data_7F5E # _entry.id 7F5E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7F5E pdb_00007f5e 10.2210/pdb7f5e/pdb WWPDB D_1300022908 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7F5E _pdbx_database_status.recvd_initial_deposition_date 2021-06-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lu, T.' 1 ? 'Lu, H.B.' 2 ? 'Wang, J.' 3 ? 'Lin, H.' 4 ? 'Lu, W.' 5 ? 'Luo, C.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Discovery and Optimization of Small-Molecule Inhibitors for the BPTF Bromodomains Proteins' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lu, T.' 1 ? primary 'Lu, H.B.' 2 ? primary 'Wang, J.' 3 ? primary 'Han, J.' 4 ? primary 'Xiao, S.' 5 ? primary 'Jiang, H.' 6 ? primary 'Chen, Y.' 7 ? primary 'Yang, F.' 8 ? primary 'Li, Q.' 9 ? primary 'Jiang, H.L.' 10 ? primary 'Chen, K.X.' 11 ? primary 'Lu, W.C.' 12 ? primary 'Lin, H.' 13 ? primary 'Luo, C.' 14 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 98.534 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7F5E _cell.details ? _cell.formula_units_Z ? _cell.length_a 111.448 _cell.length_a_esd ? _cell.length_b 27.157 _cell.length_b_esd ? _cell.length_c 38.697 _cell.length_c_esd ? _cell.volume 115823.326 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7F5E _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nucleosome-remodeling factor subunit BPTF' 13386.286 1 ? ? ? ? 2 non-polymer syn 'N,N-dimethyl-3-[5-(2-methylsulfonyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)indol-1-yl]propan-1-amine' 397.494 1 ? ? ? ? 3 water nat water 18.015 52 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PLGSVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKI FDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA ; _entity_poly.pdbx_seq_one_letter_code_can ;PLGSVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKI FDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 LEU n 1 3 GLY n 1 4 SER n 1 5 VAL n 1 6 LEU n 1 7 THR n 1 8 PRO n 1 9 LEU n 1 10 THR n 1 11 GLU n 1 12 LYS n 1 13 ASP n 1 14 TYR n 1 15 GLU n 1 16 GLY n 1 17 LEU n 1 18 LYS n 1 19 ARG n 1 20 VAL n 1 21 LEU n 1 22 ARG n 1 23 SER n 1 24 LEU n 1 25 GLN n 1 26 ALA n 1 27 HIS n 1 28 LYS n 1 29 MET n 1 30 ALA n 1 31 TRP n 1 32 PRO n 1 33 PHE n 1 34 LEU n 1 35 GLU n 1 36 PRO n 1 37 VAL n 1 38 ASP n 1 39 PRO n 1 40 ASN n 1 41 ASP n 1 42 ALA n 1 43 PRO n 1 44 ASP n 1 45 TYR n 1 46 TYR n 1 47 GLY n 1 48 VAL n 1 49 ILE n 1 50 LYS n 1 51 GLU n 1 52 PRO n 1 53 MET n 1 54 ASP n 1 55 LEU n 1 56 ALA n 1 57 THR n 1 58 MET n 1 59 GLU n 1 60 GLU n 1 61 ARG n 1 62 VAL n 1 63 GLN n 1 64 ARG n 1 65 ARG n 1 66 TYR n 1 67 TYR n 1 68 GLU n 1 69 LYS n 1 70 LEU n 1 71 THR n 1 72 GLU n 1 73 PHE n 1 74 VAL n 1 75 ALA n 1 76 ASP n 1 77 MET n 1 78 THR n 1 79 LYS n 1 80 ILE n 1 81 PHE n 1 82 ASP n 1 83 ASN n 1 84 CYS n 1 85 ARG n 1 86 TYR n 1 87 TYR n 1 88 ASN n 1 89 PRO n 1 90 SER n 1 91 ASP n 1 92 SER n 1 93 PRO n 1 94 PHE n 1 95 TYR n 1 96 GLN n 1 97 CYS n 1 98 ALA n 1 99 GLU n 1 100 VAL n 1 101 LEU n 1 102 GLU n 1 103 SER n 1 104 PHE n 1 105 PHE n 1 106 VAL n 1 107 GLN n 1 108 LYS n 1 109 LEU n 1 110 LYS n 1 111 GLY n 1 112 PHE n 1 113 LYS n 1 114 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 114 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BPTF _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code J3QQQ8_HUMAN _struct_ref.pdbx_db_accession J3QQQ8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNC RYYNPSDSPFYQCAEVLESFFVQKLKGFKA ; _struct_ref.pdbx_align_begin 308 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7F5E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession J3QQQ8 _struct_ref_seq.db_align_beg 308 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 417 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 65 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7F5E PRO A 1 ? UNP J3QQQ8 ? ? 'expression tag' 61 1 1 7F5E LEU A 2 ? UNP J3QQQ8 ? ? 'expression tag' 62 2 1 7F5E GLY A 3 ? UNP J3QQQ8 ? ? 'expression tag' 63 3 1 7F5E SER A 4 ? UNP J3QQQ8 ? ? 'expression tag' 64 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1IY non-polymer . 'N,N-dimethyl-3-[5-(2-methylsulfonyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)indol-1-yl]propan-1-amine' ? 'C20 H23 N5 O2 S' 397.494 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7F5E _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Lithium sulfate monohydrate, 0.1 M Tris pH 8.5, 25% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 24.5012967654 _reflns.entry_id 7F5E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 40 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5770 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.39 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs 0.099 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.099 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.108 _reflns.pdbx_Rpim_I_all 0.043 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.987 _reflns.pdbx_CC_star 0.997 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 462 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.537 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.537 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.385 _reflns_shell.pdbx_Rpim_I_all 0.162 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.902 _reflns_shell.pdbx_CC_star 0.974 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 25.1906488631 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7F5E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20017124371 _refine.ls_d_res_low 29.4517037408 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5770 _refine.ls_number_reflns_R_free 308 _refine.ls_number_reflns_R_work 5462 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.434998346 _refine.ls_percent_reflns_R_free 5.33795493934 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.191574074786 _refine.ls_R_factor_R_free 0.272618350664 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.187252262267 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33789259305 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3QZT _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.5608043314 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.306121192389 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.20017124371 _refine_hist.d_res_low 29.4517037408 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 984 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 904 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0086457747589 ? 1009 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.96722275494 ? 1380 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0460925284682 ? 139 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00496230411197 ? 176 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.1705081273 ? 622 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2002 2.7717 . . 156 2557 90.8573342264 . . . 0.304424544527 . 0.193934480071 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7717 3.5 . . 152 2905 99.9019607843 . . . 0.257293322122 . 0.184646133209 . . . . . . . . . . . # _struct.entry_id 7F5E _struct.title 'Crystal structure of BPTF-BRD with ligand DC-BPi-11 bound' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7F5E _struct_keywords.text 'BPTF Bromodomain, Lysine acetylation, small-molecule inhibitor, BIOSYNTHETIC PROTEIN, ANTITUMOR PROTEIN' _struct_keywords.pdbx_keywords 'ANTITUMOR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 10 ? HIS A 27 ? THR A 70 HIS A 87 1 ? 18 HELX_P HELX_P2 AA2 LYS A 28 ? LEU A 34 ? LYS A 88 LEU A 94 5 ? 7 HELX_P HELX_P3 AA3 ASP A 38 ? ALA A 42 ? ASP A 98 ALA A 102 5 ? 5 HELX_P HELX_P4 AA4 ASP A 44 ? ILE A 49 ? ASP A 104 ILE A 109 1 ? 6 HELX_P HELX_P5 AA5 ASP A 54 ? ARG A 64 ? ASP A 114 ARG A 124 1 ? 11 HELX_P HELX_P6 AA6 LYS A 69 ? ASN A 88 ? LYS A 129 ASN A 148 1 ? 20 HELX_P HELX_P7 AA7 SER A 92 ? LYS A 113 ? SER A 152 LYS A 173 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7F5E _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008973 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001346 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.036823 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026131 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 3.49406 27.47979 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 61 ? ? ? A . n A 1 2 LEU 2 62 ? ? ? A . n A 1 3 GLY 3 63 ? ? ? A . n A 1 4 SER 4 64 ? ? ? A . n A 1 5 VAL 5 65 ? ? ? A . n A 1 6 LEU 6 66 66 LEU LEU A . n A 1 7 THR 7 67 67 THR THR A . n A 1 8 PRO 8 68 68 PRO PRO A . n A 1 9 LEU 9 69 69 LEU LEU A . n A 1 10 THR 10 70 70 THR THR A . n A 1 11 GLU 11 71 71 GLU GLU A . n A 1 12 LYS 12 72 72 LYS LYS A . n A 1 13 ASP 13 73 73 ASP ASP A . n A 1 14 TYR 14 74 74 TYR TYR A . n A 1 15 GLU 15 75 75 GLU GLU A . n A 1 16 GLY 16 76 76 GLY GLY A . n A 1 17 LEU 17 77 77 LEU LEU A . n A 1 18 LYS 18 78 78 LYS LYS A . n A 1 19 ARG 19 79 79 ARG ARG A . n A 1 20 VAL 20 80 80 VAL VAL A . n A 1 21 LEU 21 81 81 LEU LEU A . n A 1 22 ARG 22 82 82 ARG ARG A . n A 1 23 SER 23 83 83 SER SER A . n A 1 24 LEU 24 84 84 LEU LEU A . n A 1 25 GLN 25 85 85 GLN GLN A . n A 1 26 ALA 26 86 86 ALA ALA A . n A 1 27 HIS 27 87 87 HIS HIS A . n A 1 28 LYS 28 88 88 LYS LYS A . n A 1 29 MET 29 89 89 MET MET A . n A 1 30 ALA 30 90 90 ALA ALA A . n A 1 31 TRP 31 91 91 TRP TRP A . n A 1 32 PRO 32 92 92 PRO PRO A . n A 1 33 PHE 33 93 93 PHE PHE A . n A 1 34 LEU 34 94 94 LEU LEU A . n A 1 35 GLU 35 95 95 GLU GLU A . n A 1 36 PRO 36 96 96 PRO PRO A . n A 1 37 VAL 37 97 97 VAL VAL A . n A 1 38 ASP 38 98 98 ASP ASP A . n A 1 39 PRO 39 99 99 PRO PRO A . n A 1 40 ASN 40 100 100 ASN ASN A . n A 1 41 ASP 41 101 101 ASP ASP A . n A 1 42 ALA 42 102 102 ALA ALA A . n A 1 43 PRO 43 103 103 PRO PRO A . n A 1 44 ASP 44 104 104 ASP ASP A . n A 1 45 TYR 45 105 105 TYR TYR A . n A 1 46 TYR 46 106 106 TYR TYR A . n A 1 47 GLY 47 107 107 GLY GLY A . n A 1 48 VAL 48 108 108 VAL VAL A . n A 1 49 ILE 49 109 109 ILE ILE A . n A 1 50 LYS 50 110 110 LYS LYS A . n A 1 51 GLU 51 111 111 GLU GLU A . n A 1 52 PRO 52 112 112 PRO PRO A . n A 1 53 MET 53 113 113 MET MET A . n A 1 54 ASP 54 114 114 ASP ASP A . n A 1 55 LEU 55 115 115 LEU LEU A . n A 1 56 ALA 56 116 116 ALA ALA A . n A 1 57 THR 57 117 117 THR THR A . n A 1 58 MET 58 118 118 MET MET A . n A 1 59 GLU 59 119 119 GLU GLU A . n A 1 60 GLU 60 120 120 GLU GLU A . n A 1 61 ARG 61 121 121 ARG ARG A . n A 1 62 VAL 62 122 122 VAL VAL A . n A 1 63 GLN 63 123 123 GLN GLN A . n A 1 64 ARG 64 124 124 ARG ARG A . n A 1 65 ARG 65 125 125 ARG ARG A . n A 1 66 TYR 66 126 126 TYR TYR A . n A 1 67 TYR 67 127 127 TYR TYR A . n A 1 68 GLU 68 128 128 GLU GLU A . n A 1 69 LYS 69 129 129 LYS LYS A . n A 1 70 LEU 70 130 130 LEU LEU A . n A 1 71 THR 71 131 131 THR THR A . n A 1 72 GLU 72 132 132 GLU GLU A . n A 1 73 PHE 73 133 133 PHE PHE A . n A 1 74 VAL 74 134 134 VAL VAL A . n A 1 75 ALA 75 135 135 ALA ALA A . n A 1 76 ASP 76 136 136 ASP ASP A . n A 1 77 MET 77 137 137 MET MET A . n A 1 78 THR 78 138 138 THR THR A . n A 1 79 LYS 79 139 139 LYS LYS A . n A 1 80 ILE 80 140 140 ILE ILE A . n A 1 81 PHE 81 141 141 PHE PHE A . n A 1 82 ASP 82 142 142 ASP ASP A . n A 1 83 ASN 83 143 143 ASN ASN A . n A 1 84 CYS 84 144 144 CYS CYS A . n A 1 85 ARG 85 145 145 ARG ARG A . n A 1 86 TYR 86 146 146 TYR TYR A . n A 1 87 TYR 87 147 147 TYR TYR A . n A 1 88 ASN 88 148 148 ASN ASN A . n A 1 89 PRO 89 149 149 PRO PRO A . n A 1 90 SER 90 150 150 SER SER A . n A 1 91 ASP 91 151 151 ASP ASP A . n A 1 92 SER 92 152 152 SER SER A . n A 1 93 PRO 93 153 153 PRO PRO A . n A 1 94 PHE 94 154 154 PHE PHE A . n A 1 95 TYR 95 155 155 TYR TYR A . n A 1 96 GLN 96 156 156 GLN GLN A . n A 1 97 CYS 97 157 157 CYS CYS A . n A 1 98 ALA 98 158 158 ALA ALA A . n A 1 99 GLU 99 159 159 GLU GLU A . n A 1 100 VAL 100 160 160 VAL VAL A . n A 1 101 LEU 101 161 161 LEU LEU A . n A 1 102 GLU 102 162 162 GLU GLU A . n A 1 103 SER 103 163 163 SER SER A . n A 1 104 PHE 104 164 164 PHE PHE A . n A 1 105 PHE 105 165 165 PHE PHE A . n A 1 106 VAL 106 166 166 VAL VAL A . n A 1 107 GLN 107 167 167 GLN GLN A . n A 1 108 LYS 108 168 168 LYS LYS A . n A 1 109 LEU 109 169 169 LEU LEU A . n A 1 110 LYS 110 170 170 LYS LYS A . n A 1 111 GLY 111 171 171 GLY GLY A . n A 1 112 PHE 112 172 172 PHE PHE A . n A 1 113 LYS 113 173 173 LYS LYS A . n A 1 114 ALA 114 174 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 1IY 1 201 2 1IY LIG A . C 3 HOH 1 301 20 HOH HOH A . C 3 HOH 2 302 13 HOH HOH A . C 3 HOH 3 303 42 HOH HOH A . C 3 HOH 4 304 11 HOH HOH A . C 3 HOH 5 305 7 HOH HOH A . C 3 HOH 6 306 29 HOH HOH A . C 3 HOH 7 307 12 HOH HOH A . C 3 HOH 8 308 26 HOH HOH A . C 3 HOH 9 309 10 HOH HOH A . C 3 HOH 10 310 2 HOH HOH A . C 3 HOH 11 311 37 HOH HOH A . C 3 HOH 12 312 4 HOH HOH A . C 3 HOH 13 313 6 HOH HOH A . C 3 HOH 14 314 8 HOH HOH A . C 3 HOH 15 315 45 HOH HOH A . C 3 HOH 16 316 23 HOH HOH A . C 3 HOH 17 317 31 HOH HOH A . C 3 HOH 18 318 5 HOH HOH A . C 3 HOH 19 319 48 HOH HOH A . C 3 HOH 20 320 28 HOH HOH A . C 3 HOH 21 321 16 HOH HOH A . C 3 HOH 22 322 9 HOH HOH A . C 3 HOH 23 323 51 HOH HOH A . C 3 HOH 24 324 21 HOH HOH A . C 3 HOH 25 325 19 HOH HOH A . C 3 HOH 26 326 3 HOH HOH A . C 3 HOH 27 327 18 HOH HOH A . C 3 HOH 28 328 1 HOH HOH A . C 3 HOH 29 329 38 HOH HOH A . C 3 HOH 30 330 33 HOH HOH A . C 3 HOH 31 331 53 HOH HOH A . C 3 HOH 32 332 24 HOH HOH A . C 3 HOH 33 333 34 HOH HOH A . C 3 HOH 34 334 43 HOH HOH A . C 3 HOH 35 335 44 HOH HOH A . C 3 HOH 36 336 52 HOH HOH A . C 3 HOH 37 337 22 HOH HOH A . C 3 HOH 38 338 35 HOH HOH A . C 3 HOH 39 339 36 HOH HOH A . C 3 HOH 40 340 47 HOH HOH A . C 3 HOH 41 341 50 HOH HOH A . C 3 HOH 42 342 27 HOH HOH A . C 3 HOH 43 343 17 HOH HOH A . C 3 HOH 44 344 32 HOH HOH A . C 3 HOH 45 345 46 HOH HOH A . C 3 HOH 46 346 49 HOH HOH A . C 3 HOH 47 347 41 HOH HOH A . C 3 HOH 48 348 25 HOH HOH A . C 3 HOH 49 349 14 HOH HOH A . C 3 HOH 50 350 40 HOH HOH A . C 3 HOH 51 351 39 HOH HOH A . C 3 HOH 52 352 15 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6620 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-29 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7F5E _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH1 A ARG 79 ? A O A HOH 301 ? ? 1.90 2 1 NZ A LYS 129 ? ? O A HOH 302 ? ? 1.91 3 1 NH2 A ARG 79 ? B O A HOH 303 ? ? 1.95 4 1 O A HOH 348 ? ? O A HOH 349 ? ? 2.00 5 1 O A HOH 347 ? ? O A HOH 348 ? ? 2.05 6 1 O A HOH 348 ? ? O A HOH 352 ? ? 2.11 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 328 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 340 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_546 _pdbx_validate_symm_contact.dist 1.82 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 61 ? A PRO 1 2 1 Y 1 A LEU 62 ? A LEU 2 3 1 Y 1 A GLY 63 ? A GLY 3 4 1 Y 1 A SER 64 ? A SER 4 5 1 Y 1 A VAL 65 ? A VAL 5 6 1 Y 1 A ALA 174 ? A ALA 114 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1IY C10 C Y N 1 1IY C13 C Y N 2 1IY C17 C N N 3 1IY C20 C N N 4 1IY C22 C N N 5 1IY C26 C Y N 6 1IY C01 C Y N 7 1IY C02 C Y N 8 1IY C03 C Y N 9 1IY C04 C Y N 10 1IY C05 C Y N 11 1IY C06 C Y N 12 1IY C07 C Y N 13 1IY C08 C Y N 14 1IY C12 C Y N 15 1IY C14 C Y N 16 1IY C18 C N N 17 1IY C19 C N N 18 1IY C23 C N N 19 1IY C25 C Y N 20 1IY N09 N Y N 21 1IY N11 N Y N 22 1IY N15 N Y N 23 1IY N21 N N N 24 1IY N24 N Y N 25 1IY O27 O N N 26 1IY O28 O N N 27 1IY S16 S N N 28 1IY H1 H N N 29 1IY H2 H N N 30 1IY H3 H N N 31 1IY H4 H N N 32 1IY H5 H N N 33 1IY H6 H N N 34 1IY H7 H N N 35 1IY H8 H N N 36 1IY H9 H N N 37 1IY H10 H N N 38 1IY H11 H N N 39 1IY H12 H N N 40 1IY H13 H N N 41 1IY H14 H N N 42 1IY H15 H N N 43 1IY H16 H N N 44 1IY H17 H N N 45 1IY H18 H N N 46 1IY H19 H N N 47 1IY H20 H N N 48 1IY H21 H N N 49 1IY H22 H N N 50 1IY H23 H N N 51 ALA N N N N 52 ALA CA C N S 53 ALA C C N N 54 ALA O O N N 55 ALA CB C N N 56 ALA OXT O N N 57 ALA H H N N 58 ALA H2 H N N 59 ALA HA H N N 60 ALA HB1 H N N 61 ALA HB2 H N N 62 ALA HB3 H N N 63 ALA HXT H N N 64 ARG N N N N 65 ARG CA C N S 66 ARG C C N N 67 ARG O O N N 68 ARG CB C N N 69 ARG CG C N N 70 ARG CD C N N 71 ARG NE N N N 72 ARG CZ C N N 73 ARG NH1 N N N 74 ARG NH2 N N N 75 ARG OXT O N N 76 ARG H H N N 77 ARG H2 H N N 78 ARG HA H N N 79 ARG HB2 H N N 80 ARG HB3 H N N 81 ARG HG2 H N N 82 ARG HG3 H N N 83 ARG HD2 H N N 84 ARG HD3 H N N 85 ARG HE H N N 86 ARG HH11 H N N 87 ARG HH12 H N N 88 ARG HH21 H N N 89 ARG HH22 H N N 90 ARG HXT H N N 91 ASN N N N N 92 ASN CA C N S 93 ASN C C N N 94 ASN O O N N 95 ASN CB C N N 96 ASN CG C N N 97 ASN OD1 O N N 98 ASN ND2 N N N 99 ASN OXT O N N 100 ASN H H N N 101 ASN H2 H N N 102 ASN HA H N N 103 ASN HB2 H N N 104 ASN HB3 H N N 105 ASN HD21 H N N 106 ASN HD22 H N N 107 ASN HXT H N N 108 ASP N N N N 109 ASP CA C N S 110 ASP C C N N 111 ASP O O N N 112 ASP CB C N N 113 ASP CG C N N 114 ASP OD1 O N N 115 ASP OD2 O N N 116 ASP OXT O N N 117 ASP H H N N 118 ASP H2 H N N 119 ASP HA H N N 120 ASP HB2 H N N 121 ASP HB3 H N N 122 ASP HD2 H N N 123 ASP HXT H N N 124 CYS N N N N 125 CYS CA C N R 126 CYS C C N N 127 CYS O O N N 128 CYS CB C N N 129 CYS SG S N N 130 CYS OXT O N N 131 CYS H H N N 132 CYS H2 H N N 133 CYS HA H N N 134 CYS HB2 H N N 135 CYS HB3 H N N 136 CYS HG H N N 137 CYS HXT H N N 138 GLN N N N N 139 GLN CA C N S 140 GLN C C N N 141 GLN O O N N 142 GLN CB C N N 143 GLN CG C N N 144 GLN CD C N N 145 GLN OE1 O N N 146 GLN NE2 N N N 147 GLN OXT O N N 148 GLN H H N N 149 GLN H2 H N N 150 GLN HA H N N 151 GLN HB2 H N N 152 GLN HB3 H N N 153 GLN HG2 H N N 154 GLN HG3 H N N 155 GLN HE21 H N N 156 GLN HE22 H N N 157 GLN HXT H N N 158 GLU N N N N 159 GLU CA C N S 160 GLU C C N N 161 GLU O O N N 162 GLU CB C N N 163 GLU CG C N N 164 GLU CD C N N 165 GLU OE1 O N N 166 GLU OE2 O N N 167 GLU OXT O N N 168 GLU H H N N 169 GLU H2 H N N 170 GLU HA H N N 171 GLU HB2 H N N 172 GLU HB3 H N N 173 GLU HG2 H N N 174 GLU HG3 H N N 175 GLU HE2 H N N 176 GLU HXT H N N 177 GLY N N N N 178 GLY CA C N N 179 GLY C C N N 180 GLY O O N N 181 GLY OXT O N N 182 GLY H H N N 183 GLY H2 H N N 184 GLY HA2 H N N 185 GLY HA3 H N N 186 GLY HXT H N N 187 HIS N N N N 188 HIS CA C N S 189 HIS C C N N 190 HIS O O N N 191 HIS CB C N N 192 HIS CG C Y N 193 HIS ND1 N Y N 194 HIS CD2 C Y N 195 HIS CE1 C Y N 196 HIS NE2 N Y N 197 HIS OXT O N N 198 HIS H H N N 199 HIS H2 H N N 200 HIS HA H N N 201 HIS HB2 H N N 202 HIS HB3 H N N 203 HIS HD1 H N N 204 HIS HD2 H N N 205 HIS HE1 H N N 206 HIS HE2 H N N 207 HIS HXT H N N 208 HOH O O N N 209 HOH H1 H N N 210 HOH H2 H N N 211 ILE N N N N 212 ILE CA C N S 213 ILE C C N N 214 ILE O O N N 215 ILE CB C N S 216 ILE CG1 C N N 217 ILE CG2 C N N 218 ILE CD1 C N N 219 ILE OXT O N N 220 ILE H H N N 221 ILE H2 H N N 222 ILE HA H N N 223 ILE HB H N N 224 ILE HG12 H N N 225 ILE HG13 H N N 226 ILE HG21 H N N 227 ILE HG22 H N N 228 ILE HG23 H N N 229 ILE HD11 H N N 230 ILE HD12 H N N 231 ILE HD13 H N N 232 ILE HXT H N N 233 LEU N N N N 234 LEU CA C N S 235 LEU C C N N 236 LEU O O N N 237 LEU CB C N N 238 LEU CG C N N 239 LEU CD1 C N N 240 LEU CD2 C N N 241 LEU OXT O N N 242 LEU H H N N 243 LEU H2 H N N 244 LEU HA H N N 245 LEU HB2 H N N 246 LEU HB3 H N N 247 LEU HG H N N 248 LEU HD11 H N N 249 LEU HD12 H N N 250 LEU HD13 H N N 251 LEU HD21 H N N 252 LEU HD22 H N N 253 LEU HD23 H N N 254 LEU HXT H N N 255 LYS N N N N 256 LYS CA C N S 257 LYS C C N N 258 LYS O O N N 259 LYS CB C N N 260 LYS CG C N N 261 LYS CD C N N 262 LYS CE C N N 263 LYS NZ N N N 264 LYS OXT O N N 265 LYS H H N N 266 LYS H2 H N N 267 LYS HA H N N 268 LYS HB2 H N N 269 LYS HB3 H N N 270 LYS HG2 H N N 271 LYS HG3 H N N 272 LYS HD2 H N N 273 LYS HD3 H N N 274 LYS HE2 H N N 275 LYS HE3 H N N 276 LYS HZ1 H N N 277 LYS HZ2 H N N 278 LYS HZ3 H N N 279 LYS HXT H N N 280 MET N N N N 281 MET CA C N S 282 MET C C N N 283 MET O O N N 284 MET CB C N N 285 MET CG C N N 286 MET SD S N N 287 MET CE C N N 288 MET OXT O N N 289 MET H H N N 290 MET H2 H N N 291 MET HA H N N 292 MET HB2 H N N 293 MET HB3 H N N 294 MET HG2 H N N 295 MET HG3 H N N 296 MET HE1 H N N 297 MET HE2 H N N 298 MET HE3 H N N 299 MET HXT H N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 SER N N N N 341 SER CA C N S 342 SER C C N N 343 SER O O N N 344 SER CB C N N 345 SER OG O N N 346 SER OXT O N N 347 SER H H N N 348 SER H2 H N N 349 SER HA H N N 350 SER HB2 H N N 351 SER HB3 H N N 352 SER HG H N N 353 SER HXT H N N 354 THR N N N N 355 THR CA C N S 356 THR C C N N 357 THR O O N N 358 THR CB C N R 359 THR OG1 O N N 360 THR CG2 C N N 361 THR OXT O N N 362 THR H H N N 363 THR H2 H N N 364 THR HA H N N 365 THR HB H N N 366 THR HG1 H N N 367 THR HG21 H N N 368 THR HG22 H N N 369 THR HG23 H N N 370 THR HXT H N N 371 TRP N N N N 372 TRP CA C N S 373 TRP C C N N 374 TRP O O N N 375 TRP CB C N N 376 TRP CG C Y N 377 TRP CD1 C Y N 378 TRP CD2 C Y N 379 TRP NE1 N Y N 380 TRP CE2 C Y N 381 TRP CE3 C Y N 382 TRP CZ2 C Y N 383 TRP CZ3 C Y N 384 TRP CH2 C Y N 385 TRP OXT O N N 386 TRP H H N N 387 TRP H2 H N N 388 TRP HA H N N 389 TRP HB2 H N N 390 TRP HB3 H N N 391 TRP HD1 H N N 392 TRP HE1 H N N 393 TRP HE3 H N N 394 TRP HZ2 H N N 395 TRP HZ3 H N N 396 TRP HH2 H N N 397 TRP HXT H N N 398 TYR N N N N 399 TYR CA C N S 400 TYR C C N N 401 TYR O O N N 402 TYR CB C N N 403 TYR CG C Y N 404 TYR CD1 C Y N 405 TYR CD2 C Y N 406 TYR CE1 C Y N 407 TYR CE2 C Y N 408 TYR CZ C Y N 409 TYR OH O N N 410 TYR OXT O N N 411 TYR H H N N 412 TYR H2 H N N 413 TYR HA H N N 414 TYR HB2 H N N 415 TYR HB3 H N N 416 TYR HD1 H N N 417 TYR HD2 H N N 418 TYR HE1 H N N 419 TYR HE2 H N N 420 TYR HH H N N 421 TYR HXT H N N 422 VAL N N N N 423 VAL CA C N S 424 VAL C C N N 425 VAL O O N N 426 VAL CB C N N 427 VAL CG1 C N N 428 VAL CG2 C N N 429 VAL OXT O N N 430 VAL H H N N 431 VAL H2 H N N 432 VAL HA H N N 433 VAL HB H N N 434 VAL HG11 H N N 435 VAL HG12 H N N 436 VAL HG13 H N N 437 VAL HG21 H N N 438 VAL HG22 H N N 439 VAL HG23 H N N 440 VAL HXT H N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1IY O27 S16 doub N N 1 1IY C17 S16 sing N N 2 1IY O28 S16 doub N N 3 1IY S16 C10 sing N N 4 1IY C10 N11 doub Y N 5 1IY C10 N15 sing Y N 6 1IY N11 C12 sing Y N 7 1IY N15 C14 doub Y N 8 1IY C12 N24 sing Y N 9 1IY C12 C13 doub Y N 10 1IY C14 C13 sing Y N 11 1IY C14 C02 sing N N 12 1IY N24 C25 sing Y N 13 1IY C03 C02 doub Y N 14 1IY C03 C04 sing Y N 15 1IY C13 C26 sing Y N 16 1IY C07 C04 sing Y N 17 1IY C07 C08 doub Y N 18 1IY C02 C01 sing Y N 19 1IY C04 C05 doub Y N 20 1IY C25 C26 doub Y N 21 1IY C08 N09 sing Y N 22 1IY C01 C06 doub Y N 23 1IY C05 N09 sing Y N 24 1IY C05 C06 sing Y N 25 1IY N09 C18 sing N N 26 1IY C22 N21 sing N N 27 1IY C18 C19 sing N N 28 1IY C19 C20 sing N N 29 1IY N21 C20 sing N N 30 1IY N21 C23 sing N N 31 1IY C17 H1 sing N N 32 1IY C17 H2 sing N N 33 1IY C17 H3 sing N N 34 1IY C20 H4 sing N N 35 1IY C20 H5 sing N N 36 1IY C22 H6 sing N N 37 1IY C22 H7 sing N N 38 1IY C22 H8 sing N N 39 1IY C26 H9 sing N N 40 1IY C01 H10 sing N N 41 1IY C03 H11 sing N N 42 1IY C06 H12 sing N N 43 1IY C07 H13 sing N N 44 1IY C08 H14 sing N N 45 1IY C18 H15 sing N N 46 1IY C18 H16 sing N N 47 1IY C19 H17 sing N N 48 1IY C19 H18 sing N N 49 1IY C23 H19 sing N N 50 1IY C23 H20 sing N N 51 1IY C23 H21 sing N N 52 1IY C25 H22 sing N N 53 1IY N24 H23 sing N N 54 ALA N CA sing N N 55 ALA N H sing N N 56 ALA N H2 sing N N 57 ALA CA C sing N N 58 ALA CA CB sing N N 59 ALA CA HA sing N N 60 ALA C O doub N N 61 ALA C OXT sing N N 62 ALA CB HB1 sing N N 63 ALA CB HB2 sing N N 64 ALA CB HB3 sing N N 65 ALA OXT HXT sing N N 66 ARG N CA sing N N 67 ARG N H sing N N 68 ARG N H2 sing N N 69 ARG CA C sing N N 70 ARG CA CB sing N N 71 ARG CA HA sing N N 72 ARG C O doub N N 73 ARG C OXT sing N N 74 ARG CB CG sing N N 75 ARG CB HB2 sing N N 76 ARG CB HB3 sing N N 77 ARG CG CD sing N N 78 ARG CG HG2 sing N N 79 ARG CG HG3 sing N N 80 ARG CD NE sing N N 81 ARG CD HD2 sing N N 82 ARG CD HD3 sing N N 83 ARG NE CZ sing N N 84 ARG NE HE sing N N 85 ARG CZ NH1 sing N N 86 ARG CZ NH2 doub N N 87 ARG NH1 HH11 sing N N 88 ARG NH1 HH12 sing N N 89 ARG NH2 HH21 sing N N 90 ARG NH2 HH22 sing N N 91 ARG OXT HXT sing N N 92 ASN N CA sing N N 93 ASN N H sing N N 94 ASN N H2 sing N N 95 ASN CA C sing N N 96 ASN CA CB sing N N 97 ASN CA HA sing N N 98 ASN C O doub N N 99 ASN C OXT sing N N 100 ASN CB CG sing N N 101 ASN CB HB2 sing N N 102 ASN CB HB3 sing N N 103 ASN CG OD1 doub N N 104 ASN CG ND2 sing N N 105 ASN ND2 HD21 sing N N 106 ASN ND2 HD22 sing N N 107 ASN OXT HXT sing N N 108 ASP N CA sing N N 109 ASP N H sing N N 110 ASP N H2 sing N N 111 ASP CA C sing N N 112 ASP CA CB sing N N 113 ASP CA HA sing N N 114 ASP C O doub N N 115 ASP C OXT sing N N 116 ASP CB CG sing N N 117 ASP CB HB2 sing N N 118 ASP CB HB3 sing N N 119 ASP CG OD1 doub N N 120 ASP CG OD2 sing N N 121 ASP OD2 HD2 sing N N 122 ASP OXT HXT sing N N 123 CYS N CA sing N N 124 CYS N H sing N N 125 CYS N H2 sing N N 126 CYS CA C sing N N 127 CYS CA CB sing N N 128 CYS CA HA sing N N 129 CYS C O doub N N 130 CYS C OXT sing N N 131 CYS CB SG sing N N 132 CYS CB HB2 sing N N 133 CYS CB HB3 sing N N 134 CYS SG HG sing N N 135 CYS OXT HXT sing N N 136 GLN N CA sing N N 137 GLN N H sing N N 138 GLN N H2 sing N N 139 GLN CA C sing N N 140 GLN CA CB sing N N 141 GLN CA HA sing N N 142 GLN C O doub N N 143 GLN C OXT sing N N 144 GLN CB CG sing N N 145 GLN CB HB2 sing N N 146 GLN CB HB3 sing N N 147 GLN CG CD sing N N 148 GLN CG HG2 sing N N 149 GLN CG HG3 sing N N 150 GLN CD OE1 doub N N 151 GLN CD NE2 sing N N 152 GLN NE2 HE21 sing N N 153 GLN NE2 HE22 sing N N 154 GLN OXT HXT sing N N 155 GLU N CA sing N N 156 GLU N H sing N N 157 GLU N H2 sing N N 158 GLU CA C sing N N 159 GLU CA CB sing N N 160 GLU CA HA sing N N 161 GLU C O doub N N 162 GLU C OXT sing N N 163 GLU CB CG sing N N 164 GLU CB HB2 sing N N 165 GLU CB HB3 sing N N 166 GLU CG CD sing N N 167 GLU CG HG2 sing N N 168 GLU CG HG3 sing N N 169 GLU CD OE1 doub N N 170 GLU CD OE2 sing N N 171 GLU OE2 HE2 sing N N 172 GLU OXT HXT sing N N 173 GLY N CA sing N N 174 GLY N H sing N N 175 GLY N H2 sing N N 176 GLY CA C sing N N 177 GLY CA HA2 sing N N 178 GLY CA HA3 sing N N 179 GLY C O doub N N 180 GLY C OXT sing N N 181 GLY OXT HXT sing N N 182 HIS N CA sing N N 183 HIS N H sing N N 184 HIS N H2 sing N N 185 HIS CA C sing N N 186 HIS CA CB sing N N 187 HIS CA HA sing N N 188 HIS C O doub N N 189 HIS C OXT sing N N 190 HIS CB CG sing N N 191 HIS CB HB2 sing N N 192 HIS CB HB3 sing N N 193 HIS CG ND1 sing Y N 194 HIS CG CD2 doub Y N 195 HIS ND1 CE1 doub Y N 196 HIS ND1 HD1 sing N N 197 HIS CD2 NE2 sing Y N 198 HIS CD2 HD2 sing N N 199 HIS CE1 NE2 sing Y N 200 HIS CE1 HE1 sing N N 201 HIS NE2 HE2 sing N N 202 HIS OXT HXT sing N N 203 HOH O H1 sing N N 204 HOH O H2 sing N N 205 ILE N CA sing N N 206 ILE N H sing N N 207 ILE N H2 sing N N 208 ILE CA C sing N N 209 ILE CA CB sing N N 210 ILE CA HA sing N N 211 ILE C O doub N N 212 ILE C OXT sing N N 213 ILE CB CG1 sing N N 214 ILE CB CG2 sing N N 215 ILE CB HB sing N N 216 ILE CG1 CD1 sing N N 217 ILE CG1 HG12 sing N N 218 ILE CG1 HG13 sing N N 219 ILE CG2 HG21 sing N N 220 ILE CG2 HG22 sing N N 221 ILE CG2 HG23 sing N N 222 ILE CD1 HD11 sing N N 223 ILE CD1 HD12 sing N N 224 ILE CD1 HD13 sing N N 225 ILE OXT HXT sing N N 226 LEU N CA sing N N 227 LEU N H sing N N 228 LEU N H2 sing N N 229 LEU CA C sing N N 230 LEU CA CB sing N N 231 LEU CA HA sing N N 232 LEU C O doub N N 233 LEU C OXT sing N N 234 LEU CB CG sing N N 235 LEU CB HB2 sing N N 236 LEU CB HB3 sing N N 237 LEU CG CD1 sing N N 238 LEU CG CD2 sing N N 239 LEU CG HG sing N N 240 LEU CD1 HD11 sing N N 241 LEU CD1 HD12 sing N N 242 LEU CD1 HD13 sing N N 243 LEU CD2 HD21 sing N N 244 LEU CD2 HD22 sing N N 245 LEU CD2 HD23 sing N N 246 LEU OXT HXT sing N N 247 LYS N CA sing N N 248 LYS N H sing N N 249 LYS N H2 sing N N 250 LYS CA C sing N N 251 LYS CA CB sing N N 252 LYS CA HA sing N N 253 LYS C O doub N N 254 LYS C OXT sing N N 255 LYS CB CG sing N N 256 LYS CB HB2 sing N N 257 LYS CB HB3 sing N N 258 LYS CG CD sing N N 259 LYS CG HG2 sing N N 260 LYS CG HG3 sing N N 261 LYS CD CE sing N N 262 LYS CD HD2 sing N N 263 LYS CD HD3 sing N N 264 LYS CE NZ sing N N 265 LYS CE HE2 sing N N 266 LYS CE HE3 sing N N 267 LYS NZ HZ1 sing N N 268 LYS NZ HZ2 sing N N 269 LYS NZ HZ3 sing N N 270 LYS OXT HXT sing N N 271 MET N CA sing N N 272 MET N H sing N N 273 MET N H2 sing N N 274 MET CA C sing N N 275 MET CA CB sing N N 276 MET CA HA sing N N 277 MET C O doub N N 278 MET C OXT sing N N 279 MET CB CG sing N N 280 MET CB HB2 sing N N 281 MET CB HB3 sing N N 282 MET CG SD sing N N 283 MET CG HG2 sing N N 284 MET CG HG3 sing N N 285 MET SD CE sing N N 286 MET CE HE1 sing N N 287 MET CE HE2 sing N N 288 MET CE HE3 sing N N 289 MET OXT HXT sing N N 290 PHE N CA sing N N 291 PHE N H sing N N 292 PHE N H2 sing N N 293 PHE CA C sing N N 294 PHE CA CB sing N N 295 PHE CA HA sing N N 296 PHE C O doub N N 297 PHE C OXT sing N N 298 PHE CB CG sing N N 299 PHE CB HB2 sing N N 300 PHE CB HB3 sing N N 301 PHE CG CD1 doub Y N 302 PHE CG CD2 sing Y N 303 PHE CD1 CE1 sing Y N 304 PHE CD1 HD1 sing N N 305 PHE CD2 CE2 doub Y N 306 PHE CD2 HD2 sing N N 307 PHE CE1 CZ doub Y N 308 PHE CE1 HE1 sing N N 309 PHE CE2 CZ sing Y N 310 PHE CE2 HE2 sing N N 311 PHE CZ HZ sing N N 312 PHE OXT HXT sing N N 313 PRO N CA sing N N 314 PRO N CD sing N N 315 PRO N H sing N N 316 PRO CA C sing N N 317 PRO CA CB sing N N 318 PRO CA HA sing N N 319 PRO C O doub N N 320 PRO C OXT sing N N 321 PRO CB CG sing N N 322 PRO CB HB2 sing N N 323 PRO CB HB3 sing N N 324 PRO CG CD sing N N 325 PRO CG HG2 sing N N 326 PRO CG HG3 sing N N 327 PRO CD HD2 sing N N 328 PRO CD HD3 sing N N 329 PRO OXT HXT sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 1IY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 1IY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N,N-dimethyl-3-[5-(2-methylsulfonyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl)indol-1-yl]propan-1-amine' 1IY 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3QZT _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 #