data_7EI2 # _entry.id 7EI2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7EI2 pdb_00007ei2 10.2210/pdb7ei2/pdb WWPDB D_1300021534 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7EI2 _pdbx_database_status.recvd_initial_deposition_date 2021-03-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hayashi, K.' 1 ? 'Mikamiyama, H.' 2 ? 'Uehara, S.' 3 ? 'Yamamoto, S.' 4 ? 'Cary, D.' 5 ? 'Nishikawa, J.' 6 ? 'Ueda, T.' 7 ? 'Ozasa, H.' 8 ? 'Mihara, K.' 9 ? 'Yoshimura, N.' 10 ? 'Kawai, T.' 11 ? 'Ono, T.' 12 ? 'Yamamoto, S.' 13 ? 'Fumoto, M.' 14 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 1093 _citation.page_last 1101 _citation.title 'Macrocyclic Peptides as a Novel Class of NNMT Inhibitors: A SAR Study Aimed at Inhibitory Activity in the Cell.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.1c00134 _citation.pdbx_database_id_PubMed 34267879 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hayashi, K.' 1 0000-0002-2047-126X primary 'Uehara, S.' 2 0000-0001-5214-8531 primary 'Yamamoto, S.' 3 0000-0002-1731-7931 primary 'Cary, D.R.' 4 ? primary 'Nishikawa, J.' 5 ? primary 'Ueda, T.' 6 ? primary 'Ozasa, H.' 7 ? primary 'Mihara, K.' 8 ? primary 'Yoshimura, N.' 9 ? primary 'Kawai, T.' 10 ? primary 'Ono, T.' 11 ? primary 'Yamamoto, S.' 12 ? primary 'Fumoto, M.' 13 ? primary 'Mikamiyama, H.' 14 0000-0002-8964-398X # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 104.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7EI2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.693 _cell.length_a_esd ? _cell.length_b 67.645 _cell.length_b_esd ? _cell.length_c 44.300 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7EI2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nicotinamide N-methyltransferase' 28891.164 1 2.1.1.1 E103A ? ? 2 polymer syn 'macrocyclic peptide 8' 1175.377 1 ? ? ? ? 3 water nat water 18.015 68 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEI VVTDYSDQNLQELEKWLKKEPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVL STLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQS YSSTMANNEGLFSLVARKL ; ;GSGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEI VVTDYSDQNLQELEKWLKKEPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVL STLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQS YSSTMANNEGLFSLVARKL ; A ? 2 'polypeptide(L)' no yes 'G(MEA)PYKP(DI8)(XA6)C' GFPYKPXFC B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 PHE n 1 5 THR n 1 6 SER n 1 7 LYS n 1 8 ASP n 1 9 THR n 1 10 TYR n 1 11 LEU n 1 12 SER n 1 13 HIS n 1 14 PHE n 1 15 ASN n 1 16 PRO n 1 17 ARG n 1 18 ASP n 1 19 TYR n 1 20 LEU n 1 21 GLU n 1 22 LYS n 1 23 TYR n 1 24 TYR n 1 25 LYS n 1 26 PHE n 1 27 GLY n 1 28 SER n 1 29 ARG n 1 30 HIS n 1 31 SER n 1 32 ALA n 1 33 GLU n 1 34 SER n 1 35 GLN n 1 36 ILE n 1 37 LEU n 1 38 LYS n 1 39 HIS n 1 40 LEU n 1 41 LEU n 1 42 LYS n 1 43 ASN n 1 44 LEU n 1 45 PHE n 1 46 LYS n 1 47 ILE n 1 48 PHE n 1 49 CYS n 1 50 LEU n 1 51 ASP n 1 52 GLY n 1 53 VAL n 1 54 LYS n 1 55 GLY n 1 56 ASP n 1 57 LEU n 1 58 LEU n 1 59 ILE n 1 60 ASP n 1 61 ILE n 1 62 GLY n 1 63 SER n 1 64 GLY n 1 65 PRO n 1 66 THR n 1 67 ILE n 1 68 TYR n 1 69 GLN n 1 70 LEU n 1 71 LEU n 1 72 SER n 1 73 ALA n 1 74 CYS n 1 75 GLU n 1 76 SER n 1 77 PHE n 1 78 LYS n 1 79 GLU n 1 80 ILE n 1 81 VAL n 1 82 VAL n 1 83 THR n 1 84 ASP n 1 85 TYR n 1 86 SER n 1 87 ASP n 1 88 GLN n 1 89 ASN n 1 90 LEU n 1 91 GLN n 1 92 GLU n 1 93 LEU n 1 94 GLU n 1 95 LYS n 1 96 TRP n 1 97 LEU n 1 98 LYS n 1 99 LYS n 1 100 GLU n 1 101 PRO n 1 102 ALA n 1 103 ALA n 1 104 PHE n 1 105 ASP n 1 106 TRP n 1 107 SER n 1 108 PRO n 1 109 VAL n 1 110 VAL n 1 111 THR n 1 112 TYR n 1 113 VAL n 1 114 CYS n 1 115 ASP n 1 116 LEU n 1 117 GLU n 1 118 GLY n 1 119 ASN n 1 120 ARG n 1 121 VAL n 1 122 LYS n 1 123 GLY n 1 124 PRO n 1 125 GLU n 1 126 LYS n 1 127 GLU n 1 128 GLU n 1 129 LYS n 1 130 LEU n 1 131 ARG n 1 132 GLN n 1 133 ALA n 1 134 VAL n 1 135 LYS n 1 136 GLN n 1 137 VAL n 1 138 LEU n 1 139 LYS n 1 140 CYS n 1 141 ASP n 1 142 VAL n 1 143 THR n 1 144 GLN n 1 145 SER n 1 146 GLN n 1 147 PRO n 1 148 LEU n 1 149 GLY n 1 150 ALA n 1 151 VAL n 1 152 PRO n 1 153 LEU n 1 154 PRO n 1 155 PRO n 1 156 ALA n 1 157 ASP n 1 158 CYS n 1 159 VAL n 1 160 LEU n 1 161 SER n 1 162 THR n 1 163 LEU n 1 164 CYS n 1 165 LEU n 1 166 ASP n 1 167 ALA n 1 168 ALA n 1 169 CYS n 1 170 PRO n 1 171 ASP n 1 172 LEU n 1 173 PRO n 1 174 THR n 1 175 TYR n 1 176 CYS n 1 177 ARG n 1 178 ALA n 1 179 LEU n 1 180 ARG n 1 181 ASN n 1 182 LEU n 1 183 GLY n 1 184 SER n 1 185 LEU n 1 186 LEU n 1 187 LYS n 1 188 PRO n 1 189 GLY n 1 190 GLY n 1 191 PHE n 1 192 LEU n 1 193 VAL n 1 194 ILE n 1 195 MET n 1 196 ASP n 1 197 ALA n 1 198 LEU n 1 199 LYS n 1 200 SER n 1 201 SER n 1 202 TYR n 1 203 TYR n 1 204 MET n 1 205 ILE n 1 206 GLY n 1 207 GLU n 1 208 GLN n 1 209 LYS n 1 210 PHE n 1 211 SER n 1 212 SER n 1 213 LEU n 1 214 PRO n 1 215 LEU n 1 216 GLY n 1 217 ARG n 1 218 GLU n 1 219 ALA n 1 220 VAL n 1 221 GLU n 1 222 ALA n 1 223 ALA n 1 224 VAL n 1 225 LYS n 1 226 GLU n 1 227 ALA n 1 228 GLY n 1 229 TYR n 1 230 THR n 1 231 ILE n 1 232 GLU n 1 233 TRP n 1 234 PHE n 1 235 GLU n 1 236 VAL n 1 237 ILE n 1 238 SER n 1 239 GLN n 1 240 SER n 1 241 TYR n 1 242 SER n 1 243 SER n 1 244 THR n 1 245 MET n 1 246 ALA n 1 247 ASN n 1 248 ASN n 1 249 GLU n 1 250 GLY n 1 251 LEU n 1 252 PHE n 1 253 SER n 1 254 LEU n 1 255 VAL n 1 256 ALA n 1 257 ARG n 1 258 LYS n 1 259 LEU n 2 1 GLY n 2 2 MEA n 2 3 PRO n 2 4 TYR n 2 5 LYS n 2 6 PRO n 2 7 DI8 n 2 8 XA6 n 2 9 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 259 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NNMT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 9 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP NNMT_HUMAN P40261 ? 1 ;SGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIV VTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLS TLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSY SSTMANNEGLFSLVARKL ; 3 2 PDB 7EI2 7EI2 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7EI2 A 2 ? 259 ? P40261 3 ? 260 ? 3 260 2 2 7EI2 B 1 ? 9 ? 7EI2 0 ? 8 ? 0 8 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7EI2 GLY A 1 ? UNP P40261 ? ? 'expression tag' 2 1 1 7EI2 ALA A 102 ? UNP P40261 GLU 103 'engineered mutation' 103 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DI8 'L-peptide linking' . '(3S)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid' ? 'C10 H11 N O2' 177.200 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MEA 'L-peptide linking' n N-METHYLPHENYLALANINE ? 'C10 H13 N O2' 179.216 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XA6 'L-peptide linking' n '(2S)-3-(4-aminocarbonylphenyl)-2-azanyl-propanoic acid' ? 'C10 H12 N2 O3' 208.214 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7EI2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Sodium iodide, 0.1M Bis-Tris propane pH7.5, 20% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-07-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7EI2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.080 _reflns.d_resolution_low 52 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14497 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.100 _reflns.pdbx_Rmerge_I_obs 0.053 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.066 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.057 _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.080 2.150 ? ? ? ? ? ? 1455 99.800 ? ? ? ? 0.380 ? ? ? ? ? ? ? ? 6.300 ? 0.979 ? ? 0.413 0.161 ? 1 1 0.941 ? ? ? ? ? ? ? ? ? ? 2.150 2.240 ? ? ? ? ? ? 1449 100.000 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 6.900 ? 1.034 ? ? 0.328 0.124 ? 2 1 0.971 ? ? ? ? ? ? ? ? ? ? 2.240 2.340 ? ? ? ? ? ? 1444 100.000 ? ? ? ? 0.236 ? ? ? ? ? ? ? ? 7.100 ? 1.055 ? ? 0.255 0.096 ? 3 1 0.978 ? ? ? ? ? ? ? ? ? ? 2.340 2.470 ? ? ? ? ? ? 1413 100.000 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 7.100 ? 1.083 ? ? 0.190 0.071 ? 4 1 0.987 ? ? ? ? ? ? ? ? ? ? 2.470 2.620 ? ? ? ? ? ? 1468 100.000 ? ? ? ? 0.134 ? ? ? ? ? ? ? ? 7.200 ? 1.199 ? ? 0.144 0.054 ? 5 1 0.993 ? ? ? ? ? ? ? ? ? ? 2.620 2.820 ? ? ? ? ? ? 1428 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 7.200 ? 1.139 ? ? 0.111 0.041 ? 6 1 0.994 ? ? ? ? ? ? ? ? ? ? 2.820 3.110 ? ? ? ? ? ? 1451 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 7.300 ? 1.068 ? ? 0.084 0.031 ? 7 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.110 3.560 ? ? ? ? ? ? 1450 100.000 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 7.300 ? 0.999 ? ? 0.059 0.022 ? 8 1 0.998 ? ? ? ? ? ? ? ? ? ? 3.560 4.480 ? ? ? ? ? ? 1469 100.000 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 7.300 ? 0.979 ? ? 0.041 0.015 ? 9 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.480 50.000 ? ? ? ? ? ? 1470 99.600 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 7.100 ? 1.116 ? ? 0.032 0.012 ? 10 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 0.1000 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0200 _refine.aniso_B[2][2] -0.0700 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -0.0200 _refine.B_iso_max 104.060 _refine.B_iso_mean 46.7340 _refine.B_iso_min 28.950 _refine.correlation_coeff_Fo_to_Fc 0.9640 _refine.correlation_coeff_Fo_to_Fc_free 0.9470 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7EI2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0800 _refine.ls_d_res_low 51.98 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13794 _refine.ls_number_reflns_R_free 701 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8600 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1870 _refine.ls_R_factor_R_free 0.2464 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1840 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3ROD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2240 _refine.pdbx_overall_ESU_R_Free 0.1970 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.8090 _refine.overall_SU_ML 0.1550 _refine.overall_SU_R_Cruickshank_DPI 0.2242 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0800 _refine_hist.d_res_low 51.98 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 1951 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 242 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 48.61 _refine_hist.pdbx_number_atoms_protein 1883 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.019 1946 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.594 1.998 2641 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.570 5.000 241 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.147 24.474 76 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.303 15.000 321 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.828 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.110 0.200 293 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 1458 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0800 _refine_ls_shell.d_res_low 2.1330 _refine_ls_shell.number_reflns_all 1046 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 48 _refine_ls_shell.number_reflns_R_work 998 _refine_ls_shell.percent_reflns_obs 98.8700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3180 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2420 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7EI2 _struct.title 'Structure of human NNMT in complex with macrocyclic peptide 8' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7EI2 _struct_keywords.text 'Nicotinamide N-methyltransferase, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 15 ? TYR A 24 ? ASN A 16 TYR A 25 1 ? 10 HELX_P HELX_P2 AA2 SER A 31 ? CYS A 49 ? SER A 32 CYS A 50 1 ? 19 HELX_P HELX_P3 AA3 ILE A 67 ? LEU A 71 ? ILE A 68 LEU A 72 5 ? 5 HELX_P HELX_P4 AA4 SER A 72 ? GLU A 75 ? SER A 73 GLU A 76 5 ? 4 HELX_P HELX_P5 AA5 SER A 86 ? LYS A 98 ? SER A 87 LYS A 99 1 ? 13 HELX_P HELX_P6 AA6 TRP A 106 ? GLU A 117 ? TRP A 107 GLU A 118 1 ? 12 HELX_P HELX_P7 AA7 LYS A 122 ? ALA A 133 ? LYS A 123 ALA A 134 1 ? 12 HELX_P HELX_P8 AA8 CYS A 164 ? CYS A 169 ? CYS A 165 CYS A 170 1 ? 6 HELX_P HELX_P9 AA9 ASP A 171 ? SER A 184 ? ASP A 172 SER A 185 1 ? 14 HELX_P HELX_P10 AB1 ARG A 217 ? ALA A 227 ? ARG A 218 ALA A 228 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GLY 1 C ? ? ? 1_555 B MEA 2 N ? ? B GLY 0 B MEA 1 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale none ? B GLY 1 CA ? ? ? 1_555 B CYS 9 SG ? ? B GLY 0 B CYS 8 1_555 ? ? ? ? ? ? ? 1.634 ? ? covale3 covale both ? B MEA 2 C ? ? ? 1_555 B PRO 3 N ? ? B MEA 1 B PRO 2 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale4 covale both ? B PRO 6 C ? ? ? 1_555 B DI8 7 N ? ? B PRO 5 B DI8 6 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale5 covale both ? B DI8 7 C ? ? ? 1_555 B XA6 8 N ? ? B DI8 6 B XA6 7 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale6 covale both ? B XA6 8 C ? ? ? 1_555 B CYS 9 N ? ? B XA6 7 B CYS 8 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MEA 2 B . ? MEA 1 B PRO 3 B ? PRO 2 B 1 12.15 2 PRO 6 B . ? PRO 5 B DI8 7 B ? DI8 6 B 1 -2.76 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 134 ? LYS A 139 ? VAL A 135 LYS A 140 AA1 2 PHE A 77 ? ASP A 84 ? PHE A 78 ASP A 85 AA1 3 GLY A 55 ? ILE A 61 ? GLY A 56 ILE A 62 AA1 4 ALA A 156 ? THR A 162 ? ALA A 157 THR A 163 AA1 5 LEU A 186 ? ALA A 197 ? LEU A 187 ALA A 198 AA1 6 LEU A 251 ? LYS A 258 ? LEU A 252 LYS A 259 AA1 7 TYR A 229 ? VAL A 236 ? TYR A 230 VAL A 237 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 138 ? O LEU A 139 N VAL A 82 ? N VAL A 83 AA1 2 3 O GLU A 79 ? O GLU A 80 N ASP A 56 ? N ASP A 57 AA1 3 4 N ILE A 61 ? N ILE A 62 O LEU A 160 ? O LEU A 161 AA1 4 5 N ASP A 157 ? N ASP A 158 O PHE A 191 ? O PHE A 192 AA1 5 6 N ASP A 196 ? N ASP A 197 O PHE A 252 ? O PHE A 253 AA1 6 7 O VAL A 255 ? O VAL A 256 N TRP A 233 ? N TRP A 234 # _atom_sites.entry_id 7EI2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011948 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002978 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014783 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023264 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 ? ? ? A . n A 1 2 SER 2 3 ? ? ? A . n A 1 3 GLY 3 4 ? ? ? A . n A 1 4 PHE 4 5 ? ? ? A . n A 1 5 THR 5 6 ? ? ? A . n A 1 6 SER 6 7 ? ? ? A . n A 1 7 LYS 7 8 ? ? ? A . n A 1 8 ASP 8 9 ? ? ? A . n A 1 9 THR 9 10 ? ? ? A . n A 1 10 TYR 10 11 ? ? ? A . n A 1 11 LEU 11 12 12 LEU LEU A . n A 1 12 SER 12 13 13 SER SER A . n A 1 13 HIS 13 14 14 HIS HIS A . n A 1 14 PHE 14 15 15 PHE PHE A . n A 1 15 ASN 15 16 16 ASN ASN A . n A 1 16 PRO 16 17 17 PRO PRO A . n A 1 17 ARG 17 18 18 ARG ARG A . n A 1 18 ASP 18 19 19 ASP ASP A . n A 1 19 TYR 19 20 20 TYR TYR A . n A 1 20 LEU 20 21 21 LEU LEU A . n A 1 21 GLU 21 22 22 GLU GLU A . n A 1 22 LYS 22 23 23 LYS LYS A . n A 1 23 TYR 23 24 24 TYR TYR A . n A 1 24 TYR 24 25 25 TYR TYR A . n A 1 25 LYS 25 26 26 LYS LYS A . n A 1 26 PHE 26 27 27 PHE PHE A . n A 1 27 GLY 27 28 28 GLY GLY A . n A 1 28 SER 28 29 29 SER SER A . n A 1 29 ARG 29 30 30 ARG ARG A . n A 1 30 HIS 30 31 31 HIS HIS A . n A 1 31 SER 31 32 32 SER SER A . n A 1 32 ALA 32 33 33 ALA ALA A . n A 1 33 GLU 33 34 34 GLU GLU A . n A 1 34 SER 34 35 35 SER SER A . n A 1 35 GLN 35 36 36 GLN GLN A . n A 1 36 ILE 36 37 37 ILE ILE A . n A 1 37 LEU 37 38 38 LEU LEU A . n A 1 38 LYS 38 39 39 LYS LYS A . n A 1 39 HIS 39 40 40 HIS HIS A . n A 1 40 LEU 40 41 41 LEU LEU A . n A 1 41 LEU 41 42 42 LEU LEU A . n A 1 42 LYS 42 43 43 LYS LYS A . n A 1 43 ASN 43 44 44 ASN ASN A . n A 1 44 LEU 44 45 45 LEU LEU A . n A 1 45 PHE 45 46 46 PHE PHE A . n A 1 46 LYS 46 47 47 LYS LYS A . n A 1 47 ILE 47 48 48 ILE ILE A . n A 1 48 PHE 48 49 49 PHE PHE A . n A 1 49 CYS 49 50 50 CYS CYS A . n A 1 50 LEU 50 51 51 LEU LEU A . n A 1 51 ASP 51 52 52 ASP ASP A . n A 1 52 GLY 52 53 53 GLY GLY A . n A 1 53 VAL 53 54 54 VAL VAL A . n A 1 54 LYS 54 55 55 LYS LYS A . n A 1 55 GLY 55 56 56 GLY GLY A . n A 1 56 ASP 56 57 57 ASP ASP A . n A 1 57 LEU 57 58 58 LEU LEU A . n A 1 58 LEU 58 59 59 LEU LEU A . n A 1 59 ILE 59 60 60 ILE ILE A . n A 1 60 ASP 60 61 61 ASP ASP A . n A 1 61 ILE 61 62 62 ILE ILE A . n A 1 62 GLY 62 63 63 GLY GLY A . n A 1 63 SER 63 64 64 SER SER A . n A 1 64 GLY 64 65 65 GLY GLY A . n A 1 65 PRO 65 66 66 PRO PRO A . n A 1 66 THR 66 67 67 THR THR A . n A 1 67 ILE 67 68 68 ILE ILE A . n A 1 68 TYR 68 69 69 TYR TYR A . n A 1 69 GLN 69 70 70 GLN GLN A . n A 1 70 LEU 70 71 71 LEU LEU A . n A 1 71 LEU 71 72 72 LEU LEU A . n A 1 72 SER 72 73 73 SER SER A . n A 1 73 ALA 73 74 74 ALA ALA A . n A 1 74 CYS 74 75 75 CYS CYS A . n A 1 75 GLU 75 76 76 GLU GLU A . n A 1 76 SER 76 77 77 SER SER A . n A 1 77 PHE 77 78 78 PHE PHE A . n A 1 78 LYS 78 79 79 LYS LYS A . n A 1 79 GLU 79 80 80 GLU GLU A . n A 1 80 ILE 80 81 81 ILE ILE A . n A 1 81 VAL 81 82 82 VAL VAL A . n A 1 82 VAL 82 83 83 VAL VAL A . n A 1 83 THR 83 84 84 THR THR A . n A 1 84 ASP 84 85 85 ASP ASP A . n A 1 85 TYR 85 86 86 TYR TYR A . n A 1 86 SER 86 87 87 SER SER A . n A 1 87 ASP 87 88 88 ASP ASP A . n A 1 88 GLN 88 89 89 GLN GLN A . n A 1 89 ASN 89 90 90 ASN ASN A . n A 1 90 LEU 90 91 91 LEU LEU A . n A 1 91 GLN 91 92 92 GLN GLN A . n A 1 92 GLU 92 93 93 GLU GLU A . n A 1 93 LEU 93 94 94 LEU LEU A . n A 1 94 GLU 94 95 95 GLU GLU A . n A 1 95 LYS 95 96 96 LYS LYS A . n A 1 96 TRP 96 97 97 TRP TRP A . n A 1 97 LEU 97 98 98 LEU LEU A . n A 1 98 LYS 98 99 99 LYS LYS A . n A 1 99 LYS 99 100 100 LYS LYS A . n A 1 100 GLU 100 101 101 GLU GLU A . n A 1 101 PRO 101 102 102 PRO PRO A . n A 1 102 ALA 102 103 103 ALA ALA A . n A 1 103 ALA 103 104 104 ALA ALA A . n A 1 104 PHE 104 105 105 PHE PHE A . n A 1 105 ASP 105 106 106 ASP ASP A . n A 1 106 TRP 106 107 107 TRP TRP A . n A 1 107 SER 107 108 108 SER SER A . n A 1 108 PRO 108 109 109 PRO PRO A . n A 1 109 VAL 109 110 110 VAL VAL A . n A 1 110 VAL 110 111 111 VAL VAL A . n A 1 111 THR 111 112 112 THR THR A . n A 1 112 TYR 112 113 113 TYR TYR A . n A 1 113 VAL 113 114 114 VAL VAL A . n A 1 114 CYS 114 115 115 CYS CYS A . n A 1 115 ASP 115 116 116 ASP ASP A . n A 1 116 LEU 116 117 117 LEU LEU A . n A 1 117 GLU 117 118 118 GLU GLU A . n A 1 118 GLY 118 119 119 GLY GLY A . n A 1 119 ASN 119 120 120 ASN ASN A . n A 1 120 ARG 120 121 121 ARG ARG A . n A 1 121 VAL 121 122 122 VAL VAL A . n A 1 122 LYS 122 123 123 LYS LYS A . n A 1 123 GLY 123 124 124 GLY GLY A . n A 1 124 PRO 124 125 125 PRO PRO A . n A 1 125 GLU 125 126 126 GLU GLU A . n A 1 126 LYS 126 127 127 LYS LYS A . n A 1 127 GLU 127 128 128 GLU GLU A . n A 1 128 GLU 128 129 129 GLU GLU A . n A 1 129 LYS 129 130 130 LYS LYS A . n A 1 130 LEU 130 131 131 LEU LEU A . n A 1 131 ARG 131 132 132 ARG ARG A . n A 1 132 GLN 132 133 133 GLN GLN A . n A 1 133 ALA 133 134 134 ALA ALA A . n A 1 134 VAL 134 135 135 VAL VAL A . n A 1 135 LYS 135 136 136 LYS LYS A . n A 1 136 GLN 136 137 137 GLN GLN A . n A 1 137 VAL 137 138 138 VAL VAL A . n A 1 138 LEU 138 139 139 LEU LEU A . n A 1 139 LYS 139 140 140 LYS LYS A . n A 1 140 CYS 140 141 141 CYS CYS A . n A 1 141 ASP 141 142 142 ASP ASP A . n A 1 142 VAL 142 143 143 VAL VAL A . n A 1 143 THR 143 144 144 THR THR A . n A 1 144 GLN 144 145 145 GLN GLN A . n A 1 145 SER 145 146 146 SER SER A . n A 1 146 GLN 146 147 147 GLN GLN A . n A 1 147 PRO 147 148 148 PRO PRO A . n A 1 148 LEU 148 149 149 LEU LEU A . n A 1 149 GLY 149 150 150 GLY GLY A . n A 1 150 ALA 150 151 151 ALA ALA A . n A 1 151 VAL 151 152 152 VAL VAL A . n A 1 152 PRO 152 153 153 PRO PRO A . n A 1 153 LEU 153 154 154 LEU LEU A . n A 1 154 PRO 154 155 155 PRO PRO A . n A 1 155 PRO 155 156 156 PRO PRO A . n A 1 156 ALA 156 157 157 ALA ALA A . n A 1 157 ASP 157 158 158 ASP ASP A . n A 1 158 CYS 158 159 159 CYS CYS A . n A 1 159 VAL 159 160 160 VAL VAL A . n A 1 160 LEU 160 161 161 LEU LEU A . n A 1 161 SER 161 162 162 SER SER A . n A 1 162 THR 162 163 163 THR THR A . n A 1 163 LEU 163 164 164 LEU LEU A . n A 1 164 CYS 164 165 165 CYS CYS A . n A 1 165 LEU 165 166 166 LEU LEU A . n A 1 166 ASP 166 167 167 ASP ASP A . n A 1 167 ALA 167 168 168 ALA ALA A . n A 1 168 ALA 168 169 169 ALA ALA A . n A 1 169 CYS 169 170 170 CYS CYS A . n A 1 170 PRO 170 171 171 PRO PRO A . n A 1 171 ASP 171 172 172 ASP ASP A . n A 1 172 LEU 172 173 173 LEU LEU A . n A 1 173 PRO 173 174 174 PRO PRO A . n A 1 174 THR 174 175 175 THR THR A . n A 1 175 TYR 175 176 176 TYR TYR A . n A 1 176 CYS 176 177 177 CYS CYS A . n A 1 177 ARG 177 178 178 ARG ARG A . n A 1 178 ALA 178 179 179 ALA ALA A . n A 1 179 LEU 179 180 180 LEU LEU A . n A 1 180 ARG 180 181 181 ARG ARG A . n A 1 181 ASN 181 182 182 ASN ASN A . n A 1 182 LEU 182 183 183 LEU LEU A . n A 1 183 GLY 183 184 184 GLY GLY A . n A 1 184 SER 184 185 185 SER SER A . n A 1 185 LEU 185 186 186 LEU LEU A . n A 1 186 LEU 186 187 187 LEU LEU A . n A 1 187 LYS 187 188 188 LYS LYS A . n A 1 188 PRO 188 189 189 PRO PRO A . n A 1 189 GLY 189 190 190 GLY GLY A . n A 1 190 GLY 190 191 191 GLY GLY A . n A 1 191 PHE 191 192 192 PHE PHE A . n A 1 192 LEU 192 193 193 LEU LEU A . n A 1 193 VAL 193 194 194 VAL VAL A . n A 1 194 ILE 194 195 195 ILE ILE A . n A 1 195 MET 195 196 196 MET MET A . n A 1 196 ASP 196 197 197 ASP ASP A . n A 1 197 ALA 197 198 198 ALA ALA A . n A 1 198 LEU 198 199 199 LEU LEU A . n A 1 199 LYS 199 200 200 LYS LYS A . n A 1 200 SER 200 201 201 SER SER A . n A 1 201 SER 201 202 202 SER SER A . n A 1 202 TYR 202 203 203 TYR TYR A . n A 1 203 TYR 203 204 204 TYR TYR A . n A 1 204 MET 204 205 205 MET MET A . n A 1 205 ILE 205 206 206 ILE ILE A . n A 1 206 GLY 206 207 207 GLY GLY A . n A 1 207 GLU 207 208 208 GLU GLU A . n A 1 208 GLN 208 209 209 GLN GLN A . n A 1 209 LYS 209 210 210 LYS LYS A . n A 1 210 PHE 210 211 211 PHE PHE A . n A 1 211 SER 211 212 212 SER SER A . n A 1 212 SER 212 213 ? ? ? A . n A 1 213 LEU 213 214 ? ? ? A . n A 1 214 PRO 214 215 ? ? ? A . n A 1 215 LEU 215 216 ? ? ? A . n A 1 216 GLY 216 217 217 GLY GLY A . n A 1 217 ARG 217 218 218 ARG ARG A . n A 1 218 GLU 218 219 219 GLU GLU A . n A 1 219 ALA 219 220 220 ALA ALA A . n A 1 220 VAL 220 221 221 VAL VAL A . n A 1 221 GLU 221 222 222 GLU GLU A . n A 1 222 ALA 222 223 223 ALA ALA A . n A 1 223 ALA 223 224 224 ALA ALA A . n A 1 224 VAL 224 225 225 VAL VAL A . n A 1 225 LYS 225 226 226 LYS LYS A . n A 1 226 GLU 226 227 227 GLU GLU A . n A 1 227 ALA 227 228 228 ALA ALA A . n A 1 228 GLY 228 229 229 GLY GLY A . n A 1 229 TYR 229 230 230 TYR TYR A . n A 1 230 THR 230 231 231 THR THR A . n A 1 231 ILE 231 232 232 ILE ILE A . n A 1 232 GLU 232 233 233 GLU GLU A . n A 1 233 TRP 233 234 234 TRP TRP A . n A 1 234 PHE 234 235 235 PHE PHE A . n A 1 235 GLU 235 236 236 GLU GLU A . n A 1 236 VAL 236 237 237 VAL VAL A . n A 1 237 ILE 237 238 238 ILE ILE A . n A 1 238 SER 238 239 ? ? ? A . n A 1 239 GLN 239 240 ? ? ? A . n A 1 240 SER 240 241 ? ? ? A . n A 1 241 TYR 241 242 ? ? ? A . n A 1 242 SER 242 243 ? ? ? A . n A 1 243 SER 243 244 ? ? ? A . n A 1 244 THR 244 245 ? ? ? A . n A 1 245 MET 245 246 ? ? ? A . n A 1 246 ALA 246 247 ? ? ? A . n A 1 247 ASN 247 248 ? ? ? A . n A 1 248 ASN 248 249 ? ? ? A . n A 1 249 GLU 249 250 ? ? ? A . n A 1 250 GLY 250 251 251 GLY GLY A . n A 1 251 LEU 251 252 252 LEU LEU A . n A 1 252 PHE 252 253 253 PHE PHE A . n A 1 253 SER 253 254 254 SER SER A . n A 1 254 LEU 254 255 255 LEU LEU A . n A 1 255 VAL 255 256 256 VAL VAL A . n A 1 256 ALA 256 257 257 ALA ALA A . n A 1 257 ARG 257 258 258 ARG ARG A . n A 1 258 LYS 258 259 259 LYS LYS A . n A 1 259 LEU 259 260 260 LEU LEU A . n B 2 1 GLY 1 0 0 GLY GLY B . n B 2 2 MEA 2 1 1 MEA MEA B . n B 2 3 PRO 3 2 2 PRO PRO B . n B 2 4 TYR 4 3 3 TYR TYR B . n B 2 5 LYS 5 4 4 LYS LYS B . n B 2 6 PRO 6 5 5 PRO PRO B . n B 2 7 DI8 7 6 6 DI8 DI8 B . n B 2 8 XA6 8 7 7 XA6 XA6 B . n B 2 9 CYS 9 8 8 CYS CYS B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 301 235 HOH HOH A . C 3 HOH 2 302 226 HOH HOH A . C 3 HOH 3 303 229 HOH HOH A . C 3 HOH 4 304 10 HOH HOH A . C 3 HOH 5 305 37 HOH HOH A . C 3 HOH 6 306 205 HOH HOH A . C 3 HOH 7 307 51 HOH HOH A . C 3 HOH 8 308 30 HOH HOH A . C 3 HOH 9 309 236 HOH HOH A . C 3 HOH 10 310 216 HOH HOH A . C 3 HOH 11 311 233 HOH HOH A . C 3 HOH 12 312 2 HOH HOH A . C 3 HOH 13 313 19 HOH HOH A . C 3 HOH 14 314 234 HOH HOH A . C 3 HOH 15 315 32 HOH HOH A . C 3 HOH 16 316 68 HOH HOH A . C 3 HOH 17 317 9 HOH HOH A . C 3 HOH 18 318 215 HOH HOH A . C 3 HOH 19 319 223 HOH HOH A . C 3 HOH 20 320 221 HOH HOH A . C 3 HOH 21 321 77 HOH HOH A . C 3 HOH 22 322 35 HOH HOH A . C 3 HOH 23 323 1 HOH HOH A . C 3 HOH 24 324 213 HOH HOH A . C 3 HOH 25 325 50 HOH HOH A . C 3 HOH 26 326 108 HOH HOH A . C 3 HOH 27 327 211 HOH HOH A . C 3 HOH 28 328 20 HOH HOH A . C 3 HOH 29 329 29 HOH HOH A . C 3 HOH 30 330 231 HOH HOH A . C 3 HOH 31 331 146 HOH HOH A . C 3 HOH 32 332 53 HOH HOH A . C 3 HOH 33 333 232 HOH HOH A . C 3 HOH 34 334 72 HOH HOH A . C 3 HOH 35 335 13 HOH HOH A . C 3 HOH 36 336 18 HOH HOH A . C 3 HOH 37 337 209 HOH HOH A . C 3 HOH 38 338 26 HOH HOH A . C 3 HOH 39 339 214 HOH HOH A . C 3 HOH 40 340 220 HOH HOH A . C 3 HOH 41 341 228 HOH HOH A . C 3 HOH 42 342 104 HOH HOH A . C 3 HOH 43 343 230 HOH HOH A . C 3 HOH 44 344 133 HOH HOH A . C 3 HOH 45 345 39 HOH HOH A . C 3 HOH 46 346 22 HOH HOH A . C 3 HOH 47 347 212 HOH HOH A . C 3 HOH 48 348 54 HOH HOH A . C 3 HOH 49 349 41 HOH HOH A . C 3 HOH 50 350 218 HOH HOH A . C 3 HOH 51 351 120 HOH HOH A . C 3 HOH 52 352 23 HOH HOH A . C 3 HOH 53 353 34 HOH HOH A . C 3 HOH 54 354 219 HOH HOH A . C 3 HOH 55 355 208 HOH HOH A . C 3 HOH 56 356 42 HOH HOH A . C 3 HOH 57 357 5 HOH HOH A . C 3 HOH 58 358 237 HOH HOH A . C 3 HOH 59 359 28 HOH HOH A . C 3 HOH 60 360 36 HOH HOH A . C 3 HOH 61 361 25 HOH HOH A . C 3 HOH 62 362 227 HOH HOH A . C 3 HOH 63 363 206 HOH HOH A . C 3 HOH 64 364 217 HOH HOH A . C 3 HOH 65 365 98 HOH HOH A . D 3 HOH 1 101 46 HOH HOH B . D 3 HOH 2 102 21 HOH HOH B . D 3 HOH 3 103 15 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1430 ? 1 MORE -7 ? 1 'SSA (A^2)' 11000 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-30 2 'Structure model' 1 1 2022-10-12 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' # _pdbx_phasing_MR.entry_id 7EI2 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body 0.464 _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 30.860 _pdbx_phasing_MR.d_res_low_rotation 2.360 _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0218 1 ? 'data reduction' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 2 ? 'data scaling' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 3 ? phasing ? ? 'Alexei Vaguine' alexei@ysbl.york.ac.uk ? ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/molrep.html ? MOLREP ? ? program 11.6.02 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Oct. 31, 2020' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.27 5 # _pdbx_entry_details.entry_id 7EI2 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG1 A THR 163 ? ? O A HOH 301 ? ? 1.83 2 1 O A GLU 101 ? ? O A HOH 302 ? ? 2.15 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 120 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 39.74 _pdbx_validate_torsion.psi 45.25 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 12 ? CG ? A LEU 11 CG 2 1 Y 1 A LEU 12 ? CD1 ? A LEU 11 CD1 3 1 Y 1 A LEU 12 ? CD2 ? A LEU 11 CD2 4 1 Y 1 A SER 13 ? OG ? A SER 12 OG 5 1 Y 1 A LYS 23 ? NZ ? A LYS 22 NZ 6 1 Y 1 A LYS 79 ? NZ ? A LYS 78 NZ 7 1 Y 1 A ARG 121 ? NE ? A ARG 120 NE 8 1 Y 1 A ARG 121 ? CZ ? A ARG 120 CZ 9 1 Y 1 A ARG 121 ? NH1 ? A ARG 120 NH1 10 1 Y 1 A ARG 121 ? NH2 ? A ARG 120 NH2 11 1 Y 1 A LYS 123 ? CG ? A LYS 122 CG 12 1 Y 1 A LYS 123 ? CD ? A LYS 122 CD 13 1 Y 1 A LYS 123 ? CE ? A LYS 122 CE 14 1 Y 1 A LYS 123 ? NZ ? A LYS 122 NZ 15 1 Y 1 A LYS 136 ? CG ? A LYS 135 CG 16 1 Y 1 A LYS 136 ? CD ? A LYS 135 CD 17 1 Y 1 A LYS 136 ? CE ? A LYS 135 CE 18 1 Y 1 A LYS 136 ? NZ ? A LYS 135 NZ 19 1 Y 1 A LYS 200 ? CE ? A LYS 199 CE 20 1 Y 1 A LYS 200 ? NZ ? A LYS 199 NZ 21 1 Y 1 A GLU 208 ? CG ? A GLU 207 CG 22 1 Y 1 A GLU 208 ? CD ? A GLU 207 CD 23 1 Y 1 A GLU 208 ? OE1 ? A GLU 207 OE1 24 1 Y 1 A GLU 208 ? OE2 ? A GLU 207 OE2 25 1 Y 1 A LYS 210 ? CE ? A LYS 209 CE 26 1 Y 1 A LYS 210 ? NZ ? A LYS 209 NZ 27 1 Y 1 A SER 212 ? OG ? A SER 211 OG 28 1 Y 1 A GLU 219 ? CG ? A GLU 218 CG 29 1 Y 1 A GLU 219 ? CD ? A GLU 218 CD 30 1 Y 1 A GLU 219 ? OE1 ? A GLU 218 OE1 31 1 Y 1 A GLU 219 ? OE2 ? A GLU 218 OE2 32 1 Y 1 A GLU 236 ? CG ? A GLU 235 CG 33 1 Y 1 A GLU 236 ? CD ? A GLU 235 CD 34 1 Y 1 A GLU 236 ? OE1 ? A GLU 235 OE1 35 1 Y 1 A GLU 236 ? OE2 ? A GLU 235 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 2 ? A GLY 1 2 1 Y 1 A SER 3 ? A SER 2 3 1 Y 1 A GLY 4 ? A GLY 3 4 1 Y 1 A PHE 5 ? A PHE 4 5 1 Y 1 A THR 6 ? A THR 5 6 1 Y 1 A SER 7 ? A SER 6 7 1 Y 1 A LYS 8 ? A LYS 7 8 1 Y 1 A ASP 9 ? A ASP 8 9 1 Y 1 A THR 10 ? A THR 9 10 1 Y 1 A TYR 11 ? A TYR 10 11 1 Y 1 A SER 213 ? A SER 212 12 1 Y 1 A LEU 214 ? A LEU 213 13 1 Y 1 A PRO 215 ? A PRO 214 14 1 Y 1 A LEU 216 ? A LEU 215 15 1 Y 1 A SER 239 ? A SER 238 16 1 Y 1 A GLN 240 ? A GLN 239 17 1 Y 1 A SER 241 ? A SER 240 18 1 Y 1 A TYR 242 ? A TYR 241 19 1 Y 1 A SER 243 ? A SER 242 20 1 Y 1 A SER 244 ? A SER 243 21 1 Y 1 A THR 245 ? A THR 244 22 1 Y 1 A MET 246 ? A MET 245 23 1 Y 1 A ALA 247 ? A ALA 246 24 1 Y 1 A ASN 248 ? A ASN 247 25 1 Y 1 A ASN 249 ? A ASN 248 26 1 Y 1 A GLU 250 ? A GLU 249 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DI8 C C N N 88 DI8 N N N N 89 DI8 O O N N 90 DI8 C1 C N N 91 DI8 C2 C Y N 92 DI8 C3 C Y N 93 DI8 C4 C Y N 94 DI8 C5 C Y N 95 DI8 C6 C Y N 96 DI8 C7 C Y N 97 DI8 C8 C N N 98 DI8 CA C N S 99 DI8 OXT O N N 100 DI8 H H N N 101 DI8 HXT H N N 102 DI8 H1 H N N 103 DI8 H1A H N N 104 DI8 H3 H N N 105 DI8 H4 H N N 106 DI8 H5 H N N 107 DI8 H6 H N N 108 DI8 H8 H N N 109 DI8 H8A H N N 110 DI8 HA H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MEA C1 C N N 254 MEA N N N N 255 MEA CA C N S 256 MEA C C N N 257 MEA O O N N 258 MEA CB C N N 259 MEA CG C Y N 260 MEA CD1 C Y N 261 MEA CE1 C Y N 262 MEA CZ C Y N 263 MEA CE2 C Y N 264 MEA CD2 C Y N 265 MEA OXT O N N 266 MEA HC1 H N N 267 MEA HC2 H N N 268 MEA HC3 H N N 269 MEA H H N N 270 MEA HA H N N 271 MEA HB1 H N N 272 MEA HB2 H N N 273 MEA HD1 H N N 274 MEA HE1 H N N 275 MEA HZ H N N 276 MEA HE2 H N N 277 MEA HD2 H N N 278 MEA HXT H N N 279 MET N N N N 280 MET CA C N S 281 MET C C N N 282 MET O O N N 283 MET CB C N N 284 MET CG C N N 285 MET SD S N N 286 MET CE C N N 287 MET OXT O N N 288 MET H H N N 289 MET H2 H N N 290 MET HA H N N 291 MET HB2 H N N 292 MET HB3 H N N 293 MET HG2 H N N 294 MET HG3 H N N 295 MET HE1 H N N 296 MET HE2 H N N 297 MET HE3 H N N 298 MET HXT H N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SER N N N N 340 SER CA C N S 341 SER C C N N 342 SER O O N N 343 SER CB C N N 344 SER OG O N N 345 SER OXT O N N 346 SER H H N N 347 SER H2 H N N 348 SER HA H N N 349 SER HB2 H N N 350 SER HB3 H N N 351 SER HG H N N 352 SER HXT H N N 353 THR N N N N 354 THR CA C N S 355 THR C C N N 356 THR O O N N 357 THR CB C N R 358 THR OG1 O N N 359 THR CG2 C N N 360 THR OXT O N N 361 THR H H N N 362 THR H2 H N N 363 THR HA H N N 364 THR HB H N N 365 THR HG1 H N N 366 THR HG21 H N N 367 THR HG22 H N N 368 THR HG23 H N N 369 THR HXT H N N 370 TRP N N N N 371 TRP CA C N S 372 TRP C C N N 373 TRP O O N N 374 TRP CB C N N 375 TRP CG C Y N 376 TRP CD1 C Y N 377 TRP CD2 C Y N 378 TRP NE1 N Y N 379 TRP CE2 C Y N 380 TRP CE3 C Y N 381 TRP CZ2 C Y N 382 TRP CZ3 C Y N 383 TRP CH2 C Y N 384 TRP OXT O N N 385 TRP H H N N 386 TRP H2 H N N 387 TRP HA H N N 388 TRP HB2 H N N 389 TRP HB3 H N N 390 TRP HD1 H N N 391 TRP HE1 H N N 392 TRP HE3 H N N 393 TRP HZ2 H N N 394 TRP HZ3 H N N 395 TRP HH2 H N N 396 TRP HXT H N N 397 TYR N N N N 398 TYR CA C N S 399 TYR C C N N 400 TYR O O N N 401 TYR CB C N N 402 TYR CG C Y N 403 TYR CD1 C Y N 404 TYR CD2 C Y N 405 TYR CE1 C Y N 406 TYR CE2 C Y N 407 TYR CZ C Y N 408 TYR OH O N N 409 TYR OXT O N N 410 TYR H H N N 411 TYR H2 H N N 412 TYR HA H N N 413 TYR HB2 H N N 414 TYR HB3 H N N 415 TYR HD1 H N N 416 TYR HD2 H N N 417 TYR HE1 H N N 418 TYR HE2 H N N 419 TYR HH H N N 420 TYR HXT H N N 421 VAL N N N N 422 VAL CA C N S 423 VAL C C N N 424 VAL O O N N 425 VAL CB C N N 426 VAL CG1 C N N 427 VAL CG2 C N N 428 VAL OXT O N N 429 VAL H H N N 430 VAL H2 H N N 431 VAL HA H N N 432 VAL HB H N N 433 VAL HG11 H N N 434 VAL HG12 H N N 435 VAL HG13 H N N 436 VAL HG21 H N N 437 VAL HG22 H N N 438 VAL HG23 H N N 439 VAL HXT H N N 440 XA6 N N N N 441 XA6 CA C N S 442 XA6 CB C N N 443 XA6 CG C Y N 444 XA6 CD1 C Y N 445 XA6 CE1 C Y N 446 XA6 CD2 C Y N 447 XA6 CE2 C Y N 448 XA6 CZ1 C Y N 449 XA6 CH C N N 450 XA6 OT O N N 451 XA6 NT N N N 452 XA6 C C N N 453 XA6 O O N N 454 XA6 H H N N 455 XA6 H2 H N N 456 XA6 HA H N N 457 XA6 H5 H N N 458 XA6 H6 H N N 459 XA6 H7 H N N 460 XA6 H8 H N N 461 XA6 H9 H N N 462 XA6 H10 H N N 463 XA6 H11 H N N 464 XA6 H12 H N N 465 XA6 OXT O N N 466 XA6 HXT H N N 467 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DI8 O C doub N N 83 DI8 OXT C sing N N 84 DI8 C CA sing N N 85 DI8 CA N sing N N 86 DI8 N C8 sing N N 87 DI8 N H sing N N 88 DI8 OXT HXT sing N N 89 DI8 CA C1 sing N N 90 DI8 C1 C2 sing N N 91 DI8 C1 H1 sing N N 92 DI8 C1 H1A sing N N 93 DI8 C2 C7 doub Y N 94 DI8 C2 C3 sing Y N 95 DI8 C3 C4 doub Y N 96 DI8 C3 H3 sing N N 97 DI8 C4 C5 sing Y N 98 DI8 C4 H4 sing N N 99 DI8 C6 C5 doub Y N 100 DI8 C5 H5 sing N N 101 DI8 C7 C6 sing Y N 102 DI8 C6 H6 sing N N 103 DI8 C8 C7 sing N N 104 DI8 C8 H8 sing N N 105 DI8 C8 H8A sing N N 106 DI8 CA HA sing N N 107 GLN N CA sing N N 108 GLN N H sing N N 109 GLN N H2 sing N N 110 GLN CA C sing N N 111 GLN CA CB sing N N 112 GLN CA HA sing N N 113 GLN C O doub N N 114 GLN C OXT sing N N 115 GLN CB CG sing N N 116 GLN CB HB2 sing N N 117 GLN CB HB3 sing N N 118 GLN CG CD sing N N 119 GLN CG HG2 sing N N 120 GLN CG HG3 sing N N 121 GLN CD OE1 doub N N 122 GLN CD NE2 sing N N 123 GLN NE2 HE21 sing N N 124 GLN NE2 HE22 sing N N 125 GLN OXT HXT sing N N 126 GLU N CA sing N N 127 GLU N H sing N N 128 GLU N H2 sing N N 129 GLU CA C sing N N 130 GLU CA CB sing N N 131 GLU CA HA sing N N 132 GLU C O doub N N 133 GLU C OXT sing N N 134 GLU CB CG sing N N 135 GLU CB HB2 sing N N 136 GLU CB HB3 sing N N 137 GLU CG CD sing N N 138 GLU CG HG2 sing N N 139 GLU CG HG3 sing N N 140 GLU CD OE1 doub N N 141 GLU CD OE2 sing N N 142 GLU OE2 HE2 sing N N 143 GLU OXT HXT sing N N 144 GLY N CA sing N N 145 GLY N H sing N N 146 GLY N H2 sing N N 147 GLY CA C sing N N 148 GLY CA HA2 sing N N 149 GLY CA HA3 sing N N 150 GLY C O doub N N 151 GLY C OXT sing N N 152 GLY OXT HXT sing N N 153 HIS N CA sing N N 154 HIS N H sing N N 155 HIS N H2 sing N N 156 HIS CA C sing N N 157 HIS CA CB sing N N 158 HIS CA HA sing N N 159 HIS C O doub N N 160 HIS C OXT sing N N 161 HIS CB CG sing N N 162 HIS CB HB2 sing N N 163 HIS CB HB3 sing N N 164 HIS CG ND1 sing Y N 165 HIS CG CD2 doub Y N 166 HIS ND1 CE1 doub Y N 167 HIS ND1 HD1 sing N N 168 HIS CD2 NE2 sing Y N 169 HIS CD2 HD2 sing N N 170 HIS CE1 NE2 sing Y N 171 HIS CE1 HE1 sing N N 172 HIS NE2 HE2 sing N N 173 HIS OXT HXT sing N N 174 HOH O H1 sing N N 175 HOH O H2 sing N N 176 ILE N CA sing N N 177 ILE N H sing N N 178 ILE N H2 sing N N 179 ILE CA C sing N N 180 ILE CA CB sing N N 181 ILE CA HA sing N N 182 ILE C O doub N N 183 ILE C OXT sing N N 184 ILE CB CG1 sing N N 185 ILE CB CG2 sing N N 186 ILE CB HB sing N N 187 ILE CG1 CD1 sing N N 188 ILE CG1 HG12 sing N N 189 ILE CG1 HG13 sing N N 190 ILE CG2 HG21 sing N N 191 ILE CG2 HG22 sing N N 192 ILE CG2 HG23 sing N N 193 ILE CD1 HD11 sing N N 194 ILE CD1 HD12 sing N N 195 ILE CD1 HD13 sing N N 196 ILE OXT HXT sing N N 197 LEU N CA sing N N 198 LEU N H sing N N 199 LEU N H2 sing N N 200 LEU CA C sing N N 201 LEU CA CB sing N N 202 LEU CA HA sing N N 203 LEU C O doub N N 204 LEU C OXT sing N N 205 LEU CB CG sing N N 206 LEU CB HB2 sing N N 207 LEU CB HB3 sing N N 208 LEU CG CD1 sing N N 209 LEU CG CD2 sing N N 210 LEU CG HG sing N N 211 LEU CD1 HD11 sing N N 212 LEU CD1 HD12 sing N N 213 LEU CD1 HD13 sing N N 214 LEU CD2 HD21 sing N N 215 LEU CD2 HD22 sing N N 216 LEU CD2 HD23 sing N N 217 LEU OXT HXT sing N N 218 LYS N CA sing N N 219 LYS N H sing N N 220 LYS N H2 sing N N 221 LYS CA C sing N N 222 LYS CA CB sing N N 223 LYS CA HA sing N N 224 LYS C O doub N N 225 LYS C OXT sing N N 226 LYS CB CG sing N N 227 LYS CB HB2 sing N N 228 LYS CB HB3 sing N N 229 LYS CG CD sing N N 230 LYS CG HG2 sing N N 231 LYS CG HG3 sing N N 232 LYS CD CE sing N N 233 LYS CD HD2 sing N N 234 LYS CD HD3 sing N N 235 LYS CE NZ sing N N 236 LYS CE HE2 sing N N 237 LYS CE HE3 sing N N 238 LYS NZ HZ1 sing N N 239 LYS NZ HZ2 sing N N 240 LYS NZ HZ3 sing N N 241 LYS OXT HXT sing N N 242 MEA C1 N sing N N 243 MEA C1 HC1 sing N N 244 MEA C1 HC2 sing N N 245 MEA C1 HC3 sing N N 246 MEA N CA sing N N 247 MEA N H sing N N 248 MEA CA C sing N N 249 MEA CA CB sing N N 250 MEA CA HA sing N N 251 MEA C O doub N N 252 MEA C OXT sing N N 253 MEA CB CG sing N N 254 MEA CB HB1 sing N N 255 MEA CB HB2 sing N N 256 MEA CG CD1 doub Y N 257 MEA CG CD2 sing Y N 258 MEA CD1 CE1 sing Y N 259 MEA CD1 HD1 sing N N 260 MEA CE1 CZ doub Y N 261 MEA CE1 HE1 sing N N 262 MEA CZ CE2 sing Y N 263 MEA CZ HZ sing N N 264 MEA CE2 CD2 doub Y N 265 MEA CE2 HE2 sing N N 266 MEA CD2 HD2 sing N N 267 MEA OXT HXT sing N N 268 MET N CA sing N N 269 MET N H sing N N 270 MET N H2 sing N N 271 MET CA C sing N N 272 MET CA CB sing N N 273 MET CA HA sing N N 274 MET C O doub N N 275 MET C OXT sing N N 276 MET CB CG sing N N 277 MET CB HB2 sing N N 278 MET CB HB3 sing N N 279 MET CG SD sing N N 280 MET CG HG2 sing N N 281 MET CG HG3 sing N N 282 MET SD CE sing N N 283 MET CE HE1 sing N N 284 MET CE HE2 sing N N 285 MET CE HE3 sing N N 286 MET OXT HXT sing N N 287 PHE N CA sing N N 288 PHE N H sing N N 289 PHE N H2 sing N N 290 PHE CA C sing N N 291 PHE CA CB sing N N 292 PHE CA HA sing N N 293 PHE C O doub N N 294 PHE C OXT sing N N 295 PHE CB CG sing N N 296 PHE CB HB2 sing N N 297 PHE CB HB3 sing N N 298 PHE CG CD1 doub Y N 299 PHE CG CD2 sing Y N 300 PHE CD1 CE1 sing Y N 301 PHE CD1 HD1 sing N N 302 PHE CD2 CE2 doub Y N 303 PHE CD2 HD2 sing N N 304 PHE CE1 CZ doub Y N 305 PHE CE1 HE1 sing N N 306 PHE CE2 CZ sing Y N 307 PHE CE2 HE2 sing N N 308 PHE CZ HZ sing N N 309 PHE OXT HXT sing N N 310 PRO N CA sing N N 311 PRO N CD sing N N 312 PRO N H sing N N 313 PRO CA C sing N N 314 PRO CA CB sing N N 315 PRO CA HA sing N N 316 PRO C O doub N N 317 PRO C OXT sing N N 318 PRO CB CG sing N N 319 PRO CB HB2 sing N N 320 PRO CB HB3 sing N N 321 PRO CG CD sing N N 322 PRO CG HG2 sing N N 323 PRO CG HG3 sing N N 324 PRO CD HD2 sing N N 325 PRO CD HD3 sing N N 326 PRO OXT HXT sing N N 327 SER N CA sing N N 328 SER N H sing N N 329 SER N H2 sing N N 330 SER CA C sing N N 331 SER CA CB sing N N 332 SER CA HA sing N N 333 SER C O doub N N 334 SER C OXT sing N N 335 SER CB OG sing N N 336 SER CB HB2 sing N N 337 SER CB HB3 sing N N 338 SER OG HG sing N N 339 SER OXT HXT sing N N 340 THR N CA sing N N 341 THR N H sing N N 342 THR N H2 sing N N 343 THR CA C sing N N 344 THR CA CB sing N N 345 THR CA HA sing N N 346 THR C O doub N N 347 THR C OXT sing N N 348 THR CB OG1 sing N N 349 THR CB CG2 sing N N 350 THR CB HB sing N N 351 THR OG1 HG1 sing N N 352 THR CG2 HG21 sing N N 353 THR CG2 HG22 sing N N 354 THR CG2 HG23 sing N N 355 THR OXT HXT sing N N 356 TRP N CA sing N N 357 TRP N H sing N N 358 TRP N H2 sing N N 359 TRP CA C sing N N 360 TRP CA CB sing N N 361 TRP CA HA sing N N 362 TRP C O doub N N 363 TRP C OXT sing N N 364 TRP CB CG sing N N 365 TRP CB HB2 sing N N 366 TRP CB HB3 sing N N 367 TRP CG CD1 doub Y N 368 TRP CG CD2 sing Y N 369 TRP CD1 NE1 sing Y N 370 TRP CD1 HD1 sing N N 371 TRP CD2 CE2 doub Y N 372 TRP CD2 CE3 sing Y N 373 TRP NE1 CE2 sing Y N 374 TRP NE1 HE1 sing N N 375 TRP CE2 CZ2 sing Y N 376 TRP CE3 CZ3 doub Y N 377 TRP CE3 HE3 sing N N 378 TRP CZ2 CH2 doub Y N 379 TRP CZ2 HZ2 sing N N 380 TRP CZ3 CH2 sing Y N 381 TRP CZ3 HZ3 sing N N 382 TRP CH2 HH2 sing N N 383 TRP OXT HXT sing N N 384 TYR N CA sing N N 385 TYR N H sing N N 386 TYR N H2 sing N N 387 TYR CA C sing N N 388 TYR CA CB sing N N 389 TYR CA HA sing N N 390 TYR C O doub N N 391 TYR C OXT sing N N 392 TYR CB CG sing N N 393 TYR CB HB2 sing N N 394 TYR CB HB3 sing N N 395 TYR CG CD1 doub Y N 396 TYR CG CD2 sing Y N 397 TYR CD1 CE1 sing Y N 398 TYR CD1 HD1 sing N N 399 TYR CD2 CE2 doub Y N 400 TYR CD2 HD2 sing N N 401 TYR CE1 CZ doub Y N 402 TYR CE1 HE1 sing N N 403 TYR CE2 CZ sing Y N 404 TYR CE2 HE2 sing N N 405 TYR CZ OH sing N N 406 TYR OH HH sing N N 407 TYR OXT HXT sing N N 408 VAL N CA sing N N 409 VAL N H sing N N 410 VAL N H2 sing N N 411 VAL CA C sing N N 412 VAL CA CB sing N N 413 VAL CA HA sing N N 414 VAL C O doub N N 415 VAL C OXT sing N N 416 VAL CB CG1 sing N N 417 VAL CB CG2 sing N N 418 VAL CB HB sing N N 419 VAL CG1 HG11 sing N N 420 VAL CG1 HG12 sing N N 421 VAL CG1 HG13 sing N N 422 VAL CG2 HG21 sing N N 423 VAL CG2 HG22 sing N N 424 VAL CG2 HG23 sing N N 425 VAL OXT HXT sing N N 426 XA6 NT CH sing N N 427 XA6 OT CH doub N N 428 XA6 CH CZ1 sing N N 429 XA6 CZ1 CE2 doub Y N 430 XA6 CZ1 CE1 sing Y N 431 XA6 CE2 CD2 sing Y N 432 XA6 CE1 CD1 doub Y N 433 XA6 CD2 CG doub Y N 434 XA6 CD1 CG sing Y N 435 XA6 CG CB sing N N 436 XA6 CB CA sing N N 437 XA6 CA N sing N N 438 XA6 CA C sing N N 439 XA6 O C doub N N 440 XA6 N H sing N N 441 XA6 N H2 sing N N 442 XA6 CA HA sing N N 443 XA6 CB H5 sing N N 444 XA6 CB H6 sing N N 445 XA6 CD1 H7 sing N N 446 XA6 CE1 H8 sing N N 447 XA6 CD2 H9 sing N N 448 XA6 CE2 H10 sing N N 449 XA6 NT H11 sing N N 450 XA6 NT H12 sing N N 451 XA6 C OXT sing N N 452 XA6 OXT HXT sing N N 453 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 XA6 ? ? XA6 ? ? 'SUBJECT OF INVESTIGATION' ? 2 MEA ? ? MEA ? ? 'SUBJECT OF INVESTIGATION' ? 3 DI8 ? ? DI8 ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3ROD _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #