VAL VAL A . n A 1 135 ILE 135 733 733 ILE ILE A . n A 1 136 GLN 136 734 734 GLN GLN A . n A 1 137 LEU 137 735 735 LEU LEU A . n A 1 138 VAL 138 736 736 VAL VAL A . n A 1 139 GLY 139 737 737 GLY GLY A . n A 1 140 MET 140 738 738 MET MET A . n A 1 141 LEU 141 739 739 LEU LEU A . n A 1 142 ARG 142 740 740 ARG ARG A . n A 1 143 GLY 143 741 741 GLY GLY A . n A 1 144 ILE 144 742 742 ILE ILE A . n A 1 145 ALA 145 743 743 ALA ALA A . n A 1 146 ALA 146 744 744 ALA ALA A . n A 1 147 GLY 147 745 745 GLY GLY A . n A 1 148 MET 148 746 746 MET MET A . n A 1 149 ARG 149 747 747 ARG ARG A . n A 1 150 TYR 150 748 748 TYR TYR A . n A 1 151 LEU 151 749 749 LEU LEU A . n A 1 152 ALA 152 750 750 ALA ALA A . n A 1 153 ASP 153 751 751 ASP ASP A . n A 1 154 MET 154 752 752 MET MET A . n A 1 155 GLY 155 753 753 GLY GLY A . n A 1 156 TYR 156 754 754 TYR TYR A . n A 1 157 VAL 157 755 755 VAL VAL A . n A 1 158 HIS 158 756 756 HIS HIS A . n A 1 159 ARG 159 757 757 ARG ARG A . n A 1 160 ASP 160 758 758 ASP ASP A . n A 1 161 LEU 161 759 759 LEU LEU A . n A 1 162 ALA 162 760 760 ALA ALA A . n A 1 163 ALA 163 761 761 ALA ALA A . n A 1 164 ARG 164 762 762 ARG ARG A . n A 1 165 ASN 165 763 763 ASN ASN A . n A 1 166 ILE 166 764 764 ILE ILE A . n A 1 167 LEU 167 765 765 LEU LEU A . n A 1 168 VAL 168 766 766 VAL VAL A . n A 1 169 ASN 169 767 767 ASN ASN A . n A 1 170 SER 170 768 768 SER SER A . n A 1 171 ASN 171 769 769 ASN ASN A . n A 1 172 LEU 172 770 770 LEU LEU A . n A 1 173 VAL 173 771 771 VAL VAL A . n A 1 174 CYS 174 772 772 CYS CYS A . n A 1 175 LYS 175 773 773 LYS LYS A . n A 1 176 VAL 176 774 774 VAL VAL A . n A 1 177 SER 177 775 775 SER SER A . n A 1 178 ASP 178 776 776 ASP ASP A . n A 1 179 PHE 179 777 777 PHE PHE A . n A 1 180 GLY 180 778 778 GLY GLY A . n A 1 181 LEU 181 779 779 LEU LEU A . n A 1 182 SER 182 780 ? ? ? A . n A 1 183 ARG 183 781 ? ? ? A . n A 1 184 VAL 184 782 ? ? ? A . n A 1 185 ILE 185 783 ? ? ? A . n A 1 186 GLU 186 784 ? ? ? A . n A 1 187 ASP 187 785 ? ? ? A . n A 1 188 ASP 188 786 ? ? ? A . n A 1 189 PRO 189 787 ? ? ? A . n A 1 190 GLU 190 788 ? ? ? A . n A 1 191 ALA 191 789 ? ? ? A . n A 1 192 VAL 192 790 ? ? ? A . n A 1 193 TYR 193 791 ? ? ? A . n A 1 194 THR 194 792 ? ? ? A . n A 1 195 THR 195 793 ? ? ? A . n A 1 196 THR 196 794 ? ? ? A . n A 1 197 GLY 197 795 ? ? ? A . n A 1 198 GLY 198 796 ? ? ? A . n A 1 199 LYS 199 797 ? ? ? A . n A 1 200 ILE 200 798 ? ? ? A . n A 1 201 PRO 201 799 799 PRO PRO A . n A 1 202 VAL 202 800 800 VAL VAL A . n A 1 203 ARG 203 801 801 ARG ARG A . n A 1 204 TRP 204 802 802 TRP TRP A . n A 1 205 THR 205 803 803 THR THR A . n A 1 206 ALA 206 804 804 ALA ALA A . n A 1 207 PRO 207 805 805 PRO PRO A . n A 1 208 GLU 208 806 806 GLU GLU A . n A 1 209 ALA 209 807 807 ALA ALA A . n A 1 210 ILE 210 808 808 ILE ILE A . n A 1 211 GLN 211 809 809 GLN GLN A . n A 1 212 TYR 212 810 810 TYR TYR A . n A 1 213 ARG 213 811 811 ARG ARG A . n A 1 214 LYS 214 812 812 LYS LYS A . n A 1 215 PHE 215 813 813 PHE PHE A . n A 1 216 THR 216 814 814 THR THR A . n A 1 217 SER 217 815 815 SER SER A . n A 1 218 ALA 218 816 816 ALA ALA A . n A 1 219 SER 219 817 817 SER SER A . n A 1 220 ASP 220 818 818 ASP ASP A . n A 1 221 VAL 221 819 819 VAL VAL A . n A 1 222 TRP 222 820 820 TRP TRP A . n A 1 223 SER 223 821 821 SER SER A . n A 1 224 TYR 224 822 822 TYR TYR A . n A 1 225 GLY 225 823 823 GLY GLY A . n A 1 226 ILE 226 824 824 ILE ILE A . n A 1 227 VAL 227 825 825 VAL VAL A . n A 1 228 MET 228 826 826 MET MET A . n A 1 229 TRP 229 827 827 TRP TRP A . n A 1 230 GLU 230 828 828 GLU GLU A . n A 1 231 VAL 231 829 829 VAL VAL A . n A 1 232 MET 232 830 830 MET MET A . n A 1 233 SER 233 831 831 SER SER A . n A 1 234 TYR 234 832 832 TYR TYR A . n A 1 235 GLY 235 833 833 GLY GLY A . n A 1 236 GLU 236 834 834 GLU GLU A . n A 1 237 ARG 237 835 835 ARG ARG A . n A 1 238 PRO 238 836 836 PRO PRO A . n A 1 239 TYR 239 837 837 TYR TYR A . n A 1 240 TRP 240 838 838 TRP TRP A . n A 1 241 ASP 241 839 839 ASP ASP A . n A 1 242 MET 242 840 840 MET MET A . n A 1 243 SER 243 841 841 SER SER A . n A 1 244 ASN 244 842 842 ASN ASN A . n A 1 245 GLN 245 843 843 GLN GLN A . n A 1 246 ASP 246 844 844 ASP ASP A . n A 1 247 VAL 247 845 845 VAL VAL A . n A 1 248 ILE 248 846 846 ILE ILE A . n A 1 249 LYS 249 847 847 LYS LYS A . n A 1 250 ALA 250 848 848 ALA ALA A . n A 1 251 ILE 251 849 849 ILE ILE A . n A 1 252 GLU 252 850 850 GLU GLU A . n A 1 253 GLU 253 851 851 GLU GLU A . n A 1 254 GLY 254 852 852 GLY GLY A . n A 1 255 TYR 255 853 853 TYR TYR A . n A 1 256 ARG 256 854 854 ARG ARG A . n A 1 257 LEU 257 855 855 LEU LEU A . n A 1 258 PRO 258 856 856 PRO PRO A . n A 1 259 ALA 259 857 857 ALA ALA A . n A 1 260 PRO 260 858 858 PRO PRO A . n A 1 261 MET 261 859 859 MET MET A . n A 1 262 ASP 262 860 860 ASP ASP A . n A 1 263 CYS 263 861 861 CYS CYS A . n A 1 264 PRO 264 862 862 PRO PRO A . n A 1 265 ALA 265 863 863 ALA ALA A . n A 1 266 GLY 266 864 864 GLY GLY A . n A 1 267 LEU 267 865 865 LEU LEU A . n A 1 268 HIS 268 866 866 HIS HIS A . n A 1 269 GLN 269 867 867 GLN GLN A . n A 1 270 LEU 270 868 868 LEU LEU A . n A 1 271 MET 271 869 869 MET MET A . n A 1 272 LEU 272 870 870 LEU LEU A . n A 1 273 ASP 273 871 871 ASP ASP A . n A 1 274 CYS 274 872 872 CYS CYS A . n A 1 275 TRP 275 873 873 TRP TRP A . n A 1 276 GLN 276 874 874 GLN GLN A . n A 1 277 LYS 277 875 875 LYS LYS A . n A 1 278 GLU 278 876 876 GLU GLU A . n A 1 279 ARG 279 877 877 ARG ARG A . n A 1 280 ALA 280 878 878 ALA ALA A . n A 1 281 GLU 281 879 879 GLU GLU A . n A 1 282 ARG 282 880 880 ARG ARG A . n A 1 283 PRO 283 881 881 PRO PRO A . n A 1 284 LYS 284 882 882 LYS LYS A . n A 1 285 PHE 285 883 883 PHE PHE A . n A 1 286 GLU 286 884 884 GLU GLU A . n A 1 287 GLN 287 885 885 GLN GLN A . n A 1 288 ILE 288 886 886 ILE ILE A . n A 1 289 VAL 289 887 887 VAL VAL A . n A 1 290 GLY 290 888 888 GLY GLY A . n A 1 291 ILE 291 889 889 ILE ILE A . n A 1 292 LEU 292 890 890 LEU LEU A . n A 1 293 ASP 293 891 891 ASP ASP A . n A 1 294 LYS 294 892 892 LYS LYS A . n A 1 295 MET 295 893 893 MET MET A . n A 1 296 ILE 296 894 894 ILE ILE A . n A 1 297 ARG 297 895 895 ARG ARG A . n A 1 298 ASN 298 896 896 ASN ASN A . n A 1 299 PRO 299 897 897 PRO PRO A . n A 1 300 ASN 300 898 898 ASN ASN A . n A 1 301 SER 301 899 899 SER SER A . n A 1 302 ALA 302 900 900 ALA ALA A . n A 1 303 HIS 303 901 901 HIS HIS A . n A 1 304 HIS 304 902 902 HIS HIS A . n A 1 305 HIS 305 903 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1001 2 HOH HOH A . B 2 HOH 2 1002 6 HOH HOH A . B 2 HOH 3 1003 3 HOH HOH A . B 2 HOH 4 1004 5 HOH HOH A . B 2 HOH 5 1005 4 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13930 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-07 2 'Structure model' 1 1 2021-07-14 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_type 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_atom_type.pdbx_N_electrons' 7 3 'Structure model' '_atom_type.pdbx_scat_Z' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 639 ? ? -145.63 17.11 2 1 GLU A 646 ? ? -37.76 122.48 3 1 PRO A 655 ? ? -46.21 90.28 4 1 ARG A 656 ? ? 43.34 91.68 5 1 LYS A 657 ? ? -154.98 67.69 6 1 ARG A 658 ? ? 33.18 -135.48 7 1 GLU A 673 ? ? -38.15 -27.10 8 1 LYS A 674 ? ? -67.75 -71.33 9 1 ASP A 678 ? ? -45.55 -71.49 10 1 THR A 702 ? ? -99.11 -80.76 11 1 ARG A 757 ? ? 82.26 -52.23 12 1 ASP A 758 ? ? -113.33 53.21 13 1 SER A 775 ? A -139.59 -159.42 14 1 SER A 775 ? B -142.17 -158.23 15 1 ASP A 776 ? ? 45.62 100.81 16 1 ASP A 776 ? ? 46.11 100.81 17 1 SER A 815 ? ? -69.63 0.59 18 1 TRP A 838 ? ? 54.96 -124.47 19 1 ALA A 857 ? ? -54.52 108.76 20 1 PRO A 858 ? ? -49.99 160.39 21 1 ASP A 860 ? ? 84.46 -1.50 22 1 HIS A 901 ? ? -99.32 37.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 599 ? A HIS 1 2 1 Y 1 A PHE 600 ? A PHE 2 3 1 Y 1 A LYS 601 ? A LYS 3 4 1 Y 1 A PHE 602 ? A PHE 4 5 1 Y 1 A PRO 603 ? A PRO 5 6 1 Y 1 A GLY 604 ? A GLY 6 7 1 Y 1 A THR 605 ? A THR 7 8 1 Y 1 A LYS 606 ? A LYS 8 9 1 Y 1 A SER 780 ? A SER 182 10 1 Y 1 A ARG 781 ? A ARG 183 11 1 Y 1 A VAL 782 ? A VAL 184 12 1 Y 1 A ILE 783 ? A ILE 185 13 1 Y 1 A GLU 784 ? A GLU 186 14 1 Y 1 A ASP 785 ? A ASP 187 15 1 Y 1 A ASP 786 ? A ASP 188 16 1 Y 1 A PRO 787 ? A PRO 189 17 1 Y 1 A GLU 788 ? A GLU 190 18 1 Y 1 A ALA 789 ? A ALA 191 19 1 Y 1 A VAL 790 ? A VAL 192 20 1 Y 1 A TYR 791 ? A TYR 193 21 1 Y 1 A THR 792 ? A THR 194 22 1 Y 1 A THR 793 ? A THR 195 23 1 Y 1 A THR 794 ? A THR 196 24 1 Y 1 A GLY 795 ? A GLY 197 25 1 Y 1 A GLY 796 ? A GLY 198 26 1 Y 1 A LYS 797 ? A LYS 199 27 1 Y 1 A ILE 798 ? A ILE 200 28 1 Y 1 A HIS 903 ? A HIS 305 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2REI _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #