data_7EEZ # _entry.id 7EEZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7EEZ pdb_00007eez 10.2210/pdb7eez/pdb WWPDB D_1300020797 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7EEZ _pdbx_database_status.recvd_initial_deposition_date 2021-03-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, Y.' 1 ? 'Du, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Integr Plant Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1744-7909 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 1091 _citation.page_last 1096 _citation.title 'Recognition of H3K9me1 by maize RNA-directed DNA methylation factor SHH2.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/jipb.13103 _citation.pdbx_database_id_PubMed 33913587 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Y.' 1 ? primary 'Zhou, X.' 2 ? primary 'Luo, J.' 3 ? primary 'Lv, S.' 4 ? primary 'Liu, R.' 5 ? primary 'Du, X.' 6 ? primary 'Jia, B.' 7 ? primary 'Yuan, F.' 8 ? primary 'Zhang, H.' 9 ? primary 'Du, J.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7EEZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.262 _cell.length_a_esd ? _cell.length_b 47.262 _cell.length_b_esd ? _cell.length_c 137.568 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7EEZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HB transcription factor' 18101.371 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein SAWADEE HOMEODOMAIN HOMOLOG 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGKNPVESVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWINVRKCVRQRSLPCEATECVAVLP GDLILCFQEGKDQALYYDAHVLDAQRRRHDVRGCRCRFLVRYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAAATN ; _entity_poly.pdbx_seq_one_letter_code_can ;SGKNPVESVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWINVRKCVRQRSLPCEATECVAVLP GDLILCFQEGKDQALYYDAHVLDAQRRRHDVRGCRCRFLVRYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAAATN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 LYS n 1 4 ASN n 1 5 PRO n 1 6 VAL n 1 7 GLU n 1 8 SER n 1 9 VAL n 1 10 SER n 1 11 VAL n 1 12 GLU n 1 13 PHE n 1 14 GLU n 1 15 ALA n 1 16 LYS n 1 17 SER n 1 18 ALA n 1 19 ARG n 1 20 ASP n 1 21 GLY n 1 22 ALA n 1 23 TRP n 1 24 TYR n 1 25 ASP n 1 26 VAL n 1 27 ALA n 1 28 ALA n 1 29 PHE n 1 30 LEU n 1 31 SER n 1 32 HIS n 1 33 ARG n 1 34 LEU n 1 35 PHE n 1 36 GLU n 1 37 SER n 1 38 GLY n 1 39 ASP n 1 40 PRO n 1 41 GLU n 1 42 VAL n 1 43 ARG n 1 44 VAL n 1 45 ARG n 1 46 PHE n 1 47 SER n 1 48 GLY n 1 49 PHE n 1 50 GLY n 1 51 ALA n 1 52 GLU n 1 53 GLU n 1 54 ASP n 1 55 GLU n 1 56 TRP n 1 57 ILE n 1 58 ASN n 1 59 VAL n 1 60 ARG n 1 61 LYS n 1 62 CYS n 1 63 VAL n 1 64 ARG n 1 65 GLN n 1 66 ARG n 1 67 SER n 1 68 LEU n 1 69 PRO n 1 70 CYS n 1 71 GLU n 1 72 ALA n 1 73 THR n 1 74 GLU n 1 75 CYS n 1 76 VAL n 1 77 ALA n 1 78 VAL n 1 79 LEU n 1 80 PRO n 1 81 GLY n 1 82 ASP n 1 83 LEU n 1 84 ILE n 1 85 LEU n 1 86 CYS n 1 87 PHE n 1 88 GLN n 1 89 GLU n 1 90 GLY n 1 91 LYS n 1 92 ASP n 1 93 GLN n 1 94 ALA n 1 95 LEU n 1 96 TYR n 1 97 TYR n 1 98 ASP n 1 99 ALA n 1 100 HIS n 1 101 VAL n 1 102 LEU n 1 103 ASP n 1 104 ALA n 1 105 GLN n 1 106 ARG n 1 107 ARG n 1 108 ARG n 1 109 HIS n 1 110 ASP n 1 111 VAL n 1 112 ARG n 1 113 GLY n 1 114 CYS n 1 115 ARG n 1 116 CYS n 1 117 ARG n 1 118 PHE n 1 119 LEU n 1 120 VAL n 1 121 ARG n 1 122 TYR n 1 123 ASP n 1 124 HIS n 1 125 ASP n 1 126 SER n 1 127 SER n 1 128 GLU n 1 129 GLU n 1 130 ILE n 1 131 VAL n 1 132 PRO n 1 133 LEU n 1 134 ARG n 1 135 LYS n 1 136 VAL n 1 137 CYS n 1 138 ARG n 1 139 ARG n 1 140 PRO n 1 141 GLU n 1 142 THR n 1 143 ASP n 1 144 TYR n 1 145 ARG n 1 146 LEU n 1 147 GLN n 1 148 ILE n 1 149 LEU n 1 150 HIS n 1 151 ALA n 1 152 ALA n 1 153 ARG n 1 154 ALA n 1 155 ALA n 1 156 ALA n 1 157 THR n 1 158 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 158 _entity_src_gen.gene_src_common_name Maize _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene '100279552, HB131, ZEAMMB73_Zm00001d005584' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Zea mays' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4577 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-Sumo _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B7ZYP9_MAIZE _struct_ref.pdbx_db_accession B7ZYP9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GKNPVESVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWINVRKCVRQRSLPCEATECVAVLPG DLILCFQEGKDQALYYDAHVLDAQRRRHDVRGCRCRFLVRYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAAATN ; _struct_ref.pdbx_align_begin 125 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7EEZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 158 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B7ZYP9 _struct_ref_seq.db_align_beg 125 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 281 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 125 _struct_ref_seq.pdbx_auth_seq_align_end 281 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7EEZ _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code B7ZYP9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 124 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7EEZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bis-Tris, pH 6.5, 30% PEG 300' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-04-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'silicon crystal (111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7EEZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13044 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.500 _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.750 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.082 _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 201808 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.900 1.970 ? ? ? ? ? ? 1275 100.000 ? ? ? ? 0.720 ? ? ? ? ? ? ? ? 15 ? 1.613 ? ? 0.744 0.185 ? 1 1 0.974 ? ? 1.970 2.050 ? ? ? ? ? ? 1243 100.000 ? ? ? ? 0.506 ? ? ? ? ? ? ? ? 15 ? 1.629 ? ? 0.523 0.130 ? 2 1 0.986 ? ? 2.050 2.140 ? ? ? ? ? ? 1278 100.000 ? ? ? ? 0.405 ? ? ? ? ? ? ? ? 15 ? 1.658 ? ? 0.418 0.104 ? 3 1 0.988 ? ? 2.140 2.250 ? ? ? ? ? ? 1275 100.000 ? ? ? ? 0.280 ? ? ? ? ? ? ? ? 15 ? 1.667 ? ? 0.289 0.072 ? 4 1 0.992 ? ? 2.250 2.390 ? ? ? ? ? ? 1266 100.000 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 15 ? 1.655 ? ? 0.209 0.052 ? 5 1 0.996 ? ? 2.390 2.580 ? ? ? ? ? ? 1288 100.000 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? 15 ? 1.814 ? ? 0.163 0.041 ? 6 1 0.997 ? ? 2.580 2.840 ? ? ? ? ? ? 1299 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 15 ? 1.976 ? ? 0.121 0.030 ? 7 1 0.998 ? ? 2.840 3.250 ? ? ? ? ? ? 1310 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 15 ? 1.865 ? ? 0.076 0.019 ? 8 1 0.999 ? ? 3.250 4.090 ? ? ? ? ? ? 1336 100.000 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 15 ? 1.796 ? ? 0.052 0.013 ? 9 1 0.999 ? ? 4.090 50.000 ? ? ? ? ? ? 1474 99.500 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 13.800 ? 1.819 ? ? 0.046 0.012 ? 10 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 89.260 _refine.B_iso_mean 43.0936 _refine.B_iso_min 16.350 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7EEZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9020 _refine.ls_d_res_low 38.9530 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12965 _refine.ls_number_reflns_R_free 631 _refine.ls_number_reflns_R_work 12334 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8200 _refine.ls_percent_reflns_R_free 4.8700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2215 _refine.ls_R_factor_R_free 0.2362 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2208 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4IUR _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.9800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9020 _refine_hist.d_res_low 38.9530 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 1208 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 138 _refine_hist.pdbx_B_iso_mean_ligand 36.85 _refine_hist.pdbx_B_iso_mean_solvent 42.21 _refine_hist.pdbx_number_atoms_protein 1132 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1156 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.775 ? 1559 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.030 ? 161 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 209 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.060 ? 438 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.902 2.0483 . . 155 2348 100.0000 . . . 0.2931 0.0000 0.2600 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0483 2.2544 . . 127 2413 100.0000 . . . 0.2883 0.0000 0.2486 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2544 2.5806 . . 117 2433 100.0000 . . . 0.2109 0.0000 0.2342 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5806 3.2510 . . 133 2462 100.0000 . . . 0.2777 0.0000 0.2439 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2510 38.953 . . 99 2678 100.0000 . . . 0.1977 0.0000 0.1977 . . . . . . . . . . . # _struct.entry_id 7EEZ _struct.title 'crystal structure of maize SHH2 SAWADEE domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7EEZ _struct_keywords.text 'SAWADEE domain, Maize, SHH2, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 34 ? GLY A 38 ? LEU A 157 GLY A 161 5 ? 5 HELX_P HELX_P2 AA2 VAL A 59 ? CYS A 62 ? VAL A 182 CYS A 185 1 ? 4 HELX_P HELX_P3 AA3 GLU A 71 ? VAL A 78 ? GLU A 194 VAL A 201 5 ? 8 HELX_P HELX_P4 AA4 PRO A 140 ? ILE A 148 ? PRO A 263 ILE A 271 5 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 75 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 198 A ZN 501 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc2 metalc ? ? A HIS 109 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 232 A ZN 501 1_555 ? ? ? ? ? ? ? 2.207 ? ? metalc3 metalc ? ? A CYS 114 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 237 A ZN 501 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc4 metalc ? ? A CYS 116 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 239 A ZN 501 1_555 ? ? ? ? ? ? ? 2.232 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 55 ? ASN A 58 ? GLU A 178 ASN A 181 AA1 2 GLU A 41 ? PHE A 46 ? GLU A 164 PHE A 169 AA1 3 TRP A 23 ? ARG A 33 ? TRP A 146 ARG A 156 AA1 4 PHE A 13 ? LYS A 16 ? PHE A 136 LYS A 139 AA1 5 VAL A 63 ? GLN A 65 ? VAL A 186 GLN A 188 AA2 1 LEU A 68 ? PRO A 69 ? LEU A 191 PRO A 192 AA2 2 VAL A 136 ? ARG A 138 ? VAL A 259 ARG A 261 AA2 3 LEU A 83 ? GLU A 89 ? LEU A 206 GLU A 212 AA2 4 ALA A 94 ? GLN A 105 ? ALA A 217 GLN A 228 AA2 5 ARG A 117 ? TYR A 122 ? ARG A 240 TYR A 245 AA2 6 GLU A 128 ? PRO A 132 ? GLU A 251 PRO A 255 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 55 ? O GLU A 178 N VAL A 44 ? N VAL A 167 AA1 2 3 O ARG A 43 ? O ARG A 166 N LEU A 30 ? N LEU A 153 AA1 3 4 O VAL A 26 ? O VAL A 149 N PHE A 13 ? N PHE A 136 AA1 4 5 N GLU A 14 ? N GLU A 137 O ARG A 64 ? O ARG A 187 AA2 1 2 N LEU A 68 ? N LEU A 191 O ARG A 138 ? O ARG A 261 AA2 2 3 O CYS A 137 ? O CYS A 260 N LEU A 85 ? N LEU A 208 AA2 3 4 N CYS A 86 ? N CYS A 209 O TYR A 97 ? O TYR A 220 AA2 4 5 N GLN A 105 ? N GLN A 228 O ARG A 117 ? O ARG A 240 AA2 5 6 N VAL A 120 ? N VAL A 243 O GLU A 129 ? O GLU A 252 # _atom_sites.entry_id 7EEZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.021159 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021159 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007269 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 124 ? ? ? A . n A 1 2 GLY 2 125 ? ? ? A . n A 1 3 LYS 3 126 ? ? ? A . n A 1 4 ASN 4 127 ? ? ? A . n A 1 5 PRO 5 128 ? ? ? A . n A 1 6 VAL 6 129 ? ? ? A . n A 1 7 GLU 7 130 ? ? ? A . n A 1 8 SER 8 131 ? ? ? A . n A 1 9 VAL 9 132 ? ? ? A . n A 1 10 SER 10 133 ? ? ? A . n A 1 11 VAL 11 134 134 VAL VAL A . n A 1 12 GLU 12 135 135 GLU GLU A . n A 1 13 PHE 13 136 136 PHE PHE A . n A 1 14 GLU 14 137 137 GLU GLU A . n A 1 15 ALA 15 138 138 ALA ALA A . n A 1 16 LYS 16 139 139 LYS LYS A . n A 1 17 SER 17 140 140 SER SER A . n A 1 18 ALA 18 141 141 ALA ALA A . n A 1 19 ARG 19 142 142 ARG ARG A . n A 1 20 ASP 20 143 143 ASP ASP A . n A 1 21 GLY 21 144 144 GLY GLY A . n A 1 22 ALA 22 145 145 ALA ALA A . n A 1 23 TRP 23 146 146 TRP TRP A . n A 1 24 TYR 24 147 147 TYR TYR A . n A 1 25 ASP 25 148 148 ASP ASP A . n A 1 26 VAL 26 149 149 VAL VAL A . n A 1 27 ALA 27 150 150 ALA ALA A . n A 1 28 ALA 28 151 151 ALA ALA A . n A 1 29 PHE 29 152 152 PHE PHE A . n A 1 30 LEU 30 153 153 LEU LEU A . n A 1 31 SER 31 154 154 SER SER A . n A 1 32 HIS 32 155 155 HIS HIS A . n A 1 33 ARG 33 156 156 ARG ARG A . n A 1 34 LEU 34 157 157 LEU LEU A . n A 1 35 PHE 35 158 158 PHE PHE A . n A 1 36 GLU 36 159 159 GLU GLU A . n A 1 37 SER 37 160 160 SER SER A . n A 1 38 GLY 38 161 161 GLY GLY A . n A 1 39 ASP 39 162 162 ASP ASP A . n A 1 40 PRO 40 163 163 PRO PRO A . n A 1 41 GLU 41 164 164 GLU GLU A . n A 1 42 VAL 42 165 165 VAL VAL A . n A 1 43 ARG 43 166 166 ARG ARG A . n A 1 44 VAL 44 167 167 VAL VAL A . n A 1 45 ARG 45 168 168 ARG ARG A . n A 1 46 PHE 46 169 169 PHE PHE A . n A 1 47 SER 47 170 170 SER SER A . n A 1 48 GLY 48 171 171 GLY GLY A . n A 1 49 PHE 49 172 172 PHE PHE A . n A 1 50 GLY 50 173 173 GLY GLY A . n A 1 51 ALA 51 174 174 ALA ALA A . n A 1 52 GLU 52 175 175 GLU GLU A . n A 1 53 GLU 53 176 176 GLU GLU A . n A 1 54 ASP 54 177 177 ASP ASP A . n A 1 55 GLU 55 178 178 GLU GLU A . n A 1 56 TRP 56 179 179 TRP TRP A . n A 1 57 ILE 57 180 180 ILE ILE A . n A 1 58 ASN 58 181 181 ASN ASN A . n A 1 59 VAL 59 182 182 VAL VAL A . n A 1 60 ARG 60 183 183 ARG ARG A . n A 1 61 LYS 61 184 184 LYS LYS A . n A 1 62 CYS 62 185 185 CYS CYS A . n A 1 63 VAL 63 186 186 VAL VAL A . n A 1 64 ARG 64 187 187 ARG ARG A . n A 1 65 GLN 65 188 188 GLN GLN A . n A 1 66 ARG 66 189 189 ARG ARG A . n A 1 67 SER 67 190 190 SER SER A . n A 1 68 LEU 68 191 191 LEU LEU A . n A 1 69 PRO 69 192 192 PRO PRO A . n A 1 70 CYS 70 193 193 CYS CYS A . n A 1 71 GLU 71 194 194 GLU GLU A . n A 1 72 ALA 72 195 195 ALA ALA A . n A 1 73 THR 73 196 196 THR THR A . n A 1 74 GLU 74 197 197 GLU GLU A . n A 1 75 CYS 75 198 198 CYS CYS A . n A 1 76 VAL 76 199 199 VAL VAL A . n A 1 77 ALA 77 200 200 ALA ALA A . n A 1 78 VAL 78 201 201 VAL VAL A . n A 1 79 LEU 79 202 202 LEU LEU A . n A 1 80 PRO 80 203 203 PRO PRO A . n A 1 81 GLY 81 204 204 GLY GLY A . n A 1 82 ASP 82 205 205 ASP ASP A . n A 1 83 LEU 83 206 206 LEU LEU A . n A 1 84 ILE 84 207 207 ILE ILE A . n A 1 85 LEU 85 208 208 LEU LEU A . n A 1 86 CYS 86 209 209 CYS CYS A . n A 1 87 PHE 87 210 210 PHE PHE A . n A 1 88 GLN 88 211 211 GLN GLN A . n A 1 89 GLU 89 212 212 GLU GLU A . n A 1 90 GLY 90 213 213 GLY GLY A . n A 1 91 LYS 91 214 214 LYS LYS A . n A 1 92 ASP 92 215 215 ASP ASP A . n A 1 93 GLN 93 216 216 GLN GLN A . n A 1 94 ALA 94 217 217 ALA ALA A . n A 1 95 LEU 95 218 218 LEU LEU A . n A 1 96 TYR 96 219 219 TYR TYR A . n A 1 97 TYR 97 220 220 TYR TYR A . n A 1 98 ASP 98 221 221 ASP ASP A . n A 1 99 ALA 99 222 222 ALA ALA A . n A 1 100 HIS 100 223 223 HIS HIS A . n A 1 101 VAL 101 224 224 VAL VAL A . n A 1 102 LEU 102 225 225 LEU LEU A . n A 1 103 ASP 103 226 226 ASP ASP A . n A 1 104 ALA 104 227 227 ALA ALA A . n A 1 105 GLN 105 228 228 GLN GLN A . n A 1 106 ARG 106 229 229 ARG ARG A . n A 1 107 ARG 107 230 230 ARG ARG A . n A 1 108 ARG 108 231 231 ARG ARG A . n A 1 109 HIS 109 232 232 HIS HIS A . n A 1 110 ASP 110 233 233 ASP ASP A . n A 1 111 VAL 111 234 234 VAL VAL A . n A 1 112 ARG 112 235 235 ARG ARG A . n A 1 113 GLY 113 236 236 GLY GLY A . n A 1 114 CYS 114 237 237 CYS CYS A . n A 1 115 ARG 115 238 238 ARG ARG A . n A 1 116 CYS 116 239 239 CYS CYS A . n A 1 117 ARG 117 240 240 ARG ARG A . n A 1 118 PHE 118 241 241 PHE PHE A . n A 1 119 LEU 119 242 242 LEU LEU A . n A 1 120 VAL 120 243 243 VAL VAL A . n A 1 121 ARG 121 244 244 ARG ARG A . n A 1 122 TYR 122 245 245 TYR TYR A . n A 1 123 ASP 123 246 246 ASP ASP A . n A 1 124 HIS 124 247 247 HIS HIS A . n A 1 125 ASP 125 248 248 ASP ASP A . n A 1 126 SER 126 249 249 SER SER A . n A 1 127 SER 127 250 250 SER SER A . n A 1 128 GLU 128 251 251 GLU GLU A . n A 1 129 GLU 129 252 252 GLU GLU A . n A 1 130 ILE 130 253 253 ILE ILE A . n A 1 131 VAL 131 254 254 VAL VAL A . n A 1 132 PRO 132 255 255 PRO PRO A . n A 1 133 LEU 133 256 256 LEU LEU A . n A 1 134 ARG 134 257 257 ARG ARG A . n A 1 135 LYS 135 258 258 LYS LYS A . n A 1 136 VAL 136 259 259 VAL VAL A . n A 1 137 CYS 137 260 260 CYS CYS A . n A 1 138 ARG 138 261 261 ARG ARG A . n A 1 139 ARG 139 262 262 ARG ARG A . n A 1 140 PRO 140 263 263 PRO PRO A . n A 1 141 GLU 141 264 264 GLU GLU A . n A 1 142 THR 142 265 265 THR THR A . n A 1 143 ASP 143 266 266 ASP ASP A . n A 1 144 TYR 144 267 267 TYR TYR A . n A 1 145 ARG 145 268 268 ARG ARG A . n A 1 146 LEU 146 269 269 LEU LEU A . n A 1 147 GLN 147 270 270 GLN GLN A . n A 1 148 ILE 148 271 271 ILE ILE A . n A 1 149 LEU 149 272 ? ? ? A . n A 1 150 HIS 150 273 ? ? ? A . n A 1 151 ALA 151 274 ? ? ? A . n A 1 152 ALA 152 275 ? ? ? A . n A 1 153 ARG 153 276 ? ? ? A . n A 1 154 ALA 154 277 ? ? ? A . n A 1 155 ALA 155 278 ? ? ? A . n A 1 156 ALA 156 279 ? ? ? A . n A 1 157 THR 157 280 ? ? ? A . n A 1 158 ASN 158 281 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 501 501 ZN ZN A . C 3 HOH 1 601 26 HOH HOH A . C 3 HOH 2 602 20 HOH HOH A . C 3 HOH 3 603 10 HOH HOH A . C 3 HOH 4 604 62 HOH HOH A . C 3 HOH 5 605 35 HOH HOH A . C 3 HOH 6 606 7 HOH HOH A . C 3 HOH 7 607 12 HOH HOH A . C 3 HOH 8 608 4 HOH HOH A . C 3 HOH 9 609 33 HOH HOH A . C 3 HOH 10 610 5 HOH HOH A . C 3 HOH 11 611 48 HOH HOH A . C 3 HOH 12 612 3 HOH HOH A . C 3 HOH 13 613 34 HOH HOH A . C 3 HOH 14 614 59 HOH HOH A . C 3 HOH 15 615 8 HOH HOH A . C 3 HOH 16 616 60 HOH HOH A . C 3 HOH 17 617 40 HOH HOH A . C 3 HOH 18 618 52 HOH HOH A . C 3 HOH 19 619 61 HOH HOH A . C 3 HOH 20 620 63 HOH HOH A . C 3 HOH 21 621 31 HOH HOH A . C 3 HOH 22 622 29 HOH HOH A . C 3 HOH 23 623 25 HOH HOH A . C 3 HOH 24 624 18 HOH HOH A . C 3 HOH 25 625 27 HOH HOH A . C 3 HOH 26 626 2 HOH HOH A . C 3 HOH 27 627 13 HOH HOH A . C 3 HOH 28 628 69 HOH HOH A . C 3 HOH 29 629 19 HOH HOH A . C 3 HOH 30 630 17 HOH HOH A . C 3 HOH 31 631 1 HOH HOH A . C 3 HOH 32 632 39 HOH HOH A . C 3 HOH 33 633 16 HOH HOH A . C 3 HOH 34 634 23 HOH HOH A . C 3 HOH 35 635 22 HOH HOH A . C 3 HOH 36 636 14 HOH HOH A . C 3 HOH 37 637 24 HOH HOH A . C 3 HOH 38 638 44 HOH HOH A . C 3 HOH 39 639 74 HOH HOH A . C 3 HOH 40 640 71 HOH HOH A . C 3 HOH 41 641 11 HOH HOH A . C 3 HOH 42 642 46 HOH HOH A . C 3 HOH 43 643 38 HOH HOH A . C 3 HOH 44 644 32 HOH HOH A . C 3 HOH 45 645 49 HOH HOH A . C 3 HOH 46 646 6 HOH HOH A . C 3 HOH 47 647 54 HOH HOH A . C 3 HOH 48 648 45 HOH HOH A . C 3 HOH 49 649 9 HOH HOH A . C 3 HOH 50 650 50 HOH HOH A . C 3 HOH 51 651 66 HOH HOH A . C 3 HOH 52 652 30 HOH HOH A . C 3 HOH 53 653 47 HOH HOH A . C 3 HOH 54 654 43 HOH HOH A . C 3 HOH 55 655 75 HOH HOH A . C 3 HOH 56 656 41 HOH HOH A . C 3 HOH 57 657 15 HOH HOH A . C 3 HOH 58 658 57 HOH HOH A . C 3 HOH 59 659 65 HOH HOH A . C 3 HOH 60 660 55 HOH HOH A . C 3 HOH 61 661 37 HOH HOH A . C 3 HOH 62 662 36 HOH HOH A . C 3 HOH 63 663 67 HOH HOH A . C 3 HOH 64 664 58 HOH HOH A . C 3 HOH 65 665 68 HOH HOH A . C 3 HOH 66 666 70 HOH HOH A . C 3 HOH 67 667 64 HOH HOH A . C 3 HOH 68 668 73 HOH HOH A . C 3 HOH 69 669 56 HOH HOH A . C 3 HOH 70 670 21 HOH HOH A . C 3 HOH 71 671 28 HOH HOH A . C 3 HOH 72 672 42 HOH HOH A . C 3 HOH 73 673 53 HOH HOH A . C 3 HOH 74 674 51 HOH HOH A . C 3 HOH 75 675 72 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 656 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 75 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 109 ? A HIS 232 ? 1_555 96.9 ? 2 SG ? A CYS 75 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 SG ? A CYS 114 ? A CYS 237 ? 1_555 114.0 ? 3 NE2 ? A HIS 109 ? A HIS 232 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 SG ? A CYS 114 ? A CYS 237 ? 1_555 110.8 ? 4 SG ? A CYS 75 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 SG ? A CYS 116 ? A CYS 239 ? 1_555 111.8 ? 5 NE2 ? A HIS 109 ? A HIS 232 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 SG ? A CYS 116 ? A CYS 239 ? 1_555 123.6 ? 6 SG ? A CYS 114 ? A CYS 237 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 SG ? A CYS 116 ? A CYS 239 ? 1_555 100.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-30 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 23.7060 22.0286 50.6157 0.3066 ? 0.0481 ? -0.0049 ? 0.3598 ? -0.0379 ? 0.2923 ? 2.9427 ? -2.6478 ? 2.8318 ? 7.5511 ? -6.4629 ? 6.1041 ? -0.0874 ? -0.4435 ? -0.0606 ? 0.3760 ? 0.4738 ? 0.2252 ? -0.9044 ? -0.3033 ? -0.2307 ? 2 'X-RAY DIFFRACTION' ? refined 22.1044 25.8222 51.0419 0.5522 ? 0.0770 ? -0.0014 ? 0.2634 ? -0.0280 ? 0.2133 ? 5.9774 ? 0.6624 ? -0.5160 ? 8.4579 ? -0.9840 ? 1.7929 ? -0.0440 ? -0.0180 ? 0.4263 ? 0.4128 ? 0.3681 ? 0.6631 ? -1.5871 ? -0.2166 ? -0.1614 ? 3 'X-RAY DIFFRACTION' ? refined 37.6058 32.4122 47.9103 0.7782 ? -0.7640 ? -0.3379 ? 0.6438 ? -0.2317 ? 0.2698 ? 0.8421 ? 0.5779 ? 0.7936 ? 1.2684 ? 0.7552 ? 0.7951 ? -0.1049 ? 0.0995 ? 0.3735 ? 0.0121 ? 0.0518 ? -0.2878 ? -0.7871 ? 0.8339 ? -0.0507 ? 4 'X-RAY DIFFRACTION' ? refined 25.5437 28.2911 57.9058 0.8641 ? -0.0721 ? -0.0142 ? 0.5765 ? -0.0206 ? 0.4210 ? 4.4122 ? -2.7703 ? -4.2178 ? 2.7727 ? 1.8633 ? 4.7759 ? -0.0721 ? -1.5572 ? -0.7336 ? 0.9390 ? 0.0324 ? 0.2695 ? -0.4521 ? 1.1504 ? -0.1517 ? 5 'X-RAY DIFFRACTION' ? refined 30.1082 25.0467 47.2088 0.2948 ? -0.0961 ? -0.0423 ? 0.3454 ? -0.0355 ? 0.2665 ? 5.5457 ? 2.2565 ? 1.7937 ? 5.1199 ? 0.9128 ? 7.2808 ? -0.2049 ? -0.1517 ? 0.1364 ? 0.1393 ? 0.1561 ? -0.5000 ? -1.0781 ? 0.9208 ? 0.0085 ? 6 'X-RAY DIFFRACTION' ? refined 12.1969 20.6187 41.5539 0.3011 ? 0.0471 ? 0.0197 ? 0.6663 ? -0.0375 ? 0.6780 ? 2.0935 ? 2.8978 ? 0.8557 ? 4.7766 ? -0.4806 ? 4.2694 ? -0.2782 ? -0.4416 ? 0.8624 ? -0.2743 ? 0.0661 ? 1.8135 ? -0.3695 ? -1.8135 ? 0.2349 ? 7 'X-RAY DIFFRACTION' ? refined 16.0002 11.2208 42.6484 0.2923 ? -0.1327 ? 0.0278 ? 0.4210 ? -0.0152 ? 0.3419 ? 4.9746 ? 1.6098 ? 0.5752 ? 4.6661 ? 0.9688 ? 5.4896 ? 0.1444 ? -0.3511 ? -0.2172 ? 0.4253 ? 0.2342 ? 0.0760 ? 0.6950 ? -1.0903 ? -0.0509 ? 8 'X-RAY DIFFRACTION' ? refined 19.5580 9.1262 42.6943 0.3497 ? -0.0661 ? 0.0114 ? 0.2078 ? -0.0010 ? 0.3249 ? 5.5175 ? 2.7383 ? 1.3631 ? 5.5978 ? 2.0007 ? 5.9982 ? -0.2216 ? 0.0041 ? -0.6600 ? -0.1967 ? 0.2686 ? -0.0333 ? 1.1635 ? -0.5120 ? -0.1224 ? 9 'X-RAY DIFFRACTION' ? refined 2.6644 6.8958 35.5406 0.5168 ? -0.6168 ? -0.0095 ? 1.3075 ? -0.0708 ? 0.4506 ? 1.0700 ? 0.6266 ? 0.1011 ? 2.2054 ? 0.7144 ? 0.6701 ? 0.1127 ? 0.0387 ? -0.3914 ? 0.2890 ? -0.2325 ? 0.6366 ? 0.1944 ? -1.1638 ? 0.3389 ? 10 'X-RAY DIFFRACTION' ? refined 17.8225 7.1548 43.0707 0.4221 ? -0.1139 ? -0.0383 ? 0.3594 ? 0.0064 ? 0.3723 ? 6.3449 ? 1.1608 ? 0.9535 ? 5.2598 ? 0.8342 ? 5.0622 ? 0.0598 ? -0.2644 ? -0.8722 ? 0.3603 ? 0.3204 ? -0.1039 ? 1.2317 ? -0.5245 ? -0.3359 ? 11 'X-RAY DIFFRACTION' ? refined 16.4994 20.3957 30.7584 0.2555 ? -0.0910 ? -0.0120 ? 0.6126 ? 0.0231 ? 0.2716 ? 4.1367 ? -0.2207 ? 5.0233 ? 4.7740 ? 0.5034 ? 9.7408 ? -0.5083 ? 0.7083 ? -0.2515 ? -0.5337 ? 0.7673 ? 0.5324 ? -0.6117 ? -1.2910 ? -0.2957 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 134 ? ? ? A 145 ? ? ;chain 'A' and (resid 134 through 145 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 146 ? ? ? A 152 ? ? ;chain 'A' and (resid 146 through 152 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 153 ? ? ? A 163 ? ? ;chain 'A' and (resid 153 through 163 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 164 ? ? ? A 177 ? ? ;chain 'A' and (resid 164 through 177 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 178 ? ? ? A 188 ? ? ;chain 'A' and (resid 178 through 188 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 189 ? ? ? A 194 ? ? ;chain 'A' and (resid 189 through 194 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 195 ? ? ? A 216 ? ? ;chain 'A' and (resid 195 through 216 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 217 ? ? ? A 228 ? ? ;chain 'A' and (resid 217 through 228 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? A 229 ? ? ? A 239 ? ? ;chain 'A' and (resid 229 through 239 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? A 240 ? ? ? A 261 ? ? ;chain 'A' and (resid 240 through 261 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? A 262 ? ? ? A 271 ? ? ;chain 'A' and (resid 262 through 271 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 7EEZ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 215 ? ? -145.53 13.00 2 1 ASP A 233 ? ? -112.39 -166.77 3 1 SER A 249 ? ? 59.39 16.53 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 124 ? A SER 1 2 1 Y 1 A GLY 125 ? A GLY 2 3 1 Y 1 A LYS 126 ? A LYS 3 4 1 Y 1 A ASN 127 ? A ASN 4 5 1 Y 1 A PRO 128 ? A PRO 5 6 1 Y 1 A VAL 129 ? A VAL 6 7 1 Y 1 A GLU 130 ? A GLU 7 8 1 Y 1 A SER 131 ? A SER 8 9 1 Y 1 A VAL 132 ? A VAL 9 10 1 Y 1 A SER 133 ? A SER 10 11 1 Y 1 A LEU 272 ? A LEU 149 12 1 Y 1 A HIS 273 ? A HIS 150 13 1 Y 1 A ALA 274 ? A ALA 151 14 1 Y 1 A ALA 275 ? A ALA 152 15 1 Y 1 A ARG 276 ? A ARG 153 16 1 Y 1 A ALA 277 ? A ALA 154 17 1 Y 1 A ALA 278 ? A ALA 155 18 1 Y 1 A ALA 279 ? A ALA 156 19 1 Y 1 A THR 280 ? A THR 157 20 1 Y 1 A ASN 281 ? A ASN 158 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TRP N N N N 301 TRP CA C N S 302 TRP C C N N 303 TRP O O N N 304 TRP CB C N N 305 TRP CG C Y N 306 TRP CD1 C Y N 307 TRP CD2 C Y N 308 TRP NE1 N Y N 309 TRP CE2 C Y N 310 TRP CE3 C Y N 311 TRP CZ2 C Y N 312 TRP CZ3 C Y N 313 TRP CH2 C Y N 314 TRP OXT O N N 315 TRP H H N N 316 TRP H2 H N N 317 TRP HA H N N 318 TRP HB2 H N N 319 TRP HB3 H N N 320 TRP HD1 H N N 321 TRP HE1 H N N 322 TRP HE3 H N N 323 TRP HZ2 H N N 324 TRP HZ3 H N N 325 TRP HH2 H N N 326 TRP HXT H N N 327 TYR N N N N 328 TYR CA C N S 329 TYR C C N N 330 TYR O O N N 331 TYR CB C N N 332 TYR CG C Y N 333 TYR CD1 C Y N 334 TYR CD2 C Y N 335 TYR CE1 C Y N 336 TYR CE2 C Y N 337 TYR CZ C Y N 338 TYR OH O N N 339 TYR OXT O N N 340 TYR H H N N 341 TYR H2 H N N 342 TYR HA H N N 343 TYR HB2 H N N 344 TYR HB3 H N N 345 TYR HD1 H N N 346 TYR HD2 H N N 347 TYR HE1 H N N 348 TYR HE2 H N N 349 TYR HH H N N 350 TYR HXT H N N 351 VAL N N N N 352 VAL CA C N S 353 VAL C C N N 354 VAL O O N N 355 VAL CB C N N 356 VAL CG1 C N N 357 VAL CG2 C N N 358 VAL OXT O N N 359 VAL H H N N 360 VAL H2 H N N 361 VAL HA H N N 362 VAL HB H N N 363 VAL HG11 H N N 364 VAL HG12 H N N 365 VAL HG13 H N N 366 VAL HG21 H N N 367 VAL HG22 H N N 368 VAL HG23 H N N 369 VAL HXT H N N 370 ZN ZN ZN N N 371 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TRP N CA sing N N 287 TRP N H sing N N 288 TRP N H2 sing N N 289 TRP CA C sing N N 290 TRP CA CB sing N N 291 TRP CA HA sing N N 292 TRP C O doub N N 293 TRP C OXT sing N N 294 TRP CB CG sing N N 295 TRP CB HB2 sing N N 296 TRP CB HB3 sing N N 297 TRP CG CD1 doub Y N 298 TRP CG CD2 sing Y N 299 TRP CD1 NE1 sing Y N 300 TRP CD1 HD1 sing N N 301 TRP CD2 CE2 doub Y N 302 TRP CD2 CE3 sing Y N 303 TRP NE1 CE2 sing Y N 304 TRP NE1 HE1 sing N N 305 TRP CE2 CZ2 sing Y N 306 TRP CE3 CZ3 doub Y N 307 TRP CE3 HE3 sing N N 308 TRP CZ2 CH2 doub Y N 309 TRP CZ2 HZ2 sing N N 310 TRP CZ3 CH2 sing Y N 311 TRP CZ3 HZ3 sing N N 312 TRP CH2 HH2 sing N N 313 TRP OXT HXT sing N N 314 TYR N CA sing N N 315 TYR N H sing N N 316 TYR N H2 sing N N 317 TYR CA C sing N N 318 TYR CA CB sing N N 319 TYR CA HA sing N N 320 TYR C O doub N N 321 TYR C OXT sing N N 322 TYR CB CG sing N N 323 TYR CB HB2 sing N N 324 TYR CB HB3 sing N N 325 TYR CG CD1 doub Y N 326 TYR CG CD2 sing Y N 327 TYR CD1 CE1 sing Y N 328 TYR CD1 HD1 sing N N 329 TYR CD2 CE2 doub Y N 330 TYR CD2 HD2 sing N N 331 TYR CE1 CZ doub Y N 332 TYR CE1 HE1 sing N N 333 TYR CE2 CZ sing Y N 334 TYR CE2 HE2 sing N N 335 TYR CZ OH sing N N 336 TYR OH HH sing N N 337 TYR OXT HXT sing N N 338 VAL N CA sing N N 339 VAL N H sing N N 340 VAL N H2 sing N N 341 VAL CA C sing N N 342 VAL CA CB sing N N 343 VAL CA HA sing N N 344 VAL C O doub N N 345 VAL C OXT sing N N 346 VAL CB CG1 sing N N 347 VAL CB CG2 sing N N 348 VAL CB HB sing N N 349 VAL CG1 HG11 sing N N 350 VAL CG1 HG12 sing N N 351 VAL CG1 HG13 sing N N 352 VAL CG2 HG21 sing N N 353 VAL CG2 HG22 sing N N 354 VAL CG2 HG23 sing N N 355 VAL OXT HXT sing N N 356 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31770782 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4IUR _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #