data_7FAW # _entry.id 7FAW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7FAW pdb_00007faw 10.2210/pdb7faw/pdb WWPDB D_1300023191 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-13 2 'Structure model' 1 1 2024-01-24 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author 5 2 'Structure model' struct_ncs_dom_lim 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 14 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_seq_id' 15 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 16 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 17 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 18 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 19 2 'Structure model' '_struct_ncs_dom_lim.end_auth_seq_id' 20 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 21 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 22 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7FAW _pdbx_database_status.recvd_initial_deposition_date 2021-07-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email xmtu@ustc.edu.cn _pdbx_contact_author.name_first Xiaoming _pdbx_contact_author.name_last Tu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7361-3500 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liao, S.' 1 0000-0002-5083-667X 'Gao, J.' 2 0000-0001-6680-4288 'Tu, X.' 3 0000-0001-7361-3500 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.J.Biol.Macromol. _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 0141-8130 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 253 _citation.language ? _citation.page_first 126764 _citation.page_last 126764 _citation.title 'Structural basis for evolutionarily conserved interactions between TFIIS and Paf1C.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2023.126764 _citation.pdbx_database_id_PubMed 37696373 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gao, J.' 1 ? primary 'Jishage, M.' 2 ? primary 'Wang, Y.' 3 ? primary 'Wang, R.' 4 ? primary 'Chen, M.' 5 ? primary 'Zhu, Z.' 6 ? primary 'Zhang, J.' 7 ? primary 'Diwu, Y.' 8 ? primary 'Xu, C.' 9 ? primary 'Liao, S.' 10 ? primary 'Roeder, R.G.' 11 ? primary 'Tu, X.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcription elongation factor S-II' 9800.458 3 ? ? 'LW domain' ? 2 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DNA strand transfer protein alpha,STP-alpha,DNA strand transferase 1,Pyrimidine pathway regulatory protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKAQLNLEN LYFQG ; _entity_poly.pdbx_seq_one_letter_code_can ;MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKAQLNLEN LYFQG ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 SER n 1 4 LYS n 1 5 GLU n 1 6 VAL n 1 7 LEU n 1 8 VAL n 1 9 HIS n 1 10 VAL n 1 11 LYS n 1 12 ASN n 1 13 LEU n 1 14 GLU n 1 15 LYS n 1 16 ASN n 1 17 LYS n 1 18 SER n 1 19 ASN n 1 20 ASP n 1 21 ALA n 1 22 ALA n 1 23 VAL n 1 24 LEU n 1 25 GLU n 1 26 ILE n 1 27 LEU n 1 28 HIS n 1 29 VAL n 1 30 LEU n 1 31 ASP n 1 32 LYS n 1 33 GLU n 1 34 PHE n 1 35 VAL n 1 36 PRO n 1 37 THR n 1 38 GLU n 1 39 LYS n 1 40 LEU n 1 41 LEU n 1 42 ARG n 1 43 GLU n 1 44 THR n 1 45 LYS n 1 46 VAL n 1 47 GLY n 1 48 VAL n 1 49 GLU n 1 50 VAL n 1 51 ASN n 1 52 LYS n 1 53 PHE n 1 54 LYS n 1 55 LYS n 1 56 SER n 1 57 THR n 1 58 ASN n 1 59 VAL n 1 60 GLU n 1 61 ILE n 1 62 SER n 1 63 LYS n 1 64 LEU n 1 65 VAL n 1 66 LYS n 1 67 LYS n 1 68 MET n 1 69 ILE n 1 70 SER n 1 71 SER n 1 72 TRP n 1 73 LYS n 1 74 ALA n 1 75 GLN n 1 76 LEU n 1 77 ASN n 1 78 LEU n 1 79 GLU n 1 80 ASN n 1 81 LEU n 1 82 TYR n 1 83 PHE n 1 84 GLN n 1 85 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 85 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DST1, PPR2, YGL043W' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae S288C' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 GLY 85 85 ? ? ? A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ASP 2 2 2 ASP ASP B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 VAL 6 6 6 VAL VAL B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 HIS 9 9 9 HIS HIS B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 LYS 11 11 11 LYS LYS B . n B 1 12 ASN 12 12 12 ASN ASN B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 GLU 14 14 14 GLU GLU B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 ASN 16 16 16 ASN ASN B . n B 1 17 LYS 17 17 17 LYS LYS B . n B 1 18 SER 18 18 18 SER SER B . n B 1 19 ASN 19 19 19 ASN ASN B . n B 1 20 ASP 20 20 20 ASP ASP B . n B 1 21 ALA 21 21 21 ALA ALA B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 VAL 23 23 23 VAL VAL B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 ILE 26 26 26 ILE ILE B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 HIS 28 28 28 HIS HIS B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 ASP 31 31 31 ASP ASP B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 GLU 33 33 33 GLU GLU B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 PRO 36 36 36 PRO PRO B . n B 1 37 THR 37 37 37 THR THR B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 ARG 42 42 42 ARG ARG B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 THR 44 44 44 THR THR B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 VAL 46 46 46 VAL VAL B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 VAL 48 48 48 VAL VAL B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 VAL 50 50 50 VAL VAL B . n B 1 51 ASN 51 51 51 ASN ASN B . n B 1 52 LYS 52 52 52 LYS LYS B . n B 1 53 PHE 53 53 53 PHE PHE B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 SER 56 56 56 SER SER B . n B 1 57 THR 57 57 57 THR THR B . n B 1 58 ASN 58 58 58 ASN ASN B . n B 1 59 VAL 59 59 59 VAL VAL B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 ILE 61 61 61 ILE ILE B . n B 1 62 SER 62 62 62 SER SER B . n B 1 63 LYS 63 63 63 LYS LYS B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 VAL 65 65 65 VAL VAL B . n B 1 66 LYS 66 66 66 LYS LYS B . n B 1 67 LYS 67 67 67 LYS LYS B . n B 1 68 MET 68 68 68 MET MET B . n B 1 69 ILE 69 69 69 ILE ILE B . n B 1 70 SER 70 70 70 SER SER B . n B 1 71 SER 71 71 71 SER SER B . n B 1 72 TRP 72 72 72 TRP TRP B . n B 1 73 LYS 73 73 73 LYS LYS B . n B 1 74 ALA 74 74 74 ALA ALA B . n B 1 75 GLN 75 75 75 GLN GLN B . n B 1 76 LEU 76 76 76 LEU LEU B . n B 1 77 ASN 77 77 77 ASN ASN B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 GLU 79 79 79 GLU GLU B . n B 1 80 ASN 80 80 80 ASN ASN B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 TYR 82 82 82 TYR TYR B . n B 1 83 PHE 83 83 83 PHE PHE B . n B 1 84 GLN 84 84 84 GLN GLN B . n B 1 85 GLY 85 85 ? ? ? B . n C 1 1 MET 1 1 1 MET MET C . n C 1 2 ASP 2 2 2 ASP ASP C . n C 1 3 SER 3 3 3 SER SER C . n C 1 4 LYS 4 4 4 LYS LYS C . n C 1 5 GLU 5 5 5 GLU GLU C . n C 1 6 VAL 6 6 6 VAL VAL C . n C 1 7 LEU 7 7 7 LEU LEU C . n C 1 8 VAL 8 8 8 VAL VAL C . n C 1 9 HIS 9 9 9 HIS HIS C . n C 1 10 VAL 10 10 10 VAL VAL C . n C 1 11 LYS 11 11 11 LYS LYS C . n C 1 12 ASN 12 12 12 ASN ASN C . n C 1 13 LEU 13 13 13 LEU LEU C . n C 1 14 GLU 14 14 14 GLU GLU C . n C 1 15 LYS 15 15 15 LYS LYS C . n C 1 16 ASN 16 16 16 ASN ASN C . n C 1 17 LYS 17 17 17 LYS LYS C . n C 1 18 SER 18 18 18 SER SER C . n C 1 19 ASN 19 19 19 ASN ASN C . n C 1 20 ASP 20 20 20 ASP ASP C . n C 1 21 ALA 21 21 21 ALA ALA C . n C 1 22 ALA 22 22 22 ALA ALA C . n C 1 23 VAL 23 23 23 VAL VAL C . n C 1 24 LEU 24 24 24 LEU LEU C . n C 1 25 GLU 25 25 25 GLU GLU C . n C 1 26 ILE 26 26 26 ILE ILE C . n C 1 27 LEU 27 27 27 LEU LEU C . n C 1 28 HIS 28 28 28 HIS HIS C . n C 1 29 VAL 29 29 29 VAL VAL C . n C 1 30 LEU 30 30 30 LEU LEU C . n C 1 31 ASP 31 31 31 ASP ASP C . n C 1 32 LYS 32 32 32 LYS LYS C . n C 1 33 GLU 33 33 33 GLU GLU C . n C 1 34 PHE 34 34 34 PHE PHE C . n C 1 35 VAL 35 35 35 VAL VAL C . n C 1 36 PRO 36 36 36 PRO PRO C . n C 1 37 THR 37 37 37 THR THR C . n C 1 38 GLU 38 38 38 GLU GLU C . n C 1 39 LYS 39 39 39 LYS LYS C . n C 1 40 LEU 40 40 40 LEU LEU C . n C 1 41 LEU 41 41 41 LEU LEU C . n C 1 42 ARG 42 42 42 ARG ARG C . n C 1 43 GLU 43 43 43 GLU GLU C . n C 1 44 THR 44 44 44 THR THR C . n C 1 45 LYS 45 45 45 LYS LYS C . n C 1 46 VAL 46 46 46 VAL VAL C . n C 1 47 GLY 47 47 47 GLY GLY C . n C 1 48 VAL 48 48 48 VAL VAL C . n C 1 49 GLU 49 49 49 GLU GLU C . n C 1 50 VAL 50 50 50 VAL VAL C . n C 1 51 ASN 51 51 51 ASN ASN C . n C 1 52 LYS 52 52 52 LYS LYS C . n C 1 53 PHE 53 53 53 PHE PHE C . n C 1 54 LYS 54 54 54 LYS LYS C . n C 1 55 LYS 55 55 55 LYS LYS C . n C 1 56 SER 56 56 56 SER SER C . n C 1 57 THR 57 57 57 THR THR C . n C 1 58 ASN 58 58 58 ASN ASN C . n C 1 59 VAL 59 59 59 VAL VAL C . n C 1 60 GLU 60 60 60 GLU GLU C . n C 1 61 ILE 61 61 61 ILE ILE C . n C 1 62 SER 62 62 62 SER SER C . n C 1 63 LYS 63 63 63 LYS LYS C . n C 1 64 LEU 64 64 64 LEU LEU C . n C 1 65 VAL 65 65 65 VAL VAL C . n C 1 66 LYS 66 66 66 LYS LYS C . n C 1 67 LYS 67 67 67 LYS LYS C . n C 1 68 MET 68 68 68 MET MET C . n C 1 69 ILE 69 69 69 ILE ILE C . n C 1 70 SER 70 70 70 SER SER C . n C 1 71 SER 71 71 71 SER SER C . n C 1 72 TRP 72 72 72 TRP TRP C . n C 1 73 LYS 73 73 73 LYS LYS C . n C 1 74 ALA 74 74 74 ALA ALA C . n C 1 75 GLN 75 75 75 GLN GLN C . n C 1 76 LEU 76 76 76 LEU LEU C . n C 1 77 ASN 77 77 77 ASN ASN C . n C 1 78 LEU 78 78 78 LEU LEU C . n C 1 79 GLU 79 79 79 GLU GLU C . n C 1 80 ASN 80 80 80 ASN ASN C . n C 1 81 LEU 81 81 81 LEU LEU C . n C 1 82 TYR 82 82 82 TYR TYR C . n C 1 83 PHE 83 83 83 PHE PHE C . n C 1 84 GLN 84 84 84 GLN GLN C . n C 1 85 GLY 85 85 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 101 20 HOH HOH A . D 2 HOH 2 102 5 HOH HOH A . D 2 HOH 3 103 30 HOH HOH A . D 2 HOH 4 104 40 HOH HOH A . D 2 HOH 5 105 11 HOH HOH A . D 2 HOH 6 106 2 HOH HOH A . D 2 HOH 7 107 17 HOH HOH A . D 2 HOH 8 108 19 HOH HOH A . D 2 HOH 9 109 21 HOH HOH A . D 2 HOH 10 110 28 HOH HOH A . D 2 HOH 11 111 33 HOH HOH A . D 2 HOH 12 112 41 HOH HOH A . D 2 HOH 13 113 9 HOH HOH A . D 2 HOH 14 114 36 HOH HOH A . D 2 HOH 15 115 48 HOH HOH A . E 2 HOH 1 101 14 HOH HOH B . E 2 HOH 2 102 15 HOH HOH B . E 2 HOH 3 103 10 HOH HOH B . E 2 HOH 4 104 12 HOH HOH B . E 2 HOH 5 105 1 HOH HOH B . E 2 HOH 6 106 8 HOH HOH B . E 2 HOH 7 107 4 HOH HOH B . E 2 HOH 8 108 27 HOH HOH B . E 2 HOH 9 109 35 HOH HOH B . E 2 HOH 10 110 42 HOH HOH B . F 2 HOH 1 101 26 HOH HOH C . F 2 HOH 2 102 7 HOH HOH C . F 2 HOH 3 103 24 HOH HOH C . F 2 HOH 4 104 50 HOH HOH C . F 2 HOH 5 105 13 HOH HOH C . F 2 HOH 6 106 16 HOH HOH C . F 2 HOH 7 107 34 HOH HOH C . F 2 HOH 8 108 3 HOH HOH C . F 2 HOH 9 109 22 HOH HOH C . F 2 HOH 10 110 39 HOH HOH C . F 2 HOH 11 111 45 HOH HOH C . F 2 HOH 12 112 49 HOH HOH C . F 2 HOH 13 113 31 HOH HOH C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 4 ? CG ? A LYS 4 CG 2 1 Y 1 A LYS 4 ? CD ? A LYS 4 CD 3 1 Y 1 A LYS 4 ? CE ? A LYS 4 CE 4 1 Y 1 A LYS 4 ? NZ ? A LYS 4 NZ 5 1 Y 1 A LYS 11 ? CG ? A LYS 11 CG 6 1 Y 1 A LYS 11 ? CD ? A LYS 11 CD 7 1 Y 1 A LYS 11 ? CE ? A LYS 11 CE 8 1 Y 1 A LYS 11 ? NZ ? A LYS 11 NZ 9 1 Y 1 A LYS 32 ? CG ? A LYS 32 CG 10 1 Y 1 A LYS 32 ? CD ? A LYS 32 CD 11 1 Y 1 A LYS 32 ? CE ? A LYS 32 CE 12 1 Y 1 A LYS 32 ? NZ ? A LYS 32 NZ 13 1 Y 1 A LYS 45 ? CG ? A LYS 45 CG 14 1 Y 1 A LYS 45 ? CD ? A LYS 45 CD 15 1 Y 1 A LYS 45 ? CE ? A LYS 45 CE 16 1 Y 1 A LYS 45 ? NZ ? A LYS 45 NZ 17 1 Y 1 A LYS 55 ? CG ? A LYS 55 CG 18 1 Y 1 A LYS 55 ? CD ? A LYS 55 CD 19 1 Y 1 A LYS 55 ? CE ? A LYS 55 CE 20 1 Y 1 A LYS 55 ? NZ ? A LYS 55 NZ 21 1 Y 1 A GLN 84 ? CG ? A GLN 84 CG 22 1 Y 1 A GLN 84 ? CD ? A GLN 84 CD 23 1 Y 1 A GLN 84 ? OE1 ? A GLN 84 OE1 24 1 Y 1 A GLN 84 ? NE2 ? A GLN 84 NE2 25 1 Y 1 B LYS 32 ? CG ? B LYS 32 CG 26 1 Y 1 B LYS 32 ? CD ? B LYS 32 CD 27 1 Y 1 B LYS 32 ? CE ? B LYS 32 CE 28 1 Y 1 B LYS 32 ? NZ ? B LYS 32 NZ 29 1 Y 1 B GLU 38 ? CG ? B GLU 38 CG 30 1 Y 1 B GLU 38 ? CD ? B GLU 38 CD 31 1 Y 1 B GLU 38 ? OE1 ? B GLU 38 OE1 32 1 Y 1 B GLU 38 ? OE2 ? B GLU 38 OE2 33 1 Y 1 B LYS 55 ? CG ? B LYS 55 CG 34 1 Y 1 B LYS 55 ? CD ? B LYS 55 CD 35 1 Y 1 B LYS 55 ? CE ? B LYS 55 CE 36 1 Y 1 B LYS 55 ? NZ ? B LYS 55 NZ 37 1 Y 1 B LYS 63 ? CG ? B LYS 63 CG 38 1 Y 1 B LYS 63 ? CD ? B LYS 63 CD 39 1 Y 1 B LYS 63 ? CE ? B LYS 63 CE 40 1 Y 1 B LYS 63 ? NZ ? B LYS 63 NZ 41 1 Y 1 B LYS 66 ? CG ? B LYS 66 CG 42 1 Y 1 B LYS 66 ? CD ? B LYS 66 CD 43 1 Y 1 B LYS 66 ? CE ? B LYS 66 CE 44 1 Y 1 B LYS 66 ? NZ ? B LYS 66 NZ 45 1 Y 1 C LYS 4 ? CG ? C LYS 4 CG 46 1 Y 1 C LYS 4 ? CD ? C LYS 4 CD 47 1 Y 1 C LYS 4 ? CE ? C LYS 4 CE 48 1 Y 1 C LYS 4 ? NZ ? C LYS 4 NZ 49 1 Y 1 C LYS 32 ? CG ? C LYS 32 CG 50 1 Y 1 C LYS 32 ? CD ? C LYS 32 CD 51 1 Y 1 C LYS 32 ? CE ? C LYS 32 CE 52 1 Y 1 C LYS 32 ? NZ ? C LYS 32 NZ 53 1 Y 1 C LYS 45 ? CG ? C LYS 45 CG 54 1 Y 1 C LYS 45 ? CD ? C LYS 45 CD 55 1 Y 1 C LYS 45 ? CE ? C LYS 45 CE 56 1 Y 1 C LYS 45 ? NZ ? C LYS 45 NZ 57 1 Y 1 C LYS 54 ? CG ? C LYS 54 CG 58 1 Y 1 C LYS 54 ? CD ? C LYS 54 CD 59 1 Y 1 C LYS 54 ? CE ? C LYS 54 CE 60 1 Y 1 C LYS 54 ? NZ ? C LYS 54 NZ 61 1 Y 1 C LYS 55 ? CG ? C LYS 55 CG 62 1 Y 1 C LYS 55 ? CD ? C LYS 55 CD 63 1 Y 1 C LYS 55 ? CE ? C LYS 55 CE 64 1 Y 1 C LYS 55 ? NZ ? C LYS 55 NZ 65 1 Y 1 C LYS 63 ? CG ? C LYS 63 CG 66 1 Y 1 C LYS 63 ? CD ? C LYS 63 CD 67 1 Y 1 C LYS 63 ? CE ? C LYS 63 CE 68 1 Y 1 C LYS 63 ? NZ ? C LYS 63 NZ 69 1 Y 1 C LYS 66 ? CG ? C LYS 66 CG 70 1 Y 1 C LYS 66 ? CD ? C LYS 66 CD 71 1 Y 1 C LYS 66 ? CE ? C LYS 66 CE 72 1 Y 1 C LYS 66 ? NZ ? C LYS 66 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7FAW _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.014 _cell.length_a_esd ? _cell.length_b 91.568 _cell.length_b_esd ? _cell.length_c 118.068 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7FAW _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7FAW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.94 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Tris, pH 8.5, 25% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7FAW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.438 _reflns.d_resolution_low 118.07 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24984 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14 _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.44 _reflns_shell.d_res_low 2.50 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 996 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.621 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.958 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 81.010 _refine.B_iso_mean 42.4344 _refine.B_iso_min 24.540 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7FAW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4380 _refine.ls_d_res_low 36.1790 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24984 _refine.ls_number_reflns_R_free 2509 _refine.ls_number_reflns_R_work 22475 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9600 _refine.ls_percent_reflns_R_free 10.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2054 _refine.ls_R_factor_R_free 0.2398 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2016 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'model built by rosetta' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.4400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4380 _refine_hist.d_res_low 36.1790 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 2015 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 252 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 40.89 _refine_hist.pdbx_number_atoms_protein 1977 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 750 5.485 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 750 5.485 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 750 5.485 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4385 2.4854 . . 140 1271 100.0000 . . . 0.3440 0.0000 0.2621 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4854 2.5361 . . 142 1228 100.0000 . . . 0.2928 0.0000 0.2356 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5361 2.5912 . . 138 1238 100.0000 . . . 0.3084 0.0000 0.2232 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5912 2.6515 . . 140 1270 100.0000 . . . 0.2566 0.0000 0.2370 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6515 2.7178 . . 140 1253 100.0000 . . . 0.2938 0.0000 0.2129 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7178 2.7912 . . 135 1205 100.0000 . . . 0.2730 0.0000 0.2170 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7912 2.8733 . . 146 1290 100.0000 . . . 0.2331 0.0000 0.2273 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8733 2.9660 . . 146 1231 100.0000 . . . 0.2707 0.0000 0.2326 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9660 3.0720 . . 138 1226 100.0000 . . . 0.2643 0.0000 0.2348 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0720 3.1949 . . 145 1294 100.0000 . . . 0.2720 0.0000 0.2354 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1949 3.3402 . . 136 1201 100.0000 . . . 0.3143 0.0000 0.2314 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3402 3.5162 . . 138 1269 100.0000 . . . 0.2649 0.0000 0.2173 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5162 3.7363 . . 135 1247 100.0000 . . . 0.2357 0.0000 0.2021 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7363 4.0244 . . 142 1270 100.0000 . . . 0.2182 0.0000 0.1750 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0244 4.4288 . . 134 1232 100.0000 . . . 0.1818 0.0000 0.1592 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4288 5.0681 . . 136 1260 100.0000 . . . 0.1905 0.0000 0.1701 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.0681 6.3796 . . 141 1256 100.0000 . . . 0.2631 0.0000 0.2211 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.3796 36.17 . . 137 1234 100.0000 . . . 0.1862 0.0000 0.1703 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 84)) ; 1 2 ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 3 ;(chain C and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 84)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A MET 1 . A LYS 4 . A MET 1 A LYS 4 ? ;(chain A and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 84)) ; 1 1 2 A GLU 5 . A GLU 5 . A GLU 5 A GLU 5 ? ;(chain A and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 84)) ; 1 1 3 A MET 1 . A GLN 84 . A MET 1 A GLN 84 ? ;(chain A and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 84)) ; 1 1 4 A MET 1 . A GLN 84 . A MET 1 A GLN 84 ? ;(chain A and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 84)) ; 1 1 5 A MET 1 . A GLN 84 . A MET 1 A GLN 84 ? ;(chain A and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 84)) ; 1 1 6 A MET 1 . A GLN 84 . A MET 1 A GLN 84 ? ;(chain A and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 62 or (resid 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 84)) ; 1 2 1 B MET 1 . B SER 3 . B MET 1 B SER 3 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 2 B LYS 4 . B GLU 5 . B LYS 4 B GLU 5 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 3 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 4 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 5 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 6 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 7 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 8 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 9 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 10 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 2 11 B MET 1 . B GLN 84 . B MET 1 B GLN 84 ? ;(chain B and (resid 1 through 3 or (resid 4 through 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 53 or (resid 54 through 55 and (name N or name CA or name C or name O or name CB )) or resid 56 through 84)) ; 1 3 1 C MET 1 . C LYS 4 . C MET 1 C LYS 4 ? ;(chain C and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 84)) ; 1 3 2 C GLU 5 . C GLU 5 . C GLU 5 C GLU 5 ? ;(chain C and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 84)) ; 1 3 3 C MET 1 . C GLN 84 . C MET 1 C GLN 84 ? ;(chain C and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 84)) ; 1 3 4 C MET 1 . C GLN 84 . C MET 1 C GLN 84 ? ;(chain C and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 84)) ; 1 3 5 C MET 1 . C GLN 84 . C MET 1 C GLN 84 ? ;(chain C and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 84)) ; 1 3 6 C MET 1 . C GLN 84 . C MET 1 C GLN 84 ? ;(chain C and (resid 1 through 4 or (resid 5 and (name N or name CA or name C or name O or name CB )) or resid 6 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 84)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7FAW _struct.title 'Structure of LW domain from Yeast' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7FAW _struct_keywords.text 'LW, Transcription, Paf1C' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TFS2_YEAST _struct_ref.pdbx_db_accession P07273 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWK _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7FAW A 1 ? 73 ? P07273 1 ? 73 ? 1 73 2 1 7FAW B 1 ? 73 ? P07273 1 ? 73 ? 1 73 3 1 7FAW C 1 ? 73 ? P07273 1 ? 73 ? 1 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7FAW ALA A 74 ? UNP P07273 ? ? 'expression tag' 74 1 1 7FAW GLN A 75 ? UNP P07273 ? ? 'expression tag' 75 2 1 7FAW LEU A 76 ? UNP P07273 ? ? 'expression tag' 76 3 1 7FAW ASN A 77 ? UNP P07273 ? ? 'expression tag' 77 4 1 7FAW LEU A 78 ? UNP P07273 ? ? 'expression tag' 78 5 1 7FAW GLU A 79 ? UNP P07273 ? ? 'expression tag' 79 6 1 7FAW ASN A 80 ? UNP P07273 ? ? 'expression tag' 80 7 1 7FAW LEU A 81 ? UNP P07273 ? ? 'expression tag' 81 8 1 7FAW TYR A 82 ? UNP P07273 ? ? 'expression tag' 82 9 1 7FAW PHE A 83 ? UNP P07273 ? ? 'expression tag' 83 10 1 7FAW GLN A 84 ? UNP P07273 ? ? 'expression tag' 84 11 1 7FAW GLY A 85 ? UNP P07273 ? ? 'expression tag' 85 12 2 7FAW ALA B 74 ? UNP P07273 ? ? 'expression tag' 74 13 2 7FAW GLN B 75 ? UNP P07273 ? ? 'expression tag' 75 14 2 7FAW LEU B 76 ? UNP P07273 ? ? 'expression tag' 76 15 2 7FAW ASN B 77 ? UNP P07273 ? ? 'expression tag' 77 16 2 7FAW LEU B 78 ? UNP P07273 ? ? 'expression tag' 78 17 2 7FAW GLU B 79 ? UNP P07273 ? ? 'expression tag' 79 18 2 7FAW ASN B 80 ? UNP P07273 ? ? 'expression tag' 80 19 2 7FAW LEU B 81 ? UNP P07273 ? ? 'expression tag' 81 20 2 7FAW TYR B 82 ? UNP P07273 ? ? 'expression tag' 82 21 2 7FAW PHE B 83 ? UNP P07273 ? ? 'expression tag' 83 22 2 7FAW GLN B 84 ? UNP P07273 ? ? 'expression tag' 84 23 2 7FAW GLY B 85 ? UNP P07273 ? ? 'expression tag' 85 24 3 7FAW ALA C 74 ? UNP P07273 ? ? 'expression tag' 74 25 3 7FAW GLN C 75 ? UNP P07273 ? ? 'expression tag' 75 26 3 7FAW LEU C 76 ? UNP P07273 ? ? 'expression tag' 76 27 3 7FAW ASN C 77 ? UNP P07273 ? ? 'expression tag' 77 28 3 7FAW LEU C 78 ? UNP P07273 ? ? 'expression tag' 78 29 3 7FAW GLU C 79 ? UNP P07273 ? ? 'expression tag' 79 30 3 7FAW ASN C 80 ? UNP P07273 ? ? 'expression tag' 80 31 3 7FAW LEU C 81 ? UNP P07273 ? ? 'expression tag' 81 32 3 7FAW TYR C 82 ? UNP P07273 ? ? 'expression tag' 82 33 3 7FAW PHE C 83 ? UNP P07273 ? ? 'expression tag' 83 34 3 7FAW GLN C 84 ? UNP P07273 ? ? 'expression tag' 84 35 3 7FAW GLY C 85 ? UNP P07273 ? ? 'expression tag' 85 36 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D 2 1 B,E 3 1 C,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? ASN A 16 ? ASP A 2 ASN A 16 1 ? 15 HELX_P HELX_P2 AA2 ASN A 19 ? PHE A 34 ? ASN A 19 PHE A 34 1 ? 16 HELX_P HELX_P3 AA3 THR A 37 ? LYS A 45 ? THR A 37 LYS A 45 1 ? 9 HELX_P HELX_P4 AA4 LYS A 45 ? LYS A 52 ? LYS A 45 LYS A 52 1 ? 8 HELX_P HELX_P5 AA5 PHE A 53 ? SER A 56 ? PHE A 53 SER A 56 5 ? 4 HELX_P HELX_P6 AA6 ASN A 58 ? PHE A 83 ? ASN A 58 PHE A 83 1 ? 26 HELX_P HELX_P7 AA7 ASP B 2 ? ASN B 16 ? ASP B 2 ASN B 16 1 ? 15 HELX_P HELX_P8 AA8 ASN B 19 ? PHE B 34 ? ASN B 19 PHE B 34 1 ? 16 HELX_P HELX_P9 AA9 THR B 37 ? LYS B 45 ? THR B 37 LYS B 45 1 ? 9 HELX_P HELX_P10 AB1 LYS B 45 ? LYS B 52 ? LYS B 45 LYS B 52 1 ? 8 HELX_P HELX_P11 AB2 ASN B 58 ? PHE B 83 ? ASN B 58 PHE B 83 1 ? 26 HELX_P HELX_P12 AB3 ASP C 2 ? ASN C 16 ? ASP C 2 ASN C 16 1 ? 15 HELX_P HELX_P13 AB4 ASN C 19 ? PHE C 34 ? ASN C 19 PHE C 34 1 ? 16 HELX_P HELX_P14 AB5 THR C 37 ? LYS C 45 ? THR C 37 LYS C 45 1 ? 9 HELX_P HELX_P15 AB6 LYS C 45 ? LYS C 52 ? LYS C 45 LYS C 52 1 ? 8 HELX_P HELX_P16 AB7 ASN C 58 ? PHE C 83 ? ASN C 58 PHE C 83 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -5.1348 _pdbx_refine_tls.origin_y 8.4774 _pdbx_refine_tls.origin_z -14.2892 _pdbx_refine_tls.T[1][1] 0.2875 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0065 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0192 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.3230 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0207 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3271 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.3457 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0706 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.0577 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.4683 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.5891 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.7475 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0515 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0638 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0559 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0318 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0039 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0373 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.1166 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0877 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0093 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? ? A 84 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 1 ? ? ? B 84 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? C 1 ? ? ? C 84 ? ? all 4 'X-RAY DIFFRACTION' 1 ? ? S 1 ? ? ? S 50 ? ? all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 85 ? A GLY 85 2 1 Y 1 B GLY 85 ? B GLY 85 3 1 Y 1 C GLY 85 ? C GLY 85 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31500601 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'model built by rosetta' # _atom_sites.entry_id 7FAW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.031236 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010921 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008470 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_