data_7F5F # _entry.id 7F5F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.353 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7F5F pdb_00007f5f 10.2210/pdb7f5f/pdb WWPDB D_1300019876 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 7F8L _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7F5F _pdbx_database_status.recvd_initial_deposition_date 2021-06-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, S.' 1 ? 'Zhou, Z.' 2 ? 'Chen, X.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Immunol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1664-3224 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 807134 _citation.page_last 807134 _citation.title ;Crystal Structures of Bat and Human Coronavirus ORF8 Protein Ig-Like Domain Provide Insights Into the Diversity of Immune Responses. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fimmu.2021.807134 _citation.pdbx_database_id_PubMed 34975921 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, X.' 1 ? primary 'Zhou, Z.' 2 ? primary 'Huang, C.' 3 ? primary 'Zhou, Z.' 4 ? primary 'Kang, S.' 5 ? primary 'Huang, Z.' 6 ? primary 'Jiang, G.' 7 ? primary 'Hong, Z.' 8 ? primary 'Chen, Q.' 9 ? primary 'Yang, M.' 10 ? primary 'He, S.' 11 ? primary 'Liu, S.' 12 ? primary 'Chen, J.' 13 ? primary 'Li, K.' 14 ? primary 'Li, X.' 15 ? primary 'Liao, J.' 16 ? primary 'Chen, J.' 17 ? primary 'Chen, S.' 18 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7F5F _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.521 _cell.length_a_esd ? _cell.length_b 50.191 _cell.length_b_esd ? _cell.length_c 80.690 _cell.length_c_esd ? _cell.volume 200555.682 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7F5F _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ORF8 protein' 11925.529 1 ? ? ? ? 2 non-polymer nat 'CALCIUM ION' 40.078 2 ? ? ? ? 3 water nat water 18.015 75 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCSPFTINCQEPKLGS LVVRCSFYEDFLEYHDVRVVLDFI ; _entity_poly.pdbx_seq_one_letter_code_can ;QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCSPFTINCQEPKLGS LVVRCSFYEDFLEYHDVRVVLDFI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 GLU n 1 3 CYS n 1 4 SER n 1 5 LEU n 1 6 GLN n 1 7 SER n 1 8 CYS n 1 9 THR n 1 10 GLN n 1 11 HIS n 1 12 GLN n 1 13 PRO n 1 14 TYR n 1 15 VAL n 1 16 VAL n 1 17 ASP n 1 18 ASP n 1 19 PRO n 1 20 CYS n 1 21 PRO n 1 22 ILE n 1 23 HIS n 1 24 PHE n 1 25 TYR n 1 26 SER n 1 27 LYS n 1 28 TRP n 1 29 TYR n 1 30 ILE n 1 31 ARG n 1 32 VAL n 1 33 GLY n 1 34 ALA n 1 35 ARG n 1 36 LYS n 1 37 SER n 1 38 ALA n 1 39 PRO n 1 40 LEU n 1 41 ILE n 1 42 GLU n 1 43 LEU n 1 44 CYS n 1 45 VAL n 1 46 ASP n 1 47 GLU n 1 48 ALA n 1 49 GLY n 1 50 SER n 1 51 LYS n 1 52 SER n 1 53 PRO n 1 54 ILE n 1 55 GLN n 1 56 TYR n 1 57 ILE n 1 58 ASP n 1 59 ILE n 1 60 GLY n 1 61 ASN n 1 62 TYR n 1 63 THR n 1 64 VAL n 1 65 SER n 1 66 CYS n 1 67 SER n 1 68 PRO n 1 69 PHE n 1 70 THR n 1 71 ILE n 1 72 ASN n 1 73 CYS n 1 74 GLN n 1 75 GLU n 1 76 PRO n 1 77 LYS n 1 78 LEU n 1 79 GLY n 1 80 SER n 1 81 LEU n 1 82 VAL n 1 83 VAL n 1 84 ARG n 1 85 CYS n 1 86 SER n 1 87 PHE n 1 88 TYR n 1 89 GLU n 1 90 ASP n 1 91 PHE n 1 92 LEU n 1 93 GLU n 1 94 TYR n 1 95 HIS n 1 96 ASP n 1 97 VAL n 1 98 ARG n 1 99 VAL n 1 100 VAL n 1 101 LEU n 1 102 ASP n 1 103 PHE n 1 104 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name '2019-nCoV, SARS-CoV-2' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'orf8, ORF8' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Severe acute respiratory syndrome coronavirus 2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2697049 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A6B9VKN0_SARS2 _struct_ref.pdbx_db_accession A0A6B9VKN0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCSPFTINCQEPKLGS LVVRCSFYEDFLEYHDVRVVLDFI ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7F5F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A6B9VKN0 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 18 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7F5F _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG6000, Citric acid' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9778 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9778 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 24.1878885817 _reflns.entry_id 7F5F _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.6195 _reflns.d_resolution_low 26.55 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13144 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 58.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.6195 _reflns_shell.d_res_low 1.62 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1300 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.872 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 30.9362368328 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7F5F _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.62 _refine.ls_d_res_low 26.5457179551 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13144 _refine.ls_number_reflns_R_free 1310 _refine.ls_number_reflns_R_work 11834 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.969577122 _refine.ls_percent_reflns_R_free 9.96652465003 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.177312115052 _refine.ls_R_factor_R_free 0.205012423921 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17426131683 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36887927139 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7jtl _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.1594548253 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.159723163904 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.62 _refine_hist.d_res_low 26.5457179551 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 903 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 826 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00557323634106 ? 852 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.835611597368 ? 1164 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0585284169917 ? 126 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00540829437478 ? 151 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.6686918905 ? 514 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.62 1.6844 . . 143 1275 100.0 . . . 0.214895885265 . 0.192539775452 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6844 1.761 . . 145 1304 100.0 . . . 0.238709617073 . 0.18189189535 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.761 1.8538 . . 143 1302 100.0 . . . 0.239141119101 . 0.188453312272 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8538 1.97 . . 143 1292 100.0 . . . 0.221511309776 . 0.181036976491 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.97 2.122 . . 146 1290 100.0 . . . 0.221652258369 . 0.179052403107 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.122 2.3354 . . 146 1319 100.0 . . . 0.234698048169 . 0.174438440827 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3354 2.6731 . . 145 1317 100.0 . . . 0.2289930676 . 0.196163381656 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6731 3.3668 . . 148 1335 99.9326145553 . . . 0.182664342042 . 0.178620868425 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8 3.3668 . . 151 1400 99.8069498069 . . . 0.188410294007 . 0.159427532044 . . . . . . . . . . . # _struct.entry_id 7F5F _struct.title 'SARS-CoV-2 ORF8 S84' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7F5F _struct_keywords.text 'SARS-CoV-2, ORF8, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 3 SG ? ? A CYS 20 A CYS 20 2_665 ? ? ? ? ? ? ? 2.036 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 73 SG ? ? A CYS 25 A CYS 90 1_555 ? ? ? ? ? ? ? 2.013 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 85 SG ? ? A CYS 37 A CYS 102 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf4 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 61 A CYS 83 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc1 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 201 A HOH 369 1_555 ? ? ? ? ? ? ? 2.912 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 67 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 84 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 68 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 85 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.14 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 3 ? CYS A 8 ? CYS A 20 CYS A 25 AA1 2 ASP A 90 ? PHE A 103 ? ASP A 107 PHE A 120 AA1 3 GLY A 79 ? PHE A 87 ? GLY A 96 PHE A 104 AA1 4 PHE A 24 ? VAL A 32 ? PHE A 41 VAL A 49 AA1 5 LEU A 40 ? GLU A 42 ? LEU A 57 GLU A 59 AA2 1 PRO A 13 ? VAL A 15 ? PRO A 30 VAL A 32 AA2 2 THR A 70 ? ASN A 72 ? THR A 87 ASN A 89 AA2 3 THR A 63 ? SER A 65 ? THR A 80 SER A 82 AA3 1 CYS A 44 ? GLU A 47 ? CYS A 61 GLU A 64 AA3 2 SER A 50 ? PRO A 53 ? SER A 67 PRO A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 4 ? N SER A 21 O ARG A 98 ? O ARG A 115 AA1 2 3 O HIS A 95 ? O HIS A 112 N CYS A 85 ? N CYS A 102 AA1 3 4 O VAL A 82 ? O VAL A 99 N TYR A 29 ? N TYR A 46 AA1 4 5 N ILE A 30 ? N ILE A 47 O ILE A 41 ? O ILE A 58 AA2 1 2 N TYR A 14 ? N TYR A 31 O ILE A 71 ? O ILE A 88 AA2 2 3 O THR A 70 ? O THR A 87 N VAL A 64 ? N VAL A 81 AA3 1 2 N GLU A 47 ? N GLU A 64 O SER A 50 ? O SER A 67 # _atom_sites.entry_id 7F5F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020193 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019924 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012393 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 18 18 GLN GLN A . n A 1 2 GLU 2 19 19 GLU GLU A . n A 1 3 CYS 3 20 20 CYS CYS A . n A 1 4 SER 4 21 21 SER SER A . n A 1 5 LEU 5 22 22 LEU LEU A . n A 1 6 GLN 6 23 23 GLN GLN A . n A 1 7 SER 7 24 24 SER SER A . n A 1 8 CYS 8 25 25 CYS CYS A . n A 1 9 THR 9 26 26 THR THR A . n A 1 10 GLN 10 27 27 GLN GLN A . n A 1 11 HIS 11 28 28 HIS HIS A . n A 1 12 GLN 12 29 29 GLN GLN A . n A 1 13 PRO 13 30 30 PRO PRO A . n A 1 14 TYR 14 31 31 TYR TYR A . n A 1 15 VAL 15 32 32 VAL VAL A . n A 1 16 VAL 16 33 33 VAL VAL A . n A 1 17 ASP 17 34 34 ASP ASP A . n A 1 18 ASP 18 35 35 ASP ASP A . n A 1 19 PRO 19 36 36 PRO PRO A . n A 1 20 CYS 20 37 37 CYS CYS A . n A 1 21 PRO 21 38 38 PRO PRO A . n A 1 22 ILE 22 39 39 ILE ILE A . n A 1 23 HIS 23 40 40 HIS HIS A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 TYR 25 42 42 TYR TYR A . n A 1 26 SER 26 43 43 SER SER A . n A 1 27 LYS 27 44 44 LYS LYS A . n A 1 28 TRP 28 45 45 TRP TRP A . n A 1 29 TYR 29 46 46 TYR TYR A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ARG 31 48 48 ARG ARG A . n A 1 32 VAL 32 49 49 VAL VAL A . n A 1 33 GLY 33 50 50 GLY GLY A . n A 1 34 ALA 34 51 51 ALA ALA A . n A 1 35 ARG 35 52 52 ARG ARG A . n A 1 36 LYS 36 53 53 LYS LYS A . n A 1 37 SER 37 54 54 SER SER A . n A 1 38 ALA 38 55 55 ALA ALA A . n A 1 39 PRO 39 56 56 PRO PRO A . n A 1 40 LEU 40 57 57 LEU LEU A . n A 1 41 ILE 41 58 58 ILE ILE A . n A 1 42 GLU 42 59 59 GLU GLU A . n A 1 43 LEU 43 60 60 LEU LEU A . n A 1 44 CYS 44 61 61 CYS CYS A . n A 1 45 VAL 45 62 62 VAL VAL A . n A 1 46 ASP 46 63 63 ASP ASP A . n A 1 47 GLU 47 64 64 GLU GLU A . n A 1 48 ALA 48 65 65 ALA ALA A . n A 1 49 GLY 49 66 66 GLY GLY A . n A 1 50 SER 50 67 67 SER SER A . n A 1 51 LYS 51 68 68 LYS LYS A . n A 1 52 SER 52 69 69 SER SER A . n A 1 53 PRO 53 70 70 PRO PRO A . n A 1 54 ILE 54 71 71 ILE ILE A . n A 1 55 GLN 55 72 72 GLN GLN A . n A 1 56 TYR 56 73 73 TYR TYR A . n A 1 57 ILE 57 74 74 ILE ILE A . n A 1 58 ASP 58 75 75 ASP ASP A . n A 1 59 ILE 59 76 76 ILE ILE A . n A 1 60 GLY 60 77 77 GLY GLY A . n A 1 61 ASN 61 78 78 ASN ASN A . n A 1 62 TYR 62 79 79 TYR TYR A . n A 1 63 THR 63 80 80 THR THR A . n A 1 64 VAL 64 81 81 VAL VAL A . n A 1 65 SER 65 82 82 SER SER A . n A 1 66 CYS 66 83 83 CYS CYS A . n A 1 67 SER 67 84 84 SER SER A . n A 1 68 PRO 68 85 85 PRO PRO A . n A 1 69 PHE 69 86 86 PHE PHE A . n A 1 70 THR 70 87 87 THR THR A . n A 1 71 ILE 71 88 88 ILE ILE A . n A 1 72 ASN 72 89 89 ASN ASN A . n A 1 73 CYS 73 90 90 CYS CYS A . n A 1 74 GLN 74 91 91 GLN GLN A . n A 1 75 GLU 75 92 92 GLU GLU A . n A 1 76 PRO 76 93 93 PRO PRO A . n A 1 77 LYS 77 94 94 LYS LYS A . n A 1 78 LEU 78 95 95 LEU LEU A . n A 1 79 GLY 79 96 96 GLY GLY A . n A 1 80 SER 80 97 97 SER SER A . n A 1 81 LEU 81 98 98 LEU LEU A . n A 1 82 VAL 82 99 99 VAL VAL A . n A 1 83 VAL 83 100 100 VAL VAL A . n A 1 84 ARG 84 101 101 ARG ARG A . n A 1 85 CYS 85 102 102 CYS CYS A . n A 1 86 SER 86 103 103 SER SER A . n A 1 87 PHE 87 104 104 PHE PHE A . n A 1 88 TYR 88 105 105 TYR TYR A . n A 1 89 GLU 89 106 106 GLU GLU A . n A 1 90 ASP 90 107 107 ASP ASP A . n A 1 91 PHE 91 108 108 PHE PHE A . n A 1 92 LEU 92 109 109 LEU LEU A . n A 1 93 GLU 93 110 110 GLU GLU A . n A 1 94 TYR 94 111 111 TYR TYR A . n A 1 95 HIS 95 112 112 HIS HIS A . n A 1 96 ASP 96 113 113 ASP ASP A . n A 1 97 VAL 97 114 114 VAL VAL A . n A 1 98 ARG 98 115 115 ARG ARG A . n A 1 99 VAL 99 116 116 VAL VAL A . n A 1 100 VAL 100 117 117 VAL VAL A . n A 1 101 LEU 101 118 118 LEU LEU A . n A 1 102 ASP 102 119 119 ASP ASP A . n A 1 103 PHE 103 120 120 PHE PHE A . n A 1 104 ILE 104 121 121 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 1 CA CA A . C 2 CA 1 202 2 CA CA A . D 3 HOH 1 301 22 HOH HOH A . D 3 HOH 2 302 53 HOH HOH A . D 3 HOH 3 303 79 HOH HOH A . D 3 HOH 4 304 13 HOH HOH A . D 3 HOH 5 305 45 HOH HOH A . D 3 HOH 6 306 74 HOH HOH A . D 3 HOH 7 307 73 HOH HOH A . D 3 HOH 8 308 18 HOH HOH A . D 3 HOH 9 309 43 HOH HOH A . D 3 HOH 10 310 33 HOH HOH A . D 3 HOH 11 311 6 HOH HOH A . D 3 HOH 12 312 2 HOH HOH A . D 3 HOH 13 313 59 HOH HOH A . D 3 HOH 14 314 36 HOH HOH A . D 3 HOH 15 315 9 HOH HOH A . D 3 HOH 16 316 65 HOH HOH A . D 3 HOH 17 317 3 HOH HOH A . D 3 HOH 18 318 11 HOH HOH A . D 3 HOH 19 319 78 HOH HOH A . D 3 HOH 20 320 37 HOH HOH A . D 3 HOH 21 321 35 HOH HOH A . D 3 HOH 22 322 12 HOH HOH A . D 3 HOH 23 323 5 HOH HOH A . D 3 HOH 24 324 20 HOH HOH A . D 3 HOH 25 325 8 HOH HOH A . D 3 HOH 26 326 14 HOH HOH A . D 3 HOH 27 327 27 HOH HOH A . D 3 HOH 28 328 1 HOH HOH A . D 3 HOH 29 329 23 HOH HOH A . D 3 HOH 30 330 29 HOH HOH A . D 3 HOH 31 331 72 HOH HOH A . D 3 HOH 32 332 34 HOH HOH A . D 3 HOH 33 333 70 HOH HOH A . D 3 HOH 34 334 31 HOH HOH A . D 3 HOH 35 335 32 HOH HOH A . D 3 HOH 36 336 64 HOH HOH A . D 3 HOH 37 337 25 HOH HOH A . D 3 HOH 38 338 40 HOH HOH A . D 3 HOH 39 339 4 HOH HOH A . D 3 HOH 40 340 39 HOH HOH A . D 3 HOH 41 341 21 HOH HOH A . D 3 HOH 42 342 19 HOH HOH A . D 3 HOH 43 343 77 HOH HOH A . D 3 HOH 44 344 68 HOH HOH A . D 3 HOH 45 345 71 HOH HOH A . D 3 HOH 46 346 62 HOH HOH A . D 3 HOH 47 347 51 HOH HOH A . D 3 HOH 48 348 15 HOH HOH A . D 3 HOH 49 349 52 HOH HOH A . D 3 HOH 50 350 16 HOH HOH A . D 3 HOH 51 351 28 HOH HOH A . D 3 HOH 52 352 67 HOH HOH A . D 3 HOH 53 353 57 HOH HOH A . D 3 HOH 54 354 10 HOH HOH A . D 3 HOH 55 355 58 HOH HOH A . D 3 HOH 56 356 61 HOH HOH A . D 3 HOH 57 357 7 HOH HOH A . D 3 HOH 58 358 66 HOH HOH A . D 3 HOH 59 359 54 HOH HOH A . D 3 HOH 60 360 46 HOH HOH A . D 3 HOH 61 361 44 HOH HOH A . D 3 HOH 62 362 30 HOH HOH A . D 3 HOH 63 363 47 HOH HOH A . D 3 HOH 64 364 38 HOH HOH A . D 3 HOH 65 365 17 HOH HOH A . D 3 HOH 66 366 24 HOH HOH A . D 3 HOH 67 367 76 HOH HOH A . D 3 HOH 68 368 41 HOH HOH A . D 3 HOH 69 369 26 HOH HOH A . D 3 HOH 70 370 50 HOH HOH A . D 3 HOH 71 371 42 HOH HOH A . D 3 HOH 72 372 55 HOH HOH A . D 3 HOH 73 373 69 HOH HOH A . D 3 HOH 74 374 75 HOH HOH A . D 3 HOH 75 375 49 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 90 ? 1 MORE -9 ? 1 'SSA (A^2)' 6430 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CA 202 ? C CA . 2 1 A HOH 367 ? D HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-01-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 5 # _pdbx_entry_details.entry_id 7F5F _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 336 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 346 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 78 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -91.89 _pdbx_validate_torsion.psi 33.80 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 374 ? 6.83 . 2 1 O ? A HOH 375 ? 7.80 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ARG 52 ? NE ? A ARG 35 NE 2 1 Y 0 A ARG 52 ? CZ ? A ARG 35 CZ 3 1 Y 0 A ARG 52 ? NH1 ? A ARG 35 NH1 4 1 Y 1 A LYS 53 ? CG ? A LYS 36 CG 5 1 Y 1 A LYS 53 ? CD ? A LYS 36 CD 6 1 Y 1 A LYS 53 ? CE ? A LYS 36 CE 7 1 Y 1 A LYS 53 ? NZ ? A LYS 36 NZ 8 1 Y 0 A GLU 59 ? CD ? A GLU 42 CD 9 1 Y 1 A ILE 74 ? CG1 ? A ILE 57 CG1 10 1 Y 1 A ILE 74 ? CG2 ? A ILE 57 CG2 11 1 Y 1 A ILE 74 ? CD1 ? A ILE 57 CD1 12 1 Y 1 A ILE 76 ? CG1 ? A ILE 59 CG1 13 1 Y 1 A ILE 76 ? CG2 ? A ILE 59 CG2 14 1 Y 1 A ILE 76 ? CD1 ? A ILE 59 CD1 15 1 Y 0 A ASN 78 ? CG ? A ASN 61 CG 16 1 Y 0 A GLU 106 ? CD ? A GLU 89 CD 17 1 Y 0 A ASP 119 ? CG ? A ASP 102 CG # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #