data_7ER3 # _entry.id 7ER3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ER3 pdb_00007er3 10.2210/pdb7er3/pdb WWPDB D_1300022071 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-05-18 2 'Structure model' 1 1 2023-03-29 3 'Structure model' 1 2 2023-11-29 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7ER3 _pdbx_database_status.recvd_initial_deposition_date 2021-05-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yao, Q.' 1 ? 'Ma, J.' 2 ? 'Xing, Y.' 3 ? 'Zang, J.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J.Agric.Food Chem.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5118 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 69 _citation.language ? _citation.page_first 10669 _citation.page_last 10677 _citation.title 'Binding of Chloroquine to Whey Protein Relieves Its Cytotoxicity while Enhancing Its Uptake by Cells.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jafc.1c04140 _citation.pdbx_database_id_PubMed 34463093 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yao, Q.' 1 0000-0002-8998-3108 primary 'Xing, Y.' 2 ? primary 'Ma, J.' 3 ? primary 'Wang, C.' 4 ? primary 'Zang, J.' 5 0000-0003-0566-9726 primary 'Zhao, G.' 6 0000-0001-8587-9680 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Major allergen beta-lactoglobulin' 18387.264 4 ? ? ? ? 2 non-polymer syn '(4S)-N~4~-(7-chloroquinolin-4-yl)-N~1~,N~1~-diethylpentane-1,4-diamine' 319.872 4 ? ? ? ? 3 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_seq_one_letter_code_can ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(4S)-N~4~-(7-chloroquinolin-4-yl)-N~1~,N~1~-diethylpentane-1,4-diamine' 0TX 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ILE n 1 3 VAL n 1 4 THR n 1 5 GLN n 1 6 THR n 1 7 MET n 1 8 LYS n 1 9 GLY n 1 10 LEU n 1 11 ASP n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 VAL n 1 16 ALA n 1 17 GLY n 1 18 THR n 1 19 TRP n 1 20 TYR n 1 21 SER n 1 22 LEU n 1 23 ALA n 1 24 MET n 1 25 ALA n 1 26 ALA n 1 27 SER n 1 28 ASP n 1 29 ILE n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 ASP n 1 34 ALA n 1 35 GLN n 1 36 SER n 1 37 ALA n 1 38 PRO n 1 39 LEU n 1 40 ARG n 1 41 VAL n 1 42 TYR n 1 43 VAL n 1 44 GLU n 1 45 GLU n 1 46 LEU n 1 47 LYS n 1 48 PRO n 1 49 THR n 1 50 PRO n 1 51 GLU n 1 52 GLY n 1 53 ASP n 1 54 LEU n 1 55 GLU n 1 56 ILE n 1 57 LEU n 1 58 LEU n 1 59 GLN n 1 60 LYS n 1 61 TRP n 1 62 GLU n 1 63 ASN n 1 64 ASP n 1 65 GLU n 1 66 CYS n 1 67 ALA n 1 68 GLN n 1 69 LYS n 1 70 LYS n 1 71 ILE n 1 72 ILE n 1 73 ALA n 1 74 GLU n 1 75 LYS n 1 76 THR n 1 77 LYS n 1 78 ILE n 1 79 PRO n 1 80 ALA n 1 81 VAL n 1 82 PHE n 1 83 LYS n 1 84 ILE n 1 85 ASP n 1 86 ALA n 1 87 LEU n 1 88 ASN n 1 89 GLU n 1 90 ASN n 1 91 LYS n 1 92 VAL n 1 93 LEU n 1 94 VAL n 1 95 LEU n 1 96 ASP n 1 97 THR n 1 98 ASP n 1 99 TYR n 1 100 LYS n 1 101 LYS n 1 102 TYR n 1 103 LEU n 1 104 LEU n 1 105 PHE n 1 106 CYS n 1 107 MET n 1 108 GLU n 1 109 ASN n 1 110 SER n 1 111 ALA n 1 112 GLU n 1 113 PRO n 1 114 GLU n 1 115 GLN n 1 116 SER n 1 117 LEU n 1 118 VAL n 1 119 CYS n 1 120 GLN n 1 121 CYS n 1 122 LEU n 1 123 VAL n 1 124 ARG n 1 125 THR n 1 126 PRO n 1 127 GLU n 1 128 VAL n 1 129 ASP n 1 130 ASP n 1 131 GLU n 1 132 ALA n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 PHE n 1 137 ASP n 1 138 LYS n 1 139 ALA n 1 140 LEU n 1 141 LYS n 1 142 ALA n 1 143 LEU n 1 144 PRO n 1 145 MET n 1 146 HIS n 1 147 ILE n 1 148 ARG n 1 149 LEU n 1 150 SER n 1 151 PHE n 1 152 ASN n 1 153 PRO n 1 154 THR n 1 155 GLN n 1 156 LEU n 1 157 GLU n 1 158 GLU n 1 159 GLN n 1 160 CYS n 1 161 HIS n 1 162 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 162 _entity_src_gen.gene_src_common_name Bovine _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Bos taurus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9913 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0TX non-polymer . '(4S)-N~4~-(7-chloroquinolin-4-yl)-N~1~,N~1~-diethylpentane-1,4-diamine' ? 'C18 H26 Cl N3' 319.872 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ILE 162 162 162 ILE ILE A . n B 1 1 LEU 1 1 1 LEU LEU B . n B 1 2 ILE 2 2 2 ILE ILE B . n B 1 3 VAL 3 3 3 VAL VAL B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 GLN 5 5 5 GLN GLN B . n B 1 6 THR 6 6 6 THR THR B . n B 1 7 MET 7 7 7 MET MET B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 GLY 9 9 9 GLY GLY B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 GLN 13 13 13 GLN GLN B . n B 1 14 LYS 14 14 14 LYS LYS B . n B 1 15 VAL 15 15 15 VAL VAL B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 GLY 17 17 17 GLY GLY B . n B 1 18 THR 18 18 18 THR THR B . n B 1 19 TRP 19 19 19 TRP TRP B . n B 1 20 TYR 20 20 20 TYR TYR B . n B 1 21 SER 21 21 21 SER SER B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 MET 24 24 24 MET MET B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 SER 27 27 27 SER SER B . n B 1 28 ASP 28 28 28 ASP ASP B . n B 1 29 ILE 29 29 29 ILE ILE B . n B 1 30 SER 30 30 30 SER SER B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 ASP 33 33 33 ASP ASP B . n B 1 34 ALA 34 34 34 ALA ALA B . n B 1 35 GLN 35 35 35 GLN GLN B . n B 1 36 SER 36 36 36 SER SER B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 PRO 38 38 38 PRO PRO B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 ARG 40 40 40 ARG ARG B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 TYR 42 42 42 TYR TYR B . n B 1 43 VAL 43 43 43 VAL VAL B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 GLU 45 45 45 GLU GLU B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 PRO 48 48 48 PRO PRO B . n B 1 49 THR 49 49 49 THR THR B . n B 1 50 PRO 50 50 50 PRO PRO B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 ASP 53 53 53 ASP ASP B . n B 1 54 LEU 54 54 54 LEU LEU B . n B 1 55 GLU 55 55 55 GLU GLU B . n B 1 56 ILE 56 56 56 ILE ILE B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 GLN 59 59 59 GLN GLN B . n B 1 60 LYS 60 60 60 LYS LYS B . n B 1 61 TRP 61 61 61 TRP TRP B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 ASN 63 63 63 ASN ASN B . n B 1 64 ASP 64 64 64 ASP ASP B . n B 1 65 GLU 65 65 65 GLU GLU B . n B 1 66 CYS 66 66 66 CYS CYS B . n B 1 67 ALA 67 67 67 ALA ALA B . n B 1 68 GLN 68 68 68 GLN GLN B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 ILE 71 71 71 ILE ILE B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 ALA 73 73 73 ALA ALA B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 LYS 75 75 75 LYS LYS B . n B 1 76 THR 76 76 76 THR THR B . n B 1 77 LYS 77 77 77 LYS LYS B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 PRO 79 79 79 PRO PRO B . n B 1 80 ALA 80 80 80 ALA ALA B . n B 1 81 VAL 81 81 81 VAL VAL B . n B 1 82 PHE 82 82 82 PHE PHE B . n B 1 83 LYS 83 83 83 LYS LYS B . n B 1 84 ILE 84 84 84 ILE ILE B . n B 1 85 ASP 85 85 85 ASP ASP B . n B 1 86 ALA 86 86 86 ALA ALA B . n B 1 87 LEU 87 87 87 LEU LEU B . n B 1 88 ASN 88 88 88 ASN ASN B . n B 1 89 GLU 89 89 89 GLU GLU B . n B 1 90 ASN 90 90 90 ASN ASN B . n B 1 91 LYS 91 91 91 LYS LYS B . n B 1 92 VAL 92 92 92 VAL VAL B . n B 1 93 LEU 93 93 93 LEU LEU B . n B 1 94 VAL 94 94 94 VAL VAL B . n B 1 95 LEU 95 95 95 LEU LEU B . n B 1 96 ASP 96 96 96 ASP ASP B . n B 1 97 THR 97 97 97 THR THR B . n B 1 98 ASP 98 98 98 ASP ASP B . n B 1 99 TYR 99 99 99 TYR TYR B . n B 1 100 LYS 100 100 100 LYS LYS B . n B 1 101 LYS 101 101 101 LYS LYS B . n B 1 102 TYR 102 102 102 TYR TYR B . n B 1 103 LEU 103 103 103 LEU LEU B . n B 1 104 LEU 104 104 104 LEU LEU B . n B 1 105 PHE 105 105 105 PHE PHE B . n B 1 106 CYS 106 106 106 CYS CYS B . n B 1 107 MET 107 107 107 MET MET B . n B 1 108 GLU 108 108 108 GLU GLU B . n B 1 109 ASN 109 109 109 ASN ASN B . n B 1 110 SER 110 110 110 SER SER B . n B 1 111 ALA 111 111 111 ALA ALA B . n B 1 112 GLU 112 112 112 GLU GLU B . n B 1 113 PRO 113 113 113 PRO PRO B . n B 1 114 GLU 114 114 114 GLU GLU B . n B 1 115 GLN 115 115 115 GLN GLN B . n B 1 116 SER 116 116 116 SER SER B . n B 1 117 LEU 117 117 117 LEU LEU B . n B 1 118 VAL 118 118 118 VAL VAL B . n B 1 119 CYS 119 119 119 CYS CYS B . n B 1 120 GLN 120 120 120 GLN GLN B . n B 1 121 CYS 121 121 121 CYS CYS B . n B 1 122 LEU 122 122 122 LEU LEU B . n B 1 123 VAL 123 123 123 VAL VAL B . n B 1 124 ARG 124 124 124 ARG ARG B . n B 1 125 THR 125 125 125 THR THR B . n B 1 126 PRO 126 126 126 PRO PRO B . n B 1 127 GLU 127 127 127 GLU GLU B . n B 1 128 VAL 128 128 128 VAL VAL B . n B 1 129 ASP 129 129 129 ASP ASP B . n B 1 130 ASP 130 130 130 ASP ASP B . n B 1 131 GLU 131 131 131 GLU GLU B . n B 1 132 ALA 132 132 132 ALA ALA B . n B 1 133 LEU 133 133 133 LEU LEU B . n B 1 134 GLU 134 134 134 GLU GLU B . n B 1 135 LYS 135 135 135 LYS LYS B . n B 1 136 PHE 136 136 136 PHE PHE B . n B 1 137 ASP 137 137 137 ASP ASP B . n B 1 138 LYS 138 138 138 LYS LYS B . n B 1 139 ALA 139 139 139 ALA ALA B . n B 1 140 LEU 140 140 140 LEU LEU B . n B 1 141 LYS 141 141 141 LYS LYS B . n B 1 142 ALA 142 142 142 ALA ALA B . n B 1 143 LEU 143 143 143 LEU LEU B . n B 1 144 PRO 144 144 144 PRO PRO B . n B 1 145 MET 145 145 145 MET MET B . n B 1 146 HIS 146 146 146 HIS HIS B . n B 1 147 ILE 147 147 147 ILE ILE B . n B 1 148 ARG 148 148 148 ARG ARG B . n B 1 149 LEU 149 149 149 LEU LEU B . n B 1 150 SER 150 150 150 SER SER B . n B 1 151 PHE 151 151 151 PHE PHE B . n B 1 152 ASN 152 152 152 ASN ASN B . n B 1 153 PRO 153 153 153 PRO PRO B . n B 1 154 THR 154 154 154 THR THR B . n B 1 155 GLN 155 155 155 GLN GLN B . n B 1 156 LEU 156 156 156 LEU LEU B . n B 1 157 GLU 157 157 157 GLU GLU B . n B 1 158 GLU 158 158 158 GLU GLU B . n B 1 159 GLN 159 159 159 GLN GLN B . n B 1 160 CYS 160 160 160 CYS CYS B . n B 1 161 HIS 161 161 161 HIS HIS B . n B 1 162 ILE 162 162 162 ILE ILE B . n C 1 1 LEU 1 1 1 LEU LEU C . n C 1 2 ILE 2 2 2 ILE ILE C . n C 1 3 VAL 3 3 3 VAL VAL C . n C 1 4 THR 4 4 4 THR THR C . n C 1 5 GLN 5 5 5 GLN GLN C . n C 1 6 THR 6 6 6 THR THR C . n C 1 7 MET 7 7 7 MET MET C . n C 1 8 LYS 8 8 8 LYS LYS C . n C 1 9 GLY 9 9 9 GLY GLY C . n C 1 10 LEU 10 10 10 LEU LEU C . n C 1 11 ASP 11 11 11 ASP ASP C . n C 1 12 ILE 12 12 12 ILE ILE C . n C 1 13 GLN 13 13 13 GLN GLN C . n C 1 14 LYS 14 14 14 LYS LYS C . n C 1 15 VAL 15 15 15 VAL VAL C . n C 1 16 ALA 16 16 16 ALA ALA C . n C 1 17 GLY 17 17 17 GLY GLY C . n C 1 18 THR 18 18 18 THR THR C . n C 1 19 TRP 19 19 19 TRP TRP C . n C 1 20 TYR 20 20 20 TYR TYR C . n C 1 21 SER 21 21 21 SER SER C . n C 1 22 LEU 22 22 22 LEU LEU C . n C 1 23 ALA 23 23 23 ALA ALA C . n C 1 24 MET 24 24 24 MET MET C . n C 1 25 ALA 25 25 25 ALA ALA C . n C 1 26 ALA 26 26 26 ALA ALA C . n C 1 27 SER 27 27 27 SER SER C . n C 1 28 ASP 28 28 28 ASP ASP C . n C 1 29 ILE 29 29 29 ILE ILE C . n C 1 30 SER 30 30 30 SER SER C . n C 1 31 LEU 31 31 31 LEU LEU C . n C 1 32 LEU 32 32 32 LEU LEU C . n C 1 33 ASP 33 33 33 ASP ASP C . n C 1 34 ALA 34 34 34 ALA ALA C . n C 1 35 GLN 35 35 35 GLN GLN C . n C 1 36 SER 36 36 36 SER SER C . n C 1 37 ALA 37 37 37 ALA ALA C . n C 1 38 PRO 38 38 38 PRO PRO C . n C 1 39 LEU 39 39 39 LEU LEU C . n C 1 40 ARG 40 40 40 ARG ARG C . n C 1 41 VAL 41 41 41 VAL VAL C . n C 1 42 TYR 42 42 42 TYR TYR C . n C 1 43 VAL 43 43 43 VAL VAL C . n C 1 44 GLU 44 44 44 GLU GLU C . n C 1 45 GLU 45 45 45 GLU GLU C . n C 1 46 LEU 46 46 46 LEU LEU C . n C 1 47 LYS 47 47 47 LYS LYS C . n C 1 48 PRO 48 48 48 PRO PRO C . n C 1 49 THR 49 49 49 THR THR C . n C 1 50 PRO 50 50 50 PRO PRO C . n C 1 51 GLU 51 51 51 GLU GLU C . n C 1 52 GLY 52 52 52 GLY GLY C . n C 1 53 ASP 53 53 53 ASP ASP C . n C 1 54 LEU 54 54 54 LEU LEU C . n C 1 55 GLU 55 55 55 GLU GLU C . n C 1 56 ILE 56 56 56 ILE ILE C . n C 1 57 LEU 57 57 57 LEU LEU C . n C 1 58 LEU 58 58 58 LEU LEU C . n C 1 59 GLN 59 59 59 GLN GLN C . n C 1 60 LYS 60 60 60 LYS LYS C . n C 1 61 TRP 61 61 61 TRP TRP C . n C 1 62 GLU 62 62 62 GLU GLU C . n C 1 63 ASN 63 63 63 ASN ASN C . n C 1 64 ASP 64 64 64 ASP ASP C . n C 1 65 GLU 65 65 65 GLU GLU C . n C 1 66 CYS 66 66 66 CYS CYS C . n C 1 67 ALA 67 67 67 ALA ALA C . n C 1 68 GLN 68 68 68 GLN GLN C . n C 1 69 LYS 69 69 69 LYS LYS C . n C 1 70 LYS 70 70 70 LYS LYS C . n C 1 71 ILE 71 71 71 ILE ILE C . n C 1 72 ILE 72 72 72 ILE ILE C . n C 1 73 ALA 73 73 73 ALA ALA C . n C 1 74 GLU 74 74 74 GLU GLU C . n C 1 75 LYS 75 75 75 LYS LYS C . n C 1 76 THR 76 76 76 THR THR C . n C 1 77 LYS 77 77 77 LYS LYS C . n C 1 78 ILE 78 78 78 ILE ILE C . n C 1 79 PRO 79 79 79 PRO PRO C . n C 1 80 ALA 80 80 80 ALA ALA C . n C 1 81 VAL 81 81 81 VAL VAL C . n C 1 82 PHE 82 82 82 PHE PHE C . n C 1 83 LYS 83 83 83 LYS LYS C . n C 1 84 ILE 84 84 84 ILE ILE C . n C 1 85 ASP 85 85 85 ASP ASP C . n C 1 86 ALA 86 86 86 ALA ALA C . n C 1 87 LEU 87 87 87 LEU LEU C . n C 1 88 ASN 88 88 88 ASN ASN C . n C 1 89 GLU 89 89 89 GLU GLU C . n C 1 90 ASN 90 90 90 ASN ASN C . n C 1 91 LYS 91 91 91 LYS LYS C . n C 1 92 VAL 92 92 92 VAL VAL C . n C 1 93 LEU 93 93 93 LEU LEU C . n C 1 94 VAL 94 94 94 VAL VAL C . n C 1 95 LEU 95 95 95 LEU LEU C . n C 1 96 ASP 96 96 96 ASP ASP C . n C 1 97 THR 97 97 97 THR THR C . n C 1 98 ASP 98 98 98 ASP ASP C . n C 1 99 TYR 99 99 99 TYR TYR C . n C 1 100 LYS 100 100 100 LYS LYS C . n C 1 101 LYS 101 101 101 LYS LYS C . n C 1 102 TYR 102 102 102 TYR TYR C . n C 1 103 LEU 103 103 103 LEU LEU C . n C 1 104 LEU 104 104 104 LEU LEU C . n C 1 105 PHE 105 105 105 PHE PHE C . n C 1 106 CYS 106 106 106 CYS CYS C . n C 1 107 MET 107 107 107 MET MET C . n C 1 108 GLU 108 108 108 GLU GLU C . n C 1 109 ASN 109 109 109 ASN ASN C . n C 1 110 SER 110 110 110 SER SER C . n C 1 111 ALA 111 111 111 ALA ALA C . n C 1 112 GLU 112 112 112 GLU GLU C . n C 1 113 PRO 113 113 113 PRO PRO C . n C 1 114 GLU 114 114 114 GLU GLU C . n C 1 115 GLN 115 115 115 GLN GLN C . n C 1 116 SER 116 116 116 SER SER C . n C 1 117 LEU 117 117 117 LEU LEU C . n C 1 118 VAL 118 118 118 VAL VAL C . n C 1 119 CYS 119 119 119 CYS CYS C . n C 1 120 GLN 120 120 120 GLN GLN C . n C 1 121 CYS 121 121 121 CYS CYS C . n C 1 122 LEU 122 122 122 LEU LEU C . n C 1 123 VAL 123 123 123 VAL VAL C . n C 1 124 ARG 124 124 124 ARG ARG C . n C 1 125 THR 125 125 125 THR THR C . n C 1 126 PRO 126 126 126 PRO PRO C . n C 1 127 GLU 127 127 127 GLU GLU C . n C 1 128 VAL 128 128 128 VAL VAL C . n C 1 129 ASP 129 129 129 ASP ASP C . n C 1 130 ASP 130 130 130 ASP ASP C . n C 1 131 GLU 131 131 131 GLU GLU C . n C 1 132 ALA 132 132 132 ALA ALA C . n C 1 133 LEU 133 133 133 LEU LEU C . n C 1 134 GLU 134 134 134 GLU GLU C . n C 1 135 LYS 135 135 135 LYS LYS C . n C 1 136 PHE 136 136 136 PHE PHE C . n C 1 137 ASP 137 137 137 ASP ASP C . n C 1 138 LYS 138 138 138 LYS LYS C . n C 1 139 ALA 139 139 139 ALA ALA C . n C 1 140 LEU 140 140 140 LEU LEU C . n C 1 141 LYS 141 141 141 LYS LYS C . n C 1 142 ALA 142 142 142 ALA ALA C . n C 1 143 LEU 143 143 143 LEU LEU C . n C 1 144 PRO 144 144 144 PRO PRO C . n C 1 145 MET 145 145 145 MET MET C . n C 1 146 HIS 146 146 146 HIS HIS C . n C 1 147 ILE 147 147 147 ILE ILE C . n C 1 148 ARG 148 148 148 ARG ARG C . n C 1 149 LEU 149 149 149 LEU LEU C . n C 1 150 SER 150 150 150 SER SER C . n C 1 151 PHE 151 151 151 PHE PHE C . n C 1 152 ASN 152 152 152 ASN ASN C . n C 1 153 PRO 153 153 153 PRO PRO C . n C 1 154 THR 154 154 154 THR THR C . n C 1 155 GLN 155 155 155 GLN GLN C . n C 1 156 LEU 156 156 156 LEU LEU C . n C 1 157 GLU 157 157 157 GLU GLU C . n C 1 158 GLU 158 158 158 GLU GLU C . n C 1 159 GLN 159 159 159 GLN GLN C . n C 1 160 CYS 160 160 160 CYS CYS C . n C 1 161 HIS 161 161 161 HIS HIS C . n C 1 162 ILE 162 162 162 ILE ILE C . n D 1 1 LEU 1 1 1 LEU LEU D . n D 1 2 ILE 2 2 2 ILE ILE D . n D 1 3 VAL 3 3 3 VAL VAL D . n D 1 4 THR 4 4 4 THR THR D . n D 1 5 GLN 5 5 5 GLN GLN D . n D 1 6 THR 6 6 6 THR THR D . n D 1 7 MET 7 7 7 MET MET D . n D 1 8 LYS 8 8 8 LYS LYS D . n D 1 9 GLY 9 9 9 GLY GLY D . n D 1 10 LEU 10 10 10 LEU LEU D . n D 1 11 ASP 11 11 11 ASP ASP D . n D 1 12 ILE 12 12 12 ILE ILE D . n D 1 13 GLN 13 13 13 GLN GLN D . n D 1 14 LYS 14 14 14 LYS LYS D . n D 1 15 VAL 15 15 15 VAL VAL D . n D 1 16 ALA 16 16 16 ALA ALA D . n D 1 17 GLY 17 17 17 GLY GLY D . n D 1 18 THR 18 18 18 THR THR D . n D 1 19 TRP 19 19 19 TRP TRP D . n D 1 20 TYR 20 20 20 TYR TYR D . n D 1 21 SER 21 21 21 SER SER D . n D 1 22 LEU 22 22 22 LEU LEU D . n D 1 23 ALA 23 23 23 ALA ALA D . n D 1 24 MET 24 24 24 MET MET D . n D 1 25 ALA 25 25 25 ALA ALA D . n D 1 26 ALA 26 26 26 ALA ALA D . n D 1 27 SER 27 27 27 SER SER D . n D 1 28 ASP 28 28 28 ASP ASP D . n D 1 29 ILE 29 29 29 ILE ILE D . n D 1 30 SER 30 30 30 SER SER D . n D 1 31 LEU 31 31 31 LEU LEU D . n D 1 32 LEU 32 32 32 LEU LEU D . n D 1 33 ASP 33 33 33 ASP ASP D . n D 1 34 ALA 34 34 34 ALA ALA D . n D 1 35 GLN 35 35 35 GLN GLN D . n D 1 36 SER 36 36 36 SER SER D . n D 1 37 ALA 37 37 37 ALA ALA D . n D 1 38 PRO 38 38 38 PRO PRO D . n D 1 39 LEU 39 39 39 LEU LEU D . n D 1 40 ARG 40 40 40 ARG ARG D . n D 1 41 VAL 41 41 41 VAL VAL D . n D 1 42 TYR 42 42 42 TYR TYR D . n D 1 43 VAL 43 43 43 VAL VAL D . n D 1 44 GLU 44 44 44 GLU GLU D . n D 1 45 GLU 45 45 45 GLU GLU D . n D 1 46 LEU 46 46 46 LEU LEU D . n D 1 47 LYS 47 47 47 LYS LYS D . n D 1 48 PRO 48 48 48 PRO PRO D . n D 1 49 THR 49 49 49 THR THR D . n D 1 50 PRO 50 50 50 PRO PRO D . n D 1 51 GLU 51 51 51 GLU GLU D . n D 1 52 GLY 52 52 52 GLY GLY D . n D 1 53 ASP 53 53 53 ASP ASP D . n D 1 54 LEU 54 54 54 LEU LEU D . n D 1 55 GLU 55 55 55 GLU GLU D . n D 1 56 ILE 56 56 56 ILE ILE D . n D 1 57 LEU 57 57 57 LEU LEU D . n D 1 58 LEU 58 58 58 LEU LEU D . n D 1 59 GLN 59 59 59 GLN GLN D . n D 1 60 LYS 60 60 60 LYS LYS D . n D 1 61 TRP 61 61 61 TRP TRP D . n D 1 62 GLU 62 62 62 GLU GLU D . n D 1 63 ASN 63 63 63 ASN ASN D . n D 1 64 ASP 64 64 64 ASP ASP D . n D 1 65 GLU 65 65 65 GLU GLU D . n D 1 66 CYS 66 66 66 CYS CYS D . n D 1 67 ALA 67 67 67 ALA ALA D . n D 1 68 GLN 68 68 68 GLN GLN D . n D 1 69 LYS 69 69 69 LYS LYS D . n D 1 70 LYS 70 70 70 LYS LYS D . n D 1 71 ILE 71 71 71 ILE ILE D . n D 1 72 ILE 72 72 72 ILE ILE D . n D 1 73 ALA 73 73 73 ALA ALA D . n D 1 74 GLU 74 74 74 GLU GLU D . n D 1 75 LYS 75 75 75 LYS LYS D . n D 1 76 THR 76 76 76 THR THR D . n D 1 77 LYS 77 77 77 LYS LYS D . n D 1 78 ILE 78 78 78 ILE ILE D . n D 1 79 PRO 79 79 79 PRO PRO D . n D 1 80 ALA 80 80 80 ALA ALA D . n D 1 81 VAL 81 81 81 VAL VAL D . n D 1 82 PHE 82 82 82 PHE PHE D . n D 1 83 LYS 83 83 83 LYS LYS D . n D 1 84 ILE 84 84 84 ILE ILE D . n D 1 85 ASP 85 85 85 ASP ASP D . n D 1 86 ALA 86 86 86 ALA ALA D . n D 1 87 LEU 87 87 87 LEU LEU D . n D 1 88 ASN 88 88 88 ASN ASN D . n D 1 89 GLU 89 89 89 GLU GLU D . n D 1 90 ASN 90 90 90 ASN ASN D . n D 1 91 LYS 91 91 91 LYS LYS D . n D 1 92 VAL 92 92 92 VAL VAL D . n D 1 93 LEU 93 93 93 LEU LEU D . n D 1 94 VAL 94 94 94 VAL VAL D . n D 1 95 LEU 95 95 95 LEU LEU D . n D 1 96 ASP 96 96 96 ASP ASP D . n D 1 97 THR 97 97 97 THR THR D . n D 1 98 ASP 98 98 98 ASP ASP D . n D 1 99 TYR 99 99 99 TYR TYR D . n D 1 100 LYS 100 100 100 LYS LYS D . n D 1 101 LYS 101 101 101 LYS LYS D . n D 1 102 TYR 102 102 102 TYR TYR D . n D 1 103 LEU 103 103 103 LEU LEU D . n D 1 104 LEU 104 104 104 LEU LEU D . n D 1 105 PHE 105 105 105 PHE PHE D . n D 1 106 CYS 106 106 106 CYS CYS D . n D 1 107 MET 107 107 107 MET MET D . n D 1 108 GLU 108 108 108 GLU GLU D . n D 1 109 ASN 109 109 109 ASN ASN D . n D 1 110 SER 110 110 110 SER SER D . n D 1 111 ALA 111 111 111 ALA ALA D . n D 1 112 GLU 112 112 112 GLU GLU D . n D 1 113 PRO 113 113 113 PRO PRO D . n D 1 114 GLU 114 114 114 GLU GLU D . n D 1 115 GLN 115 115 115 GLN GLN D . n D 1 116 SER 116 116 116 SER SER D . n D 1 117 LEU 117 117 117 LEU LEU D . n D 1 118 VAL 118 118 118 VAL VAL D . n D 1 119 CYS 119 119 119 CYS CYS D . n D 1 120 GLN 120 120 120 GLN GLN D . n D 1 121 CYS 121 121 121 CYS CYS D . n D 1 122 LEU 122 122 122 LEU LEU D . n D 1 123 VAL 123 123 123 VAL VAL D . n D 1 124 ARG 124 124 124 ARG ARG D . n D 1 125 THR 125 125 125 THR THR D . n D 1 126 PRO 126 126 126 PRO PRO D . n D 1 127 GLU 127 127 127 GLU GLU D . n D 1 128 VAL 128 128 128 VAL VAL D . n D 1 129 ASP 129 129 129 ASP ASP D . n D 1 130 ASP 130 130 130 ASP ASP D . n D 1 131 GLU 131 131 131 GLU GLU D . n D 1 132 ALA 132 132 132 ALA ALA D . n D 1 133 LEU 133 133 133 LEU LEU D . n D 1 134 GLU 134 134 134 GLU GLU D . n D 1 135 LYS 135 135 135 LYS LYS D . n D 1 136 PHE 136 136 136 PHE PHE D . n D 1 137 ASP 137 137 137 ASP ASP D . n D 1 138 LYS 138 138 138 LYS LYS D . n D 1 139 ALA 139 139 139 ALA ALA D . n D 1 140 LEU 140 140 140 LEU LEU D . n D 1 141 LYS 141 141 141 LYS LYS D . n D 1 142 ALA 142 142 142 ALA ALA D . n D 1 143 LEU 143 143 143 LEU LEU D . n D 1 144 PRO 144 144 144 PRO PRO D . n D 1 145 MET 145 145 145 MET MET D . n D 1 146 HIS 146 146 146 HIS HIS D . n D 1 147 ILE 147 147 147 ILE ILE D . n D 1 148 ARG 148 148 148 ARG ARG D . n D 1 149 LEU 149 149 149 LEU LEU D . n D 1 150 SER 150 150 150 SER SER D . n D 1 151 PHE 151 151 151 PHE PHE D . n D 1 152 ASN 152 152 152 ASN ASN D . n D 1 153 PRO 153 153 153 PRO PRO D . n D 1 154 THR 154 154 154 THR THR D . n D 1 155 GLN 155 155 155 GLN GLN D . n D 1 156 LEU 156 156 156 LEU LEU D . n D 1 157 GLU 157 157 157 GLU GLU D . n D 1 158 GLU 158 158 158 GLU GLU D . n D 1 159 GLN 159 159 159 GLN GLN D . n D 1 160 CYS 160 160 160 CYS CYS D . n D 1 161 HIS 161 161 161 HIS HIS D . n D 1 162 ILE 162 162 162 ILE ILE D . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 0TX _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 0TX _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 0TX 1 201 2 0TX 0TX A . F 2 0TX 1 201 1 0TX 0TX B . G 2 0TX 1 201 4 0TX 0TX C . H 2 0TX 1 201 3 0TX 0TX D . I 3 HOH 1 301 14 HOH HOH A . I 3 HOH 2 302 19 HOH HOH A . I 3 HOH 3 303 2 HOH HOH A . I 3 HOH 4 304 20 HOH HOH A . I 3 HOH 5 305 6 HOH HOH A . I 3 HOH 6 306 5 HOH HOH A . J 3 HOH 1 301 18 HOH HOH B . J 3 HOH 2 302 8 HOH HOH B . J 3 HOH 3 303 4 HOH HOH B . J 3 HOH 4 304 22 HOH HOH B . K 3 HOH 1 301 11 HOH HOH C . K 3 HOH 2 302 23 HOH HOH C . K 3 HOH 3 303 3 HOH HOH C . K 3 HOH 4 304 21 HOH HOH C . K 3 HOH 5 305 12 HOH HOH C . K 3 HOH 6 306 9 HOH HOH C . K 3 HOH 7 307 7 HOH HOH C . K 3 HOH 8 308 17 HOH HOH C . K 3 HOH 9 309 10 HOH HOH C . K 3 HOH 10 310 16 HOH HOH C . L 3 HOH 1 301 13 HOH HOH D . L 3 HOH 2 302 1 HOH HOH D . L 3 HOH 3 303 15 HOH HOH D . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? 3.27 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? v1.10.1 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 111.740 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7ER3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 150.118 _cell.length_a_esd ? _cell.length_b 66.953 _cell.length_b_esd ? _cell.length_c 78.044 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7ER3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ER3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'EVAPORATION, RECRYSTALLIZATION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1000 mM Sodium citrate tribasic, 100 mM Tris-HCl (pH 7.0) and 200 mM Sodium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 90 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9779 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9779 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7ER3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.598 _reflns.d_resolution_low 29.5950 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21922 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.961 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.598 _reflns_shell.d_res_low 2.691 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 21922 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.961 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 195.760 _refine.B_iso_mean 66.8453 _refine.B_iso_min 14.570 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7ER3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5980 _refine.ls_d_res_low 29.5950 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21862 _refine.ls_number_reflns_R_free 1098 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.6100 _refine.ls_percent_reflns_R_free 5.0200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2514 _refine.ls_R_factor_R_free 0.3244 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2472 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5IO6 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 41.3000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5980 _refine_hist.d_res_low 29.5950 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 5359 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 648 _refine_hist.pdbx_B_iso_mean_ligand 88.57 _refine_hist.pdbx_B_iso_mean_solvent 45.97 _refine_hist.pdbx_number_atoms_protein 5144 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 192 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2652 19.072 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2652 19.072 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 2652 19.072 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 2652 19.072 ? 1 # _refine_ls_shell.R_factor_R_free 0.3957 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2865 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.d_res_high 2.5976 _refine_ls_shell.d_res_low 2.7157 _refine_ls_shell.number_reflns_R_free 117 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 2299 _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.percent_reflns_obs 87 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; 1 2 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; 1 3 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; 1 4 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? A 1 A 4 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 2 ? A 6 A 7 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 3 ? A 9 A 12 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 4 ? A 0 A 0 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 5 ? A 46 A 46 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 6 ? A 65 A 68 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 7 ? A 72 A 72 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 8 ? A 78 A 8 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 9 ? A 85 A 86 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 10 ? A 88 A 89 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 11 ? A 92 A 9 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 12 ? A 92 A 1 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 13 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 14 ? A 129 A 133 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 15 ? A 139 A 139 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 16 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 17 ? A 146 A 146 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 18 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 19 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 20 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 21 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 22 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 23 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 24 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 25 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 26 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 27 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 28 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 29 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 1 30 ? A 1 A 162 ;(chain A and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 1 ? B 1 B 4 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 2 ? B 6 B 7 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 3 ? B 9 B 12 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 4 ? B 14 B 28 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 5 ? B 0 B 0 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 6 ? B 48 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 7 ? B 46562 B 46562 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 8 ? B 62 B 68 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 9 ? B 82 B 73 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 10 ? B 76 B 76 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 11 ? B 7 B 7 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 12 ? B 88 B 86 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 13 ? B 82 B 89 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 14 ? B 90 B 99 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 15 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 16 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 17 ? B 114 B 126 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 18 ? B 142 B 145 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 19 ? B 146 B 146 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 20 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 21 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 22 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 23 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 24 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 25 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 26 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 27 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 28 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 29 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 2 30 ? B 1 B 162 ;(chain B and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 1 ? C 1 C 4 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 2 ? C 6 C 7 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 3 ? C 9 C 12 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 4 ? C 14 C 28 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 5 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 6 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 7 ? C 6562 C 6562 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 8 ? C 65 C 68 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 9 ? C 72 C 73 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 10 ? C 85 C 86 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 11 ? C 88 C 86 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 12 ? C 88 C 89 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 13 ? C 102 C 107 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 14 ? C 114 C 126 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 15 ? C 129 C 133 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 16 ? C 136 C 137 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 17 ? C 139 C 139 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 18 ? C 142 C 145 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 19 ? C 146 C 146 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 20 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 21 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 22 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 23 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 24 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 25 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 26 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 27 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 28 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 29 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 30 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 3 31 ? C 1 C 162 ;(chain C and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 1 ? D 1 D 4 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 2 ? D 6 D 7 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 3 ? D 9 D 12 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 4 ? D 0 D 0 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 5 ? D 46 D 46 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 6 ? D 65 D 68 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 7 ? D 72 D 72 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 8 ? D 78 D 8 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 9 ? D 85 D 86 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 10 ? D 88 D 89 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 11 ? D 92 D 9 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 12 ? D 92 D 1 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 13 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 14 ? D 129 D 133 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 15 ? D 139 D 139 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 16 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 17 ? D 146 D 146 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 18 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 19 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 20 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 21 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 22 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 23 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 24 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 25 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 26 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 27 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 28 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 29 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? 1 4 30 ? D 1 D 162 ;(chain D and (resseq 1:4 or resseq 6:7 or resseq 9:12 or resseq 14:28 or resseq 30:32 or resseq 34:44 or resseq 46 or resseq 48:62 or resseq 65:68 or resseq 72:73 or resseq 76 or resseq 78:82 or resseq 85:86 or resseq 88:89 or resseq 92:99 or resseq 102:107 or resseq 109:112 or resseq 114:126 or resseq 129:133 or resseq 136:137 or resseq 139 or resseq 142:145 or (resid 146 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 147 or resseq 150 or resseq 152:157 or resseq 160 or (resid 161 and (name N or name CA or name C or name O or name CB or name CG or name ND1 or name CD2 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 162)) ; ? ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7ER3 _struct.title 'Crystal structure of beta-lactoglobulin complexed with chloroquine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ER3 _struct_keywords.text 'beta-lactoglobulin, chloroquine, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B5B0D4_BOVIN _struct_ref.pdbx_db_accession B5B0D4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _struct_ref.pdbx_align_begin 17 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7ER3 A 1 ? 162 ? B5B0D4 17 ? 178 ? 1 162 2 1 7ER3 B 1 ? 162 ? B5B0D4 17 ? 178 ? 1 162 3 1 7ER3 C 1 ? 162 ? B5B0D4 17 ? 178 ? 1 162 4 1 7ER3 D 1 ? 162 ? B5B0D4 17 ? 178 ? 1 162 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E,I 2 1 B,F,J 3 1 C,G,K 4 1 D,H,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 11 ? VAL A 15 ? ASP A 11 VAL A 15 5 ? 5 HELX_P HELX_P2 AA2 ASP A 129 ? ALA A 139 ? ASP A 129 ALA A 139 1 ? 11 HELX_P HELX_P3 AA3 ASN A 152 ? GLU A 157 ? ASN A 152 GLU A 157 1 ? 6 HELX_P HELX_P4 AA4 GLU A 158 ? ILE A 162 ? GLU A 158 ILE A 162 5 ? 5 HELX_P HELX_P5 AA5 ASP B 11 ? ALA B 16 ? ASP B 11 ALA B 16 5 ? 6 HELX_P HELX_P6 AA6 ASP B 28 ? LEU B 32 ? ASP B 28 LEU B 32 5 ? 5 HELX_P HELX_P7 AA7 ASP B 129 ? ALA B 139 ? ASP B 129 ALA B 139 1 ? 11 HELX_P HELX_P8 AA8 ASN B 152 ? GLU B 158 ? ASN B 152 GLU B 158 1 ? 7 HELX_P HELX_P9 AA9 GLN B 159 ? ILE B 162 ? GLN B 159 ILE B 162 5 ? 4 HELX_P HELX_P10 AB1 ASP C 28 ? LEU C 32 ? ASP C 28 LEU C 32 5 ? 5 HELX_P HELX_P11 AB2 ASP C 129 ? LYS C 141 ? ASP C 129 LYS C 141 1 ? 13 HELX_P HELX_P12 AB3 ASN C 152 ? GLU C 158 ? ASN C 152 GLU C 158 1 ? 7 HELX_P HELX_P13 AB4 GLN C 159 ? ILE C 162 ? GLN C 159 ILE C 162 5 ? 4 HELX_P HELX_P14 AB5 ASP D 11 ? ALA D 16 ? ASP D 11 ALA D 16 5 ? 6 HELX_P HELX_P15 AB6 ASP D 28 ? LEU D 32 ? ASP D 28 LEU D 32 5 ? 5 HELX_P HELX_P16 AB7 ASP D 129 ? LEU D 140 ? ASP D 129 LEU D 140 1 ? 12 HELX_P HELX_P17 AB8 ASN D 152 ? GLU D 157 ? ASN D 152 GLU D 157 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 160 SG ? ? A CYS 66 A CYS 160 1_555 ? ? ? ? ? ? ? 2.052 ? ? disulf2 disulf ? ? A CYS 106 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 106 A CYS 119 1_555 ? ? ? ? ? ? ? 2.045 ? ? disulf3 disulf ? ? B CYS 66 SG ? ? ? 1_555 B CYS 160 SG ? ? B CYS 66 B CYS 160 1_555 ? ? ? ? ? ? ? 2.049 ? ? disulf4 disulf ? ? B CYS 106 SG ? ? ? 1_555 B CYS 119 SG ? ? B CYS 106 B CYS 119 1_555 ? ? ? ? ? ? ? 2.050 ? ? disulf5 disulf ? ? C CYS 66 SG ? ? ? 1_555 C CYS 160 SG ? ? C CYS 66 C CYS 160 1_555 ? ? ? ? ? ? ? 2.071 ? ? disulf6 disulf ? ? C CYS 106 SG ? ? ? 1_555 C CYS 119 SG ? ? C CYS 106 C CYS 119 1_555 ? ? ? ? ? ? ? 2.099 ? ? disulf7 disulf ? ? D CYS 66 SG ? ? ? 1_555 D CYS 160 SG ? ? D CYS 66 D CYS 160 1_555 ? ? ? ? ? ? ? 2.055 ? ? disulf8 disulf ? ? D CYS 106 SG ? ? ? 1_555 D CYS 119 SG ? ? D CYS 106 D CYS 119 1_555 ? ? ? ? ? ? ? 2.062 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 66 ? CYS A 160 ? CYS A 66 ? 1_555 CYS A 160 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 106 ? CYS A 119 ? CYS A 106 ? 1_555 CYS A 119 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS B 66 ? CYS B 160 ? CYS B 66 ? 1_555 CYS B 160 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS B 106 ? CYS B 119 ? CYS B 106 ? 1_555 CYS B 119 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS C 66 ? CYS C 160 ? CYS C 66 ? 1_555 CYS C 160 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS C 106 ? CYS C 119 ? CYS C 106 ? 1_555 CYS C 119 ? 1_555 SG SG . . . None 'Disulfide bridge' 7 CYS D 66 ? CYS D 160 ? CYS D 66 ? 1_555 CYS D 160 ? 1_555 SG SG . . . None 'Disulfide bridge' 8 CYS D 106 ? CYS D 119 ? CYS D 106 ? 1_555 CYS D 119 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 16 ? AA3 ? 4 ? AA4 ? 6 ? AA5 ? 4 ? AA6 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA2 9 10 ? anti-parallel AA2 10 11 ? anti-parallel AA2 11 12 ? anti-parallel AA2 12 13 ? anti-parallel AA2 13 14 ? anti-parallel AA2 14 15 ? anti-parallel AA2 15 16 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA6 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 17 ? THR A 18 ? GLY A 17 THR A 18 AA1 2 VAL A 41 ? PRO A 48 ? VAL A 41 PRO A 48 AA1 3 LEU A 54 ? TRP A 61 ? LEU A 54 TRP A 61 AA1 4 CYS A 66 ? ALA A 73 ? CYS A 66 ALA A 73 AA2 1 VAL A 81 ? PHE A 82 ? VAL A 81 PHE A 82 AA2 2 ASN A 90 ? THR A 97 ? ASN A 90 THR A 97 AA2 3 TYR A 102 ? ASN A 109 ? TYR A 102 ASN A 109 AA2 4 VAL A 118 ? VAL A 123 ? VAL A 118 VAL A 123 AA2 5 TYR A 20 ? ALA A 26 ? TYR A 20 ALA A 26 AA2 6 ILE A 147 ? SER A 150 ? ILE A 147 SER A 150 AA2 7 ILE C 147 ? SER C 150 ? ILE C 147 SER C 150 AA2 8 TYR C 20 ? ALA C 26 ? TYR C 20 ALA C 26 AA2 9 VAL C 118 ? VAL C 123 ? VAL C 118 VAL C 123 AA2 10 TYR C 102 ? ASN C 109 ? TYR C 102 ASN C 109 AA2 11 ASN C 90 ? THR C 97 ? ASN C 90 THR C 97 AA2 12 VAL C 81 ? ILE C 84 ? VAL C 81 ILE C 84 AA2 13 CYS C 66 ? LYS C 75 ? CYS C 66 LYS C 75 AA2 14 LEU C 54 ? TRP C 61 ? LEU C 54 TRP C 61 AA2 15 TYR C 42 ? PRO C 48 ? TYR C 42 PRO C 48 AA2 16 GLY C 17 ? THR C 18 ? GLY C 17 THR C 18 AA3 1 GLY B 17 ? THR B 18 ? GLY B 17 THR B 18 AA3 2 TYR B 42 ? PRO B 48 ? TYR B 42 PRO B 48 AA3 3 LEU B 54 ? TRP B 61 ? LEU B 54 TRP B 61 AA3 4 CYS B 66 ? ILE B 72 ? CYS B 66 ILE B 72 AA4 1 VAL B 81 ? ASP B 85 ? VAL B 81 ASP B 85 AA4 2 GLU B 89 ? THR B 97 ? GLU B 89 THR B 97 AA4 3 TYR B 102 ? ASN B 109 ? TYR B 102 ASN B 109 AA4 4 VAL B 118 ? VAL B 123 ? VAL B 118 VAL B 123 AA4 5 TYR B 20 ? ALA B 26 ? TYR B 20 ALA B 26 AA4 6 ILE B 147 ? SER B 150 ? ILE B 147 SER B 150 AA5 1 GLY D 17 ? THR D 18 ? GLY D 17 THR D 18 AA5 2 VAL D 41 ? PRO D 48 ? VAL D 41 PRO D 48 AA5 3 LEU D 54 ? TRP D 61 ? LEU D 54 TRP D 61 AA5 4 CYS D 66 ? ALA D 73 ? CYS D 66 ALA D 73 AA6 1 VAL D 81 ? PHE D 82 ? VAL D 81 PHE D 82 AA6 2 VAL D 92 ? THR D 97 ? VAL D 92 THR D 97 AA6 3 TYR D 102 ? MET D 107 ? TYR D 102 MET D 107 AA6 4 VAL D 118 ? VAL D 123 ? VAL D 118 VAL D 123 AA6 5 TYR D 20 ? ALA D 26 ? TYR D 20 ALA D 26 AA6 6 ILE D 147 ? SER D 150 ? ILE D 147 SER D 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 17 ? N GLY A 17 O LEU A 46 ? O LEU A 46 AA1 2 3 N GLU A 44 ? N GLU A 44 O LEU A 57 ? O LEU A 57 AA1 3 4 N ILE A 56 ? N ILE A 56 O ILE A 71 ? O ILE A 71 AA2 1 2 N PHE A 82 ? N PHE A 82 O VAL A 92 ? O VAL A 92 AA2 2 3 N ASP A 96 ? N ASP A 96 O LEU A 104 ? O LEU A 104 AA2 3 4 N LEU A 103 ? N LEU A 103 O LEU A 122 ? O LEU A 122 AA2 4 5 O CYS A 119 ? O CYS A 119 N ALA A 25 ? N ALA A 25 AA2 5 6 N MET A 24 ? N MET A 24 O LEU A 149 ? O LEU A 149 AA2 6 7 N ARG A 148 ? N ARG A 148 O ARG C 148 ? O ARG C 148 AA2 7 8 O LEU C 149 ? O LEU C 149 N MET C 24 ? N MET C 24 AA2 8 9 N TYR C 20 ? N TYR C 20 O VAL C 123 ? O VAL C 123 AA2 9 10 O LEU C 122 ? O LEU C 122 N LEU C 103 ? N LEU C 103 AA2 10 11 O CYS C 106 ? O CYS C 106 N LEU C 93 ? N LEU C 93 AA2 11 12 O VAL C 92 ? O VAL C 92 N PHE C 82 ? N PHE C 82 AA2 12 13 O LYS C 83 ? O LYS C 83 N GLU C 74 ? N GLU C 74 AA2 13 14 O LYS C 69 ? O LYS C 69 N LEU C 58 ? N LEU C 58 AA2 14 15 O GLN C 59 ? O GLN C 59 N TYR C 42 ? N TYR C 42 AA2 15 16 O LEU C 46 ? O LEU C 46 N GLY C 17 ? N GLY C 17 AA3 1 2 N GLY B 17 ? N GLY B 17 O LEU B 46 ? O LEU B 46 AA3 2 3 N TYR B 42 ? N TYR B 42 O GLN B 59 ? O GLN B 59 AA3 3 4 N ILE B 56 ? N ILE B 56 O ILE B 71 ? O ILE B 71 AA4 1 2 N PHE B 82 ? N PHE B 82 O VAL B 92 ? O VAL B 92 AA4 2 3 N ASP B 96 ? N ASP B 96 O LEU B 104 ? O LEU B 104 AA4 3 4 N LEU B 103 ? N LEU B 103 O LEU B 122 ? O LEU B 122 AA4 4 5 O VAL B 123 ? O VAL B 123 N TYR B 20 ? N TYR B 20 AA4 5 6 N MET B 24 ? N MET B 24 O LEU B 149 ? O LEU B 149 AA5 1 2 N GLY D 17 ? N GLY D 17 O LEU D 46 ? O LEU D 46 AA5 2 3 N GLU D 44 ? N GLU D 44 O LEU D 57 ? O LEU D 57 AA5 3 4 N ILE D 56 ? N ILE D 56 O ILE D 71 ? O ILE D 71 AA6 1 2 N PHE D 82 ? N PHE D 82 O VAL D 92 ? O VAL D 92 AA6 2 3 N ASP D 96 ? N ASP D 96 O LEU D 104 ? O LEU D 104 AA6 3 4 N LEU D 103 ? N LEU D 103 O LEU D 122 ? O LEU D 122 AA6 4 5 O VAL D 123 ? O VAL D 123 N TYR D 20 ? N TYR D 20 AA6 5 6 N MET D 24 ? N MET D 24 O LEU D 149 ? O LEU D 149 # _pdbx_entry_details.entry_id 7ER3 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H3 D LEU 1 ? ? OE2 D GLU 108 ? ? 1.28 2 1 HZ1 A LYS 83 ? ? O A HOH 301 ? ? 1.33 3 1 O A ASP 137 ? ? HZ2 A LYS 141 ? ? 1.33 4 1 H A THR 125 ? ? O A HOH 302 ? ? 1.37 5 1 OD1 D ASP 129 ? ? H D ALA 132 ? ? 1.37 6 1 O A SER 21 ? ? HE2 A HIS 161 ? ? 1.42 7 1 HG1 D THR 18 ? ? OE1 D GLU 45 ? ? 1.42 8 1 O A PRO 113 ? ? H A GLN 115 ? ? 1.43 9 1 H D ASN 152 ? ? OE1 D GLN 155 ? ? 1.43 10 1 OD2 A ASP 33 ? ? H A ALA 34 ? ? 1.46 11 1 OD1 C ASP 129 ? ? H C ALA 132 ? ? 1.46 12 1 HG1 A THR 97 ? ? O A TYR 102 ? ? 1.47 13 1 OE1 A GLN 35 ? ? HH A TYR 42 ? ? 1.49 14 1 HD22 A ASN 88 ? ? OD1 A ASN 109 ? ? 1.51 15 1 OD2 D ASP 28 ? ? HG D SER 30 ? ? 1.52 16 1 O D THR 125 ? ? H D GLU 127 ? ? 1.52 17 1 O D ASP 137 ? ? HZ1 D LYS 141 ? ? 1.52 18 1 H D VAL 3 ? ? OE1 D GLU 108 ? ? 1.52 19 1 O A GLN 5 ? ? HG1 A THR 6 ? ? 1.55 20 1 OD1 B ASP 28 ? ? HG B SER 30 ? ? 1.55 21 1 O A GLY 52 ? ? HZ3 A LYS 75 ? ? 1.56 22 1 HD22 B ASN 90 ? ? O B GLU 108 ? ? 1.57 23 1 OE1 C GLN 35 ? ? HH C TYR 42 ? ? 1.58 24 1 O D PRO 113 ? ? H D GLN 115 ? ? 1.58 25 1 O A ASP 96 ? ? H A LEU 104 ? ? 1.60 26 1 O A ASP 137 ? ? NZ A LYS 141 ? ? 1.77 27 1 ND2 B ASN 90 ? ? O B GLU 108 ? ? 1.81 28 1 OD2 D ASP 28 ? ? OG D SER 30 ? ? 1.91 29 1 O D ASP 137 ? ? NZ D LYS 141 ? ? 1.95 30 1 OD1 C ASP 130 ? ? O C HOH 301 ? ? 1.98 31 1 O B GLN 13 ? ? O B HOH 301 ? ? 2.00 32 1 NZ A LYS 83 ? ? O A HOH 301 ? ? 2.00 33 1 N D LEU 1 ? ? OE2 D GLU 108 ? ? 2.01 34 1 O A PRO 113 ? ? N A GLN 115 ? ? 2.02 35 1 OG C SER 27 ? ? O C GLU 114 ? ? 2.06 36 1 O C ASP 33 ? ? O C HOH 302 ? ? 2.10 37 1 OG1 A THR 125 ? ? O A HOH 302 ? ? 2.10 38 1 N A THR 125 ? ? O A HOH 302 ? ? 2.10 39 1 NE2 C GLN 59 ? ? O C HOH 303 ? ? 2.14 40 1 O A GLY 52 ? ? NZ A LYS 75 ? ? 2.14 41 1 OD1 A ASP 33 ? ? O A HOH 303 ? ? 2.14 42 1 OD1 C ASP 129 ? ? N C ALA 132 ? ? 2.15 43 1 O A SER 30 ? ? O A HOH 303 ? ? 2.18 44 1 ND2 C ASN 90 ? ? O C GLU 108 ? ? 2.18 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A CYS 106 ? ? SG A CYS 106 ? ? 1.670 1.812 -0.142 0.016 N 2 1 C A LEU 143 ? ? N A PRO 144 ? ? 1.224 1.338 -0.114 0.019 Y 3 1 CB B GLU 74 ? ? CG B GLU 74 ? ? 1.636 1.517 0.119 0.019 N 4 1 CG B GLU 74 ? ? CD B GLU 74 ? ? 1.615 1.515 0.100 0.015 N 5 1 CB B CYS 106 ? ? SG B CYS 106 ? ? 1.707 1.812 -0.105 0.016 N 6 1 C B LEU 143 ? ? N B PRO 144 ? ? 1.215 1.338 -0.123 0.019 Y 7 1 CB B CYS 160 ? ? SG B CYS 160 ? ? 1.685 1.812 -0.127 0.016 N 8 1 C C LEU 143 ? ? N C PRO 144 ? ? 1.454 1.338 0.116 0.019 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE B ARG 40 ? ? CZ B ARG 40 ? ? NH2 B ARG 40 ? ? 115.43 120.30 -4.87 0.50 N 2 1 CB C LEU 149 ? ? CG C LEU 149 ? ? CD1 C LEU 149 ? ? 99.21 111.00 -11.79 1.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? -142.39 -43.66 2 1 THR A 6 ? ? 178.95 138.21 3 1 ASP A 33 ? ? -7.23 -95.68 4 1 ASP A 53 ? ? -69.97 -177.19 5 1 GLU A 62 ? ? -136.00 -110.44 6 1 ASN A 63 ? ? -68.33 74.21 7 1 ASP A 64 ? ? 74.89 -23.04 8 1 LYS A 75 ? ? -40.94 157.26 9 1 ALA A 86 ? ? 149.48 -92.10 10 1 ASP A 96 ? ? -178.98 136.47 11 1 TYR A 99 ? ? 74.06 -34.64 12 1 LYS A 101 ? ? -111.68 -70.35 13 1 MET A 107 ? ? -161.25 107.89 14 1 GLU A 108 ? ? -117.85 -162.58 15 1 GLU A 112 ? ? -152.40 77.66 16 1 PRO A 113 ? ? -48.96 -98.11 17 1 GLU A 114 ? ? -43.64 64.97 18 1 GLN A 115 ? ? 164.31 0.62 19 1 SER A 116 ? ? -133.84 -35.33 20 1 PRO A 126 ? ? -65.54 56.24 21 1 ILE B 2 ? ? -146.97 -42.62 22 1 ILE B 12 ? ? -59.55 -8.63 23 1 ASP B 53 ? ? -64.87 -178.88 24 1 GLU B 62 ? ? -123.78 -91.63 25 1 ASN B 63 ? ? -72.59 33.81 26 1 ALA B 86 ? ? -134.24 -147.98 27 1 ASP B 96 ? ? -178.57 142.07 28 1 TYR B 99 ? ? 69.03 -57.41 29 1 LYS B 101 ? ? -129.61 -50.35 30 1 ALA B 111 ? ? -14.30 -46.63 31 1 GLU B 114 ? ? -71.40 -156.21 32 1 GLN B 115 ? ? 57.35 7.32 33 1 SER B 116 ? ? -149.37 -34.59 34 1 PRO B 126 ? ? -66.06 79.37 35 1 ARG B 148 ? ? -161.29 107.05 36 1 GLN B 159 ? ? -21.14 117.13 37 1 ILE C 2 ? ? -148.25 -44.23 38 1 ILE C 12 ? ? -59.71 -7.50 39 1 SER C 21 ? ? -68.34 99.01 40 1 GLU C 62 ? ? -106.24 -110.28 41 1 LYS C 75 ? ? -30.96 147.78 42 1 LYS C 77 ? ? -68.34 4.71 43 1 ALA C 86 ? ? 159.77 -126.37 44 1 ASP C 96 ? ? -177.38 138.00 45 1 TYR C 99 ? ? 70.62 -56.42 46 1 LYS C 101 ? ? -133.02 -61.01 47 1 MET C 107 ? ? -160.21 84.68 48 1 PRO C 113 ? ? -95.89 -87.37 49 1 SER C 116 ? ? -166.51 -12.39 50 1 PRO C 126 ? ? -67.51 71.88 51 1 VAL C 128 ? ? -64.24 93.35 52 1 GLN C 159 ? ? -20.04 133.21 53 1 CYS C 160 ? ? 38.95 25.49 54 1 ILE D 2 ? ? -145.85 -45.67 55 1 THR D 6 ? ? -172.39 134.71 56 1 ILE D 29 ? ? -17.74 -49.57 57 1 GLU D 62 ? ? -115.91 -106.36 58 1 LYS D 75 ? ? -44.71 175.10 59 1 LYS D 77 ? ? -69.13 -70.81 60 1 ALA D 86 ? ? 123.94 -90.91 61 1 LEU D 87 ? ? -145.61 30.78 62 1 ASP D 96 ? ? 174.32 141.21 63 1 TYR D 99 ? ? 73.77 -37.91 64 1 LYS D 101 ? ? -121.41 -68.94 65 1 MET D 107 ? ? -161.03 97.71 66 1 PRO D 113 ? ? -93.92 -80.34 67 1 GLU D 114 ? ? -54.21 65.33 68 1 GLN D 115 ? ? 165.53 -0.68 69 1 SER D 116 ? ? -133.58 -36.93 70 1 PRO D 126 ? ? -62.44 61.72 71 1 CYS D 160 ? ? 71.08 33.68 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LYS A 91 ? ? VAL A 92 ? ? 143.46 2 1 ASP B 64 ? ? GLU B 65 ? ? 148.34 3 1 LEU D 87 ? ? ASN D 88 ? ? 142.91 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0TX CL CL N N 1 0TX N1 N Y N 2 0TX C1 C Y N 3 0TX C2 C Y N 4 0TX C3 C Y N 5 0TX C4 C Y N 6 0TX C5 C Y N 7 0TX C6 C Y N 8 0TX C7 C Y N 9 0TX C8 C Y N 10 0TX C9 C Y N 11 0TX N2 N N N 12 0TX C10 C N S 13 0TX C11 C N N 14 0TX C12 C N N 15 0TX C13 C N N 16 0TX N3 N N N 17 0TX C14 C N N 18 0TX C15 C N N 19 0TX C16 C N N 20 0TX C17 C N N 21 0TX C18 C N N 22 0TX H11 H N N 23 0TX H21 H N N 24 0TX H51 H N N 25 0TX H61 H N N 26 0TX H81 H N N 27 0TX HN21 H N N 28 0TX H101 H N N 29 0TX H112 H N N 30 0TX H111 H N N 31 0TX H121 H N N 32 0TX H122 H N N 33 0TX H132 H N N 34 0TX H131 H N N 35 0TX H142 H N N 36 0TX H141 H N N 37 0TX H151 H N N 38 0TX H153 H N N 39 0TX H152 H N N 40 0TX H162 H N N 41 0TX H161 H N N 42 0TX H171 H N N 43 0TX H172 H N N 44 0TX H173 H N N 45 0TX H182 H N N 46 0TX H181 H N N 47 0TX H183 H N N 48 ALA N N N N 49 ALA CA C N S 50 ALA C C N N 51 ALA O O N N 52 ALA CB C N N 53 ALA OXT O N N 54 ALA H H N N 55 ALA H2 H N N 56 ALA HA H N N 57 ALA HB1 H N N 58 ALA HB2 H N N 59 ALA HB3 H N N 60 ALA HXT H N N 61 ARG N N N N 62 ARG CA C N S 63 ARG C C N N 64 ARG O O N N 65 ARG CB C N N 66 ARG CG C N N 67 ARG CD C N N 68 ARG NE N N N 69 ARG CZ C N N 70 ARG NH1 N N N 71 ARG NH2 N N N 72 ARG OXT O N N 73 ARG H H N N 74 ARG H2 H N N 75 ARG HA H N N 76 ARG HB2 H N N 77 ARG HB3 H N N 78 ARG HG2 H N N 79 ARG HG3 H N N 80 ARG HD2 H N N 81 ARG HD3 H N N 82 ARG HE H N N 83 ARG HH11 H N N 84 ARG HH12 H N N 85 ARG HH21 H N N 86 ARG HH22 H N N 87 ARG HXT H N N 88 ASN N N N N 89 ASN CA C N S 90 ASN C C N N 91 ASN O O N N 92 ASN CB C N N 93 ASN CG C N N 94 ASN OD1 O N N 95 ASN ND2 N N N 96 ASN OXT O N N 97 ASN H H N N 98 ASN H2 H N N 99 ASN HA H N N 100 ASN HB2 H N N 101 ASN HB3 H N N 102 ASN HD21 H N N 103 ASN HD22 H N N 104 ASN HXT H N N 105 ASP N N N N 106 ASP CA C N S 107 ASP C C N N 108 ASP O O N N 109 ASP CB C N N 110 ASP CG C N N 111 ASP OD1 O N N 112 ASP OD2 O N N 113 ASP OXT O N N 114 ASP H H N N 115 ASP H2 H N N 116 ASP HA H N N 117 ASP HB2 H N N 118 ASP HB3 H N N 119 ASP HD2 H N N 120 ASP HXT H N N 121 CYS N N N N 122 CYS CA C N R 123 CYS C C N N 124 CYS O O N N 125 CYS CB C N N 126 CYS SG S N N 127 CYS OXT O N N 128 CYS H H N N 129 CYS H2 H N N 130 CYS HA H N N 131 CYS HB2 H N N 132 CYS HB3 H N N 133 CYS HG H N N 134 CYS HXT H N N 135 GLN N N N N 136 GLN CA C N S 137 GLN C C N N 138 GLN O O N N 139 GLN CB C N N 140 GLN CG C N N 141 GLN CD C N N 142 GLN OE1 O N N 143 GLN NE2 N N N 144 GLN OXT O N N 145 GLN H H N N 146 GLN H2 H N N 147 GLN HA H N N 148 GLN HB2 H N N 149 GLN HB3 H N N 150 GLN HG2 H N N 151 GLN HG3 H N N 152 GLN HE21 H N N 153 GLN HE22 H N N 154 GLN HXT H N N 155 GLU N N N N 156 GLU CA C N S 157 GLU C C N N 158 GLU O O N N 159 GLU CB C N N 160 GLU CG C N N 161 GLU CD C N N 162 GLU OE1 O N N 163 GLU OE2 O N N 164 GLU OXT O N N 165 GLU H H N N 166 GLU H2 H N N 167 GLU HA H N N 168 GLU HB2 H N N 169 GLU HB3 H N N 170 GLU HG2 H N N 171 GLU HG3 H N N 172 GLU HE2 H N N 173 GLU HXT H N N 174 GLY N N N N 175 GLY CA C N N 176 GLY C C N N 177 GLY O O N N 178 GLY OXT O N N 179 GLY H H N N 180 GLY H2 H N N 181 GLY HA2 H N N 182 GLY HA3 H N N 183 GLY HXT H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 HOH O O N N 206 HOH H1 H N N 207 HOH H2 H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 PHE N N N N 298 PHE CA C N S 299 PHE C C N N 300 PHE O O N N 301 PHE CB C N N 302 PHE CG C Y N 303 PHE CD1 C Y N 304 PHE CD2 C Y N 305 PHE CE1 C Y N 306 PHE CE2 C Y N 307 PHE CZ C Y N 308 PHE OXT O N N 309 PHE H H N N 310 PHE H2 H N N 311 PHE HA H N N 312 PHE HB2 H N N 313 PHE HB3 H N N 314 PHE HD1 H N N 315 PHE HD2 H N N 316 PHE HE1 H N N 317 PHE HE2 H N N 318 PHE HZ H N N 319 PHE HXT H N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 SER N N N N 338 SER CA C N S 339 SER C C N N 340 SER O O N N 341 SER CB C N N 342 SER OG O N N 343 SER OXT O N N 344 SER H H N N 345 SER H2 H N N 346 SER HA H N N 347 SER HB2 H N N 348 SER HB3 H N N 349 SER HG H N N 350 SER HXT H N N 351 THR N N N N 352 THR CA C N S 353 THR C C N N 354 THR O O N N 355 THR CB C N R 356 THR OG1 O N N 357 THR CG2 C N N 358 THR OXT O N N 359 THR H H N N 360 THR H2 H N N 361 THR HA H N N 362 THR HB H N N 363 THR HG1 H N N 364 THR HG21 H N N 365 THR HG22 H N N 366 THR HG23 H N N 367 THR HXT H N N 368 TRP N N N N 369 TRP CA C N S 370 TRP C C N N 371 TRP O O N N 372 TRP CB C N N 373 TRP CG C Y N 374 TRP CD1 C Y N 375 TRP CD2 C Y N 376 TRP NE1 N Y N 377 TRP CE2 C Y N 378 TRP CE3 C Y N 379 TRP CZ2 C Y N 380 TRP CZ3 C Y N 381 TRP CH2 C Y N 382 TRP OXT O N N 383 TRP H H N N 384 TRP H2 H N N 385 TRP HA H N N 386 TRP HB2 H N N 387 TRP HB3 H N N 388 TRP HD1 H N N 389 TRP HE1 H N N 390 TRP HE3 H N N 391 TRP HZ2 H N N 392 TRP HZ3 H N N 393 TRP HH2 H N N 394 TRP HXT H N N 395 TYR N N N N 396 TYR CA C N S 397 TYR C C N N 398 TYR O O N N 399 TYR CB C N N 400 TYR CG C Y N 401 TYR CD1 C Y N 402 TYR CD2 C Y N 403 TYR CE1 C Y N 404 TYR CE2 C Y N 405 TYR CZ C Y N 406 TYR OH O N N 407 TYR OXT O N N 408 TYR H H N N 409 TYR H2 H N N 410 TYR HA H N N 411 TYR HB2 H N N 412 TYR HB3 H N N 413 TYR HD1 H N N 414 TYR HD2 H N N 415 TYR HE1 H N N 416 TYR HE2 H N N 417 TYR HH H N N 418 TYR HXT H N N 419 VAL N N N N 420 VAL CA C N S 421 VAL C C N N 422 VAL O O N N 423 VAL CB C N N 424 VAL CG1 C N N 425 VAL CG2 C N N 426 VAL OXT O N N 427 VAL H H N N 428 VAL H2 H N N 429 VAL HA H N N 430 VAL HB H N N 431 VAL HG11 H N N 432 VAL HG12 H N N 433 VAL HG13 H N N 434 VAL HG21 H N N 435 VAL HG22 H N N 436 VAL HG23 H N N 437 VAL HXT H N N 438 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0TX C18 C10 sing N N 1 0TX C11 C10 sing N N 2 0TX C11 C12 sing N N 3 0TX N2 C10 sing N N 4 0TX N2 C3 sing N N 5 0TX C5 C6 doub Y N 6 0TX C5 C4 sing Y N 7 0TX C6 C7 sing Y N 8 0TX C3 C4 doub Y N 9 0TX C3 C2 sing Y N 10 0TX C15 C14 sing N N 11 0TX C12 C13 sing N N 12 0TX C4 C9 sing Y N 13 0TX C14 N3 sing N N 14 0TX C2 C1 doub Y N 15 0TX C7 CL sing N N 16 0TX C7 C8 doub Y N 17 0TX C13 N3 sing N N 18 0TX C9 C8 sing Y N 19 0TX C9 N1 doub Y N 20 0TX C1 N1 sing Y N 21 0TX N3 C16 sing N N 22 0TX C16 C17 sing N N 23 0TX C1 H11 sing N N 24 0TX C2 H21 sing N N 25 0TX C5 H51 sing N N 26 0TX C6 H61 sing N N 27 0TX C8 H81 sing N N 28 0TX N2 HN21 sing N N 29 0TX C10 H101 sing N N 30 0TX C11 H112 sing N N 31 0TX C11 H111 sing N N 32 0TX C12 H121 sing N N 33 0TX C12 H122 sing N N 34 0TX C13 H132 sing N N 35 0TX C13 H131 sing N N 36 0TX C14 H142 sing N N 37 0TX C14 H141 sing N N 38 0TX C15 H151 sing N N 39 0TX C15 H153 sing N N 40 0TX C15 H152 sing N N 41 0TX C16 H162 sing N N 42 0TX C16 H161 sing N N 43 0TX C17 H171 sing N N 44 0TX C17 H172 sing N N 45 0TX C17 H173 sing N N 46 0TX C18 H182 sing N N 47 0TX C18 H181 sing N N 48 0TX C18 H183 sing N N 49 ALA N CA sing N N 50 ALA N H sing N N 51 ALA N H2 sing N N 52 ALA CA C sing N N 53 ALA CA CB sing N N 54 ALA CA HA sing N N 55 ALA C O doub N N 56 ALA C OXT sing N N 57 ALA CB HB1 sing N N 58 ALA CB HB2 sing N N 59 ALA CB HB3 sing N N 60 ALA OXT HXT sing N N 61 ARG N CA sing N N 62 ARG N H sing N N 63 ARG N H2 sing N N 64 ARG CA C sing N N 65 ARG CA CB sing N N 66 ARG CA HA sing N N 67 ARG C O doub N N 68 ARG C OXT sing N N 69 ARG CB CG sing N N 70 ARG CB HB2 sing N N 71 ARG CB HB3 sing N N 72 ARG CG CD sing N N 73 ARG CG HG2 sing N N 74 ARG CG HG3 sing N N 75 ARG CD NE sing N N 76 ARG CD HD2 sing N N 77 ARG CD HD3 sing N N 78 ARG NE CZ sing N N 79 ARG NE HE sing N N 80 ARG CZ NH1 sing N N 81 ARG CZ NH2 doub N N 82 ARG NH1 HH11 sing N N 83 ARG NH1 HH12 sing N N 84 ARG NH2 HH21 sing N N 85 ARG NH2 HH22 sing N N 86 ARG OXT HXT sing N N 87 ASN N CA sing N N 88 ASN N H sing N N 89 ASN N H2 sing N N 90 ASN CA C sing N N 91 ASN CA CB sing N N 92 ASN CA HA sing N N 93 ASN C O doub N N 94 ASN C OXT sing N N 95 ASN CB CG sing N N 96 ASN CB HB2 sing N N 97 ASN CB HB3 sing N N 98 ASN CG OD1 doub N N 99 ASN CG ND2 sing N N 100 ASN ND2 HD21 sing N N 101 ASN ND2 HD22 sing N N 102 ASN OXT HXT sing N N 103 ASP N CA sing N N 104 ASP N H sing N N 105 ASP N H2 sing N N 106 ASP CA C sing N N 107 ASP CA CB sing N N 108 ASP CA HA sing N N 109 ASP C O doub N N 110 ASP C OXT sing N N 111 ASP CB CG sing N N 112 ASP CB HB2 sing N N 113 ASP CB HB3 sing N N 114 ASP CG OD1 doub N N 115 ASP CG OD2 sing N N 116 ASP OD2 HD2 sing N N 117 ASP OXT HXT sing N N 118 CYS N CA sing N N 119 CYS N H sing N N 120 CYS N H2 sing N N 121 CYS CA C sing N N 122 CYS CA CB sing N N 123 CYS CA HA sing N N 124 CYS C O doub N N 125 CYS C OXT sing N N 126 CYS CB SG sing N N 127 CYS CB HB2 sing N N 128 CYS CB HB3 sing N N 129 CYS SG HG sing N N 130 CYS OXT HXT sing N N 131 GLN N CA sing N N 132 GLN N H sing N N 133 GLN N H2 sing N N 134 GLN CA C sing N N 135 GLN CA CB sing N N 136 GLN CA HA sing N N 137 GLN C O doub N N 138 GLN C OXT sing N N 139 GLN CB CG sing N N 140 GLN CB HB2 sing N N 141 GLN CB HB3 sing N N 142 GLN CG CD sing N N 143 GLN CG HG2 sing N N 144 GLN CG HG3 sing N N 145 GLN CD OE1 doub N N 146 GLN CD NE2 sing N N 147 GLN NE2 HE21 sing N N 148 GLN NE2 HE22 sing N N 149 GLN OXT HXT sing N N 150 GLU N CA sing N N 151 GLU N H sing N N 152 GLU N H2 sing N N 153 GLU CA C sing N N 154 GLU CA CB sing N N 155 GLU CA HA sing N N 156 GLU C O doub N N 157 GLU C OXT sing N N 158 GLU CB CG sing N N 159 GLU CB HB2 sing N N 160 GLU CB HB3 sing N N 161 GLU CG CD sing N N 162 GLU CG HG2 sing N N 163 GLU CG HG3 sing N N 164 GLU CD OE1 doub N N 165 GLU CD OE2 sing N N 166 GLU OE2 HE2 sing N N 167 GLU OXT HXT sing N N 168 GLY N CA sing N N 169 GLY N H sing N N 170 GLY N H2 sing N N 171 GLY CA C sing N N 172 GLY CA HA2 sing N N 173 GLY CA HA3 sing N N 174 GLY C O doub N N 175 GLY C OXT sing N N 176 GLY OXT HXT sing N N 177 HIS N CA sing N N 178 HIS N H sing N N 179 HIS N H2 sing N N 180 HIS CA C sing N N 181 HIS CA CB sing N N 182 HIS CA HA sing N N 183 HIS C O doub N N 184 HIS C OXT sing N N 185 HIS CB CG sing N N 186 HIS CB HB2 sing N N 187 HIS CB HB3 sing N N 188 HIS CG ND1 sing Y N 189 HIS CG CD2 doub Y N 190 HIS ND1 CE1 doub Y N 191 HIS ND1 HD1 sing N N 192 HIS CD2 NE2 sing Y N 193 HIS CD2 HD2 sing N N 194 HIS CE1 NE2 sing Y N 195 HIS CE1 HE1 sing N N 196 HIS NE2 HE2 sing N N 197 HIS OXT HXT sing N N 198 HOH O H1 sing N N 199 HOH O H2 sing N N 200 ILE N CA sing N N 201 ILE N H sing N N 202 ILE N H2 sing N N 203 ILE CA C sing N N 204 ILE CA CB sing N N 205 ILE CA HA sing N N 206 ILE C O doub N N 207 ILE C OXT sing N N 208 ILE CB CG1 sing N N 209 ILE CB CG2 sing N N 210 ILE CB HB sing N N 211 ILE CG1 CD1 sing N N 212 ILE CG1 HG12 sing N N 213 ILE CG1 HG13 sing N N 214 ILE CG2 HG21 sing N N 215 ILE CG2 HG22 sing N N 216 ILE CG2 HG23 sing N N 217 ILE CD1 HD11 sing N N 218 ILE CD1 HD12 sing N N 219 ILE CD1 HD13 sing N N 220 ILE OXT HXT sing N N 221 LEU N CA sing N N 222 LEU N H sing N N 223 LEU N H2 sing N N 224 LEU CA C sing N N 225 LEU CA CB sing N N 226 LEU CA HA sing N N 227 LEU C O doub N N 228 LEU C OXT sing N N 229 LEU CB CG sing N N 230 LEU CB HB2 sing N N 231 LEU CB HB3 sing N N 232 LEU CG CD1 sing N N 233 LEU CG CD2 sing N N 234 LEU CG HG sing N N 235 LEU CD1 HD11 sing N N 236 LEU CD1 HD12 sing N N 237 LEU CD1 HD13 sing N N 238 LEU CD2 HD21 sing N N 239 LEU CD2 HD22 sing N N 240 LEU CD2 HD23 sing N N 241 LEU OXT HXT sing N N 242 LYS N CA sing N N 243 LYS N H sing N N 244 LYS N H2 sing N N 245 LYS CA C sing N N 246 LYS CA CB sing N N 247 LYS CA HA sing N N 248 LYS C O doub N N 249 LYS C OXT sing N N 250 LYS CB CG sing N N 251 LYS CB HB2 sing N N 252 LYS CB HB3 sing N N 253 LYS CG CD sing N N 254 LYS CG HG2 sing N N 255 LYS CG HG3 sing N N 256 LYS CD CE sing N N 257 LYS CD HD2 sing N N 258 LYS CD HD3 sing N N 259 LYS CE NZ sing N N 260 LYS CE HE2 sing N N 261 LYS CE HE3 sing N N 262 LYS NZ HZ1 sing N N 263 LYS NZ HZ2 sing N N 264 LYS NZ HZ3 sing N N 265 LYS OXT HXT sing N N 266 MET N CA sing N N 267 MET N H sing N N 268 MET N H2 sing N N 269 MET CA C sing N N 270 MET CA CB sing N N 271 MET CA HA sing N N 272 MET C O doub N N 273 MET C OXT sing N N 274 MET CB CG sing N N 275 MET CB HB2 sing N N 276 MET CB HB3 sing N N 277 MET CG SD sing N N 278 MET CG HG2 sing N N 279 MET CG HG3 sing N N 280 MET SD CE sing N N 281 MET CE HE1 sing N N 282 MET CE HE2 sing N N 283 MET CE HE3 sing N N 284 MET OXT HXT sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TRP N CA sing N N 355 TRP N H sing N N 356 TRP N H2 sing N N 357 TRP CA C sing N N 358 TRP CA CB sing N N 359 TRP CA HA sing N N 360 TRP C O doub N N 361 TRP C OXT sing N N 362 TRP CB CG sing N N 363 TRP CB HB2 sing N N 364 TRP CB HB3 sing N N 365 TRP CG CD1 doub Y N 366 TRP CG CD2 sing Y N 367 TRP CD1 NE1 sing Y N 368 TRP CD1 HD1 sing N N 369 TRP CD2 CE2 doub Y N 370 TRP CD2 CE3 sing Y N 371 TRP NE1 CE2 sing Y N 372 TRP NE1 HE1 sing N N 373 TRP CE2 CZ2 sing Y N 374 TRP CE3 CZ3 doub Y N 375 TRP CE3 HE3 sing N N 376 TRP CZ2 CH2 doub Y N 377 TRP CZ2 HZ2 sing N N 378 TRP CZ3 CH2 sing Y N 379 TRP CZ3 HZ3 sing N N 380 TRP CH2 HH2 sing N N 381 TRP OXT HXT sing N N 382 TYR N CA sing N N 383 TYR N H sing N N 384 TYR N H2 sing N N 385 TYR CA C sing N N 386 TYR CA CB sing N N 387 TYR CA HA sing N N 388 TYR C O doub N N 389 TYR C OXT sing N N 390 TYR CB CG sing N N 391 TYR CB HB2 sing N N 392 TYR CB HB3 sing N N 393 TYR CG CD1 doub Y N 394 TYR CG CD2 sing Y N 395 TYR CD1 CE1 sing Y N 396 TYR CD1 HD1 sing N N 397 TYR CD2 CE2 doub Y N 398 TYR CD2 HD2 sing N N 399 TYR CE1 CZ doub Y N 400 TYR CE1 HE1 sing N N 401 TYR CE2 CZ sing Y N 402 TYR CE2 HE2 sing N N 403 TYR CZ OH sing N N 404 TYR OH HH sing N N 405 TYR OXT HXT sing N N 406 VAL N CA sing N N 407 VAL N H sing N N 408 VAL N H2 sing N N 409 VAL CA C sing N N 410 VAL CA CB sing N N 411 VAL CA HA sing N N 412 VAL C O doub N N 413 VAL C OXT sing N N 414 VAL CB CG1 sing N N 415 VAL CB CG2 sing N N 416 VAL CB HB sing N N 417 VAL CG1 HG11 sing N N 418 VAL CG1 HG12 sing N N 419 VAL CG1 HG13 sing N N 420 VAL CG2 HG21 sing N N 421 VAL CG2 HG22 sing N N 422 VAL CG2 HG23 sing N N 423 VAL OXT HXT sing N N 424 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31972018 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5IO6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7ER3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006661 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002656 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014936 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013795 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL H N O S # loop_