data_7FQZ # _entry.id 7FQZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.367 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7FQZ pdb_00007fqz 10.2210/pdb7fqz/pdb WWPDB D_1001405236 ? ? # _pdbx_database_status.entry_id 7FQZ _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.recvd_initial_deposition_date 2022-10-20 _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mehlman, T.' 1 'Biel, J.' 2 'Azeem, S.M.' 3 'Nelson, E.R.' 4 'Hossain, S.' 5 'Dunnett, L.E.' 6 'Paterson, N.G.' 7 'Douangamath, A.' 8 'Talon, R.' 9 'Axford, D.' 10 'Orins, H.' 11 'von Delft, F.' 12 'Keedy, D.A.' 13 # _citation.id primary _citation.title 'Room-temperature crystallography reveals altered binding of small-molecule fragments to PTP1B.' _citation.journal_abbrev Elife _citation.journal_volume 12 _citation.page_first ? _citation.page_last ? _citation.year 2023 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 2050-084X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 36881464 _citation.pdbx_database_id_DOI 10.7554/eLife.84632 # loop_ _citation_author.citation_id _citation_author.name _citation_author.identifier_ORCID _citation_author.ordinal primary 'Skaist Mehlman, T.' 0000-0002-8896-1628 1 primary 'Biel, J.T.' 0000-0002-0935-8362 2 primary 'Azeem, S.M.' 0000-0002-7712-527X 3 primary 'Nelson, E.R.' ? 4 primary 'Hossain, S.' 0000-0002-2602-9245 5 primary 'Dunnett, L.' ? 6 primary 'Paterson, N.G.' ? 7 primary 'Douangamath, A.' ? 8 primary 'Talon, R.' ? 9 primary 'Axford, D.' ? 10 primary 'Orins, H.' ? 11 primary 'von Delft, F.' 0000-0003-0378-0017 12 primary 'Keedy, D.A.' 0000-0002-9184-7586 13 # _cell.entry_id 7FQZ _cell.length_a 89.550 _cell.length_b 89.550 _cell.length_c 106.450 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 7FQZ _symmetry.Int_Tables_number 152 _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein phosphatase non-receptor type 1' 37345.562 1 3.1.3.48 C32S/C92V 'catalytic domain' ? 2 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 3 non-polymer syn 5-fluoro-1,3-dihydro-2H-indol-2-one 151.138 2 ? ? ? ? 4 water nat water 18.015 165 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein-tyrosine phosphatase 1B,PTP-1B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPSRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTVGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _entity_poly.pdbx_seq_one_letter_code_can ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPSRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTVGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 MET n 1 4 GLU n 1 5 LYS n 1 6 GLU n 1 7 PHE n 1 8 GLU n 1 9 GLN n 1 10 ILE n 1 11 ASP n 1 12 LYS n 1 13 SER n 1 14 GLY n 1 15 SER n 1 16 TRP n 1 17 ALA n 1 18 ALA n 1 19 ILE n 1 20 TYR n 1 21 GLN n 1 22 ASP n 1 23 ILE n 1 24 ARG n 1 25 HIS n 1 26 GLU n 1 27 ALA n 1 28 SER n 1 29 ASP n 1 30 PHE n 1 31 PRO n 1 32 SER n 1 33 ARG n 1 34 VAL n 1 35 ALA n 1 36 LYS n 1 37 LEU n 1 38 PRO n 1 39 LYS n 1 40 ASN n 1 41 LYS n 1 42 ASN n 1 43 ARG n 1 44 ASN n 1 45 ARG n 1 46 TYR n 1 47 ARG n 1 48 ASP n 1 49 VAL n 1 50 SER n 1 51 PRO n 1 52 PHE n 1 53 ASP n 1 54 HIS n 1 55 SER n 1 56 ARG n 1 57 ILE n 1 58 LYS n 1 59 LEU n 1 60 HIS n 1 61 GLN n 1 62 GLU n 1 63 ASP n 1 64 ASN n 1 65 ASP n 1 66 TYR n 1 67 ILE n 1 68 ASN n 1 69 ALA n 1 70 SER n 1 71 LEU n 1 72 ILE n 1 73 LYS n 1 74 MET n 1 75 GLU n 1 76 GLU n 1 77 ALA n 1 78 GLN n 1 79 ARG n 1 80 SER n 1 81 TYR n 1 82 ILE n 1 83 LEU n 1 84 THR n 1 85 GLN n 1 86 GLY n 1 87 PRO n 1 88 LEU n 1 89 PRO n 1 90 ASN n 1 91 THR n 1 92 VAL n 1 93 GLY n 1 94 HIS n 1 95 PHE n 1 96 TRP n 1 97 GLU n 1 98 MET n 1 99 VAL n 1 100 TRP n 1 101 GLU n 1 102 GLN n 1 103 LYS n 1 104 SER n 1 105 ARG n 1 106 GLY n 1 107 VAL n 1 108 VAL n 1 109 MET n 1 110 LEU n 1 111 ASN n 1 112 ARG n 1 113 VAL n 1 114 MET n 1 115 GLU n 1 116 LYS n 1 117 GLY n 1 118 SER n 1 119 LEU n 1 120 LYS n 1 121 CYS n 1 122 ALA n 1 123 GLN n 1 124 TYR n 1 125 TRP n 1 126 PRO n 1 127 GLN n 1 128 LYS n 1 129 GLU n 1 130 GLU n 1 131 LYS n 1 132 GLU n 1 133 MET n 1 134 ILE n 1 135 PHE n 1 136 GLU n 1 137 ASP n 1 138 THR n 1 139 ASN n 1 140 LEU n 1 141 LYS n 1 142 LEU n 1 143 THR n 1 144 LEU n 1 145 ILE n 1 146 SER n 1 147 GLU n 1 148 ASP n 1 149 ILE n 1 150 LYS n 1 151 SER n 1 152 TYR n 1 153 TYR n 1 154 THR n 1 155 VAL n 1 156 ARG n 1 157 GLN n 1 158 LEU n 1 159 GLU n 1 160 LEU n 1 161 GLU n 1 162 ASN n 1 163 LEU n 1 164 THR n 1 165 THR n 1 166 GLN n 1 167 GLU n 1 168 THR n 1 169 ARG n 1 170 GLU n 1 171 ILE n 1 172 LEU n 1 173 HIS n 1 174 PHE n 1 175 HIS n 1 176 TYR n 1 177 THR n 1 178 THR n 1 179 TRP n 1 180 PRO n 1 181 ASP n 1 182 PHE n 1 183 GLY n 1 184 VAL n 1 185 PRO n 1 186 GLU n 1 187 SER n 1 188 PRO n 1 189 ALA n 1 190 SER n 1 191 PHE n 1 192 LEU n 1 193 ASN n 1 194 PHE n 1 195 LEU n 1 196 PHE n 1 197 LYS n 1 198 VAL n 1 199 ARG n 1 200 GLU n 1 201 SER n 1 202 GLY n 1 203 SER n 1 204 LEU n 1 205 SER n 1 206 PRO n 1 207 GLU n 1 208 HIS n 1 209 GLY n 1 210 PRO n 1 211 VAL n 1 212 VAL n 1 213 VAL n 1 214 HIS n 1 215 CYS n 1 216 SER n 1 217 ALA n 1 218 GLY n 1 219 ILE n 1 220 GLY n 1 221 ARG n 1 222 SER n 1 223 GLY n 1 224 THR n 1 225 PHE n 1 226 CYS n 1 227 LEU n 1 228 ALA n 1 229 ASP n 1 230 THR n 1 231 CYS n 1 232 LEU n 1 233 LEU n 1 234 LEU n 1 235 MET n 1 236 ASP n 1 237 LYS n 1 238 ARG n 1 239 LYS n 1 240 ASP n 1 241 PRO n 1 242 SER n 1 243 SER n 1 244 VAL n 1 245 ASP n 1 246 ILE n 1 247 LYS n 1 248 LYS n 1 249 VAL n 1 250 LEU n 1 251 LEU n 1 252 GLU n 1 253 MET n 1 254 ARG n 1 255 LYS n 1 256 PHE n 1 257 ARG n 1 258 MET n 1 259 GLY n 1 260 LEU n 1 261 ILE n 1 262 GLN n 1 263 THR n 1 264 ALA n 1 265 ASP n 1 266 GLN n 1 267 LEU n 1 268 ARG n 1 269 PHE n 1 270 SER n 1 271 TYR n 1 272 LEU n 1 273 ALA n 1 274 VAL n 1 275 ILE n 1 276 GLU n 1 277 GLY n 1 278 ALA n 1 279 LYS n 1 280 PHE n 1 281 ILE n 1 282 MET n 1 283 GLY n 1 284 ASP n 1 285 SER n 1 286 SER n 1 287 VAL n 1 288 GLN n 1 289 ASP n 1 290 GLN n 1 291 TRP n 1 292 LYS n 1 293 GLU n 1 294 LEU n 1 295 SER n 1 296 HIS n 1 297 GLU n 1 298 ASP n 1 299 LEU n 1 300 GLU n 1 301 PRO n 1 302 PRO n 1 303 PRO n 1 304 GLU n 1 305 HIS n 1 306 ILE n 1 307 PRO n 1 308 PRO n 1 309 PRO n 1 310 PRO n 1 311 ARG n 1 312 PRO n 1 313 PRO n 1 314 LYS n 1 315 ARG n 1 316 ILE n 1 317 LEU n 1 318 GLU n 1 319 PRO n 1 320 HIS n 1 321 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 321 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTPN1, PTP1B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTN1_HUMAN _struct_ref.pdbx_db_accession P18031 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH N ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7FQZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 321 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18031 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 321 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 321 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7FQZ SER A 32 ? UNP P18031 CYS 32 'engineered mutation' 32 1 1 7FQZ VAL A 92 ? UNP P18031 CYS 92 'engineered mutation' 92 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 WV0 non-polymer . 5-fluoro-1,3-dihydro-2H-indol-2-one ? 'C8 H6 F N O' 151.138 # _exptl.crystals_number 1 _exptl.entry_id 7FQZ _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 3.30 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 62.72 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details '0.1 M HEPES, 0.3 M magnesium acetate, 13.5% PEG 8000, 2% ethanol, and 1 mM BME' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 278 _diffrn.crystal_id 1 _diffrn.ambient_temp_details ? # _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2017-06-26 _diffrn_detector.diffrn_id 1 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.pdbx_wavelength_list 0.97625 _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_wavelength ? # _reflns.d_resolution_high 2.090 _reflns.d_resolution_low 62.68 _reflns.pdbx_number_measured_all 261971 _reflns.number_obs 29731 _reflns.pdbx_Rmerge_I_obs 0.129 _reflns.pdbx_netI_over_sigmaI 9.240 _reflns.pdbx_chi_squared 0.972 _reflns.percent_possible_obs 100.000 _reflns.observed_criterion_sigma_I -3.000 _reflns.pdbx_Rrim_I_all 0.137 _reflns.pdbx_CC_half 0.998 _reflns.B_iso_Wilson_estimate 46.904 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 7FQZ _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 2.090 2.140 19114 ? 2141 0 1.446 1.080 ? ? ? ? ? 2141 ? ? ? ? ? 100.000 1.535 ? 0.534 1 2 2.140 2.200 19392 ? 2118 0 1.083 1.580 ? ? ? ? ? 2118 ? ? ? ? ? 100.000 1.148 ? 0.708 1 3 2.200 2.270 18691 ? 2070 0 0.940 1.910 ? ? ? ? ? 2070 ? ? ? ? ? 100.000 0.998 ? 0.776 1 4 2.270 2.340 17161 ? 1982 0 0.792 2.280 ? ? ? ? ? 1982 ? ? ? ? ? 100.000 0.843 ? 0.806 1 5 2.340 2.410 17576 ? 1963 0 0.649 2.930 ? ? ? ? ? 1963 ? ? ? ? ? 100.000 0.689 ? 0.889 1 6 2.410 2.500 16600 ? 1879 0 0.553 3.520 ? ? ? ? ? 1879 ? ? ? ? ? 100.000 0.587 ? 0.906 1 7 2.500 2.590 15679 ? 1800 0 0.477 4.070 ? ? ? ? ? 1800 ? ? ? ? ? 100.000 0.507 ? 0.920 1 8 2.590 2.700 15749 ? 1765 0 0.383 5.100 ? ? ? ? ? 1765 ? ? ? ? ? 100.000 0.407 ? 0.962 1 9 2.700 2.820 14704 ? 1680 0 0.327 6.100 ? ? ? ? ? 1680 ? ? ? ? ? 100.000 0.348 ? 0.960 1 10 2.820 2.960 13501 ? 1613 0 0.260 7.450 ? ? ? ? ? 1614 ? ? ? ? ? 99.900 0.278 ? 0.975 1 11 2.960 3.120 13617 ? 1527 0 0.201 9.820 ? ? ? ? ? 1527 ? ? ? ? ? 100.000 0.213 ? 0.987 1 12 3.120 3.300 12849 ? 1468 0 0.165 12.170 ? ? ? ? ? 1468 ? ? ? ? ? 100.000 0.175 ? 0.989 1 13 3.300 3.530 12451 ? 1357 0 0.125 15.890 ? ? ? ? ? 1357 ? ? ? ? ? 100.000 0.132 ? 0.994 1 14 3.530 3.820 11406 ? 1280 0 0.099 19.380 ? ? ? ? ? 1280 ? ? ? ? ? 100.000 0.105 ? 0.996 1 15 3.820 4.180 10371 ? 1188 0 0.083 22.120 ? ? ? ? ? 1188 ? ? ? ? ? 100.000 0.088 ? 0.996 1 16 4.180 4.670 9331 ? 1080 0 0.066 26.000 ? ? ? ? ? 1080 ? ? ? ? ? 100.000 0.070 ? 0.998 1 17 4.670 5.400 8571 ? 961 0 0.065 26.780 ? ? ? ? ? 961 ? ? ? ? ? 100.000 0.069 ? 0.998 1 18 5.400 6.610 6862 ? 823 0 0.070 24.470 ? ? ? ? ? 823 ? ? ? ? ? 100.000 0.075 ? 0.997 1 19 6.610 9.350 5421 ? 651 0 0.060 27.740 ? ? ? ? ? 651 ? ? ? ? ? 100.000 0.064 ? 0.997 1 20 9.350 ? 2925 ? 385 0 0.048 31.560 ? ? ? ? ? 389 ? ? ? ? ? 99.000 0.051 ? 0.999 # _refine.entry_id 7FQZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.0900 _refine.ls_d_res_low 44.8200 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.9600 _refine.ls_number_reflns_obs 28562 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1681 _refine.ls_R_factor_R_work 0.1665 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2085 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 3.9000 _refine.ls_number_reflns_R_free 1169 _refine.ls_number_reflns_R_work ? _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 47.7650 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -0.0200 _refine.aniso_B[2][2] -0.0200 _refine.aniso_B[3][3] 0.0500 _refine.aniso_B[1][2] -0.0100 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] -0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9690 _refine.correlation_coeff_Fo_to_Fc_free 0.9530 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.2200 _refine.pdbx_overall_ESU_R_Free 0.1720 _refine.overall_SU_ML 0.1520 _refine.overall_SU_B 6.1470 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 147.050 _refine.B_iso_min 27.750 _refine.pdbx_overall_phase_error ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.0900 _refine_hist.d_res_low 44.8200 _refine_hist.pdbx_number_atoms_ligand 50 _refine_hist.number_atoms_solvent 169 _refine_hist.number_atoms_total 2516 _refine_hist.pdbx_number_residues_total 281 _refine_hist.pdbx_B_iso_mean_ligand 69.48 _refine_hist.pdbx_B_iso_mean_solvent 61.37 _refine_hist.pdbx_number_atoms_protein 2297 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' r_bond_refined_d 8130 0.020 0.042 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 3994 0.001 0.015 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 5919 1.534 1.646 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 9280 1.306 1.582 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 574 6.607 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 249 32.867 20.884 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 805 17.551 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 41 23.089 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 523 0.113 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 5554 0.008 0.020 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 1108 0.003 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 4030 4.065 4.550 ? ? 'X-RAY DIFFRACTION' r_mcbond_other 3946 3.984 4.533 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 2710 4.844 6.835 ? ? # _refine_ls_shell.d_res_high 2.0900 _refine_ls_shell.d_res_low 2.1440 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.number_reflns_R_work 2053 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.3140 _refine_ls_shell.R_factor_R_free 0.3360 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 81 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2134 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 7FQZ _struct.title 'PanDDA analysis group deposition -- Crystal structure of PTP1B in complex with FMOMB000203a' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 7FQZ _struct_keywords.text ;PanDDA, Diamond i24 fragment screening, protein tyrosine phosphatase, PTP, protein tyrosine phosphatase 1B, PTP1B, enzyme, allostery, multiconformer, HYDROLASE ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 2 ? GLY A 14 ? GLU A 2 GLY A 14 1 ? 13 HELX_P HELX_P2 AA2 SER A 15 ? ALA A 27 ? SER A 15 ALA A 27 1 ? 13 HELX_P HELX_P3 AA3 SER A 32 ? LEU A 37 ? SER A 32 LEU A 37 1 ? 6 HELX_P HELX_P4 AA4 PRO A 38 ? LYS A 41 ? PRO A 38 LYS A 41 5 ? 4 HELX_P HELX_P5 AA5 THR A 91 ? GLN A 102 ? THR A 91 GLN A 102 1 ? 12 HELX_P HELX_P6 AA6 PRO A 188 ? SER A 201 ? PRO A 188 SER A 201 1 ? 14 HELX_P HELX_P7 AA7 SER A 222 ? ASP A 236 ? SER A 222 ASP A 236 1 ? 15 HELX_P HELX_P8 AA8 ASP A 240 ? VAL A 244 ? ASP A 240 VAL A 244 5 ? 5 HELX_P HELX_P9 AA9 ASP A 245 ? ARG A 254 ? ASP A 245 ARG A 254 1 ? 10 HELX_P HELX_P10 AB1 THR A 263 ? MET A 282 ? THR A 263 MET A 282 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A LYS 197 NZ B ? ? 1_555 D WV0 . C1 ? ? A LYS 197 A WV0 703 1_555 ? ? ? ? ? ? ? 1.554 ? ? covale2 covale none ? A LYS 237 NZ A ? ? 1_555 C WV0 . C1 ? ? A LYS 237 A WV0 702 1_555 ? ? ? ? ? ? ? 1.361 ? ? covale3 covale none ? A LYS 237 NZ B ? ? 1_555 C WV0 . C1 ? ? A LYS 237 A WV0 702 1_555 ? ? ? ? ? ? ? 1.284 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 56 ? LYS A 58 ? ARG A 56 LYS A 58 AA1 2 TYR A 66 ? MET A 74 ? TYR A 66 MET A 74 AA1 3 ARG A 79 ? THR A 84 ? ARG A 79 THR A 84 AA1 4 VAL A 211 ? HIS A 214 ? VAL A 211 HIS A 214 AA1 5 GLY A 106 ? MET A 109 ? GLY A 106 MET A 109 AA1 6 THR A 168 ? TYR A 176 ? THR A 168 TYR A 176 AA1 7 TYR A 153 ? ASN A 162 ? TYR A 153 ASN A 162 AA1 8 LEU A 140 ? ILE A 149 ? LEU A 140 ILE A 149 AA1 9 MET A 133 ? PHE A 135 ? MET A 133 PHE A 135 AA2 1 MET A 114 ? GLU A 115 ? MET A 114 GLU A 115 AA2 2 SER A 118 ? LEU A 119 ? SER A 118 LEU A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 57 ? N ILE A 57 O ALA A 69 ? O ALA A 69 AA1 2 3 N ILE A 72 ? N ILE A 72 O TYR A 81 ? O TYR A 81 AA1 3 4 N ILE A 82 ? N ILE A 82 O VAL A 213 ? O VAL A 213 AA1 4 5 O VAL A 212 ? O VAL A 212 N VAL A 108 ? N VAL A 108 AA1 5 6 N VAL A 107 ? N VAL A 107 O PHE A 174 ? O PHE A 174 AA1 6 7 O HIS A 175 ? O HIS A 175 N THR A 154 ? N THR A 154 AA1 7 8 O GLU A 161 ? O GLU A 161 N LYS A 141 ? N LYS A 141 AA1 8 9 O LEU A 140 ? O LEU A 140 N PHE A 135 ? N PHE A 135 AA2 1 2 N GLU A 115 ? N GLU A 115 O SER A 118 ? O SER A 118 # _atom_sites.entry_id 7FQZ _atom_sites.fract_transf_matrix[1][1] 0.011167 _atom_sites.fract_transf_matrix[1][2] 0.006447 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012894 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009394 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C F H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 HIS 208 208 208 HIS HIS A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 HIS 214 214 214 HIS HIS A . n A 1 215 CYS 215 215 215 CYS CYS A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 CYS 226 226 226 CYS CYS A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 CYS 231 231 231 CYS CYS A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 LYS 247 247 247 LYS LYS A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 MET 253 253 253 MET MET A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 MET 258 258 258 MET MET A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 GLN 262 262 262 GLN GLN A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 MET 282 282 282 MET MET A . n A 1 283 GLY 283 283 ? ? ? A . n A 1 284 ASP 284 284 ? ? ? A . n A 1 285 SER 285 285 ? ? ? A . n A 1 286 SER 286 286 ? ? ? A . n A 1 287 VAL 287 287 ? ? ? A . n A 1 288 GLN 288 288 ? ? ? A . n A 1 289 ASP 289 289 ? ? ? A . n A 1 290 GLN 290 290 ? ? ? A . n A 1 291 TRP 291 291 ? ? ? A . n A 1 292 LYS 292 292 ? ? ? A . n A 1 293 GLU 293 293 ? ? ? A . n A 1 294 LEU 294 294 ? ? ? A . n A 1 295 SER 295 295 ? ? ? A . n A 1 296 HIS 296 296 ? ? ? A . n A 1 297 GLU 297 297 ? ? ? A . n A 1 298 ASP 298 298 ? ? ? A . n A 1 299 LEU 299 299 ? ? ? A . n A 1 300 GLU 300 300 ? ? ? A . n A 1 301 PRO 301 301 ? ? ? A . n A 1 302 PRO 302 302 ? ? ? A . n A 1 303 PRO 303 303 ? ? ? A . n A 1 304 GLU 304 304 ? ? ? A . n A 1 305 HIS 305 305 ? ? ? A . n A 1 306 ILE 306 306 ? ? ? A . n A 1 307 PRO 307 307 ? ? ? A . n A 1 308 PRO 308 308 ? ? ? A . n A 1 309 PRO 309 309 ? ? ? A . n A 1 310 PRO 310 310 ? ? ? A . n A 1 311 ARG 311 311 ? ? ? A . n A 1 312 PRO 312 312 ? ? ? A . n A 1 313 PRO 313 313 ? ? ? A . n A 1 314 LYS 314 314 ? ? ? A . n A 1 315 ARG 315 315 ? ? ? A . n A 1 316 ILE 316 316 ? ? ? A . n A 1 317 LEU 317 317 ? ? ? A . n A 1 318 GLU 318 318 ? ? ? A . n A 1 319 PRO 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 ASN 321 321 ? ? ? A . n # _pdbx_contact_author.id 1 _pdbx_contact_author.email dkeedy@gc.cuny.edu _pdbx_contact_author.name_first Daniel _pdbx_contact_author.name_last Keedy _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9184-7586 _pdbx_contact_author.name_mi ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TRS 1 701 701 TRS TRS A . C 3 WV0 1 702 802 WV0 LIG A . D 3 WV0 1 703 803 WV0 LIG A . E 4 HOH 1 801 522 HOH HOH A . E 4 HOH 2 802 539 HOH HOH A . E 4 HOH 3 803 404 HOH HOH A . E 4 HOH 4 804 491 HOH HOH A . E 4 HOH 5 805 439 HOH HOH A . E 4 HOH 6 806 406 HOH HOH A . E 4 HOH 7 807 643 HOH HOH A . E 4 HOH 8 808 425 HOH HOH A . E 4 HOH 9 809 562 HOH HOH A . E 4 HOH 10 810 413 HOH HOH A . E 4 HOH 11 811 477 HOH HOH A . E 4 HOH 12 812 471 HOH HOH A . E 4 HOH 13 813 621 HOH HOH A . E 4 HOH 14 814 639 HOH HOH A . E 4 HOH 15 815 520 HOH HOH A . E 4 HOH 16 816 641 HOH HOH A . E 4 HOH 17 817 642 HOH HOH A . E 4 HOH 18 818 531 HOH HOH A . E 4 HOH 19 819 574 HOH HOH A . E 4 HOH 20 820 419 HOH HOH A . E 4 HOH 21 821 412 HOH HOH A . E 4 HOH 22 822 496 HOH HOH A . E 4 HOH 23 823 447 HOH HOH A . E 4 HOH 24 824 499 HOH HOH A . E 4 HOH 25 825 415 HOH HOH A . E 4 HOH 26 826 431 HOH HOH A . E 4 HOH 27 827 484 HOH HOH A . E 4 HOH 28 828 427 HOH HOH A . E 4 HOH 29 829 442 HOH HOH A . E 4 HOH 30 830 448 HOH HOH A . E 4 HOH 31 831 403 HOH HOH A . E 4 HOH 32 832 645 HOH HOH A . E 4 HOH 33 833 443 HOH HOH A . E 4 HOH 34 834 423 HOH HOH A . E 4 HOH 35 835 475 HOH HOH A . E 4 HOH 36 836 434 HOH HOH A . E 4 HOH 37 837 482 HOH HOH A . E 4 HOH 38 838 454 HOH HOH A . E 4 HOH 39 839 617 HOH HOH A . E 4 HOH 40 840 449 HOH HOH A . E 4 HOH 41 841 432 HOH HOH A . E 4 HOH 42 842 474 HOH HOH A . E 4 HOH 43 843 444 HOH HOH A . E 4 HOH 44 844 507 HOH HOH A . E 4 HOH 45 845 560 HOH HOH A . E 4 HOH 46 846 424 HOH HOH A . E 4 HOH 47 847 455 HOH HOH A . E 4 HOH 48 848 649 HOH HOH A . E 4 HOH 49 849 500 HOH HOH A . E 4 HOH 50 850 488 HOH HOH A . E 4 HOH 51 851 555 HOH HOH A . E 4 HOH 52 852 472 HOH HOH A . E 4 HOH 53 853 505 HOH HOH A . E 4 HOH 54 854 436 HOH HOH A . E 4 HOH 55 855 625 HOH HOH A . E 4 HOH 56 856 430 HOH HOH A . E 4 HOH 57 857 530 HOH HOH A . E 4 HOH 58 858 498 HOH HOH A . E 4 HOH 59 859 469 HOH HOH A . E 4 HOH 60 860 623 HOH HOH A . E 4 HOH 61 861 545 HOH HOH A . E 4 HOH 62 862 501 HOH HOH A . E 4 HOH 63 863 512 HOH HOH A . E 4 HOH 64 864 493 HOH HOH A . E 4 HOH 65 865 437 HOH HOH A . E 4 HOH 66 866 521 HOH HOH A . E 4 HOH 67 867 568 HOH HOH A . E 4 HOH 68 868 547 HOH HOH A . E 4 HOH 69 869 518 HOH HOH A . E 4 HOH 70 870 571 HOH HOH A . E 4 HOH 71 871 497 HOH HOH A . E 4 HOH 72 872 506 HOH HOH A . E 4 HOH 73 873 483 HOH HOH A . E 4 HOH 74 874 533 HOH HOH A . E 4 HOH 75 875 514 HOH HOH A . E 4 HOH 76 876 603 HOH HOH A . E 4 HOH 77 877 510 HOH HOH A . E 4 HOH 78 878 540 HOH HOH A . E 4 HOH 79 879 651 HOH HOH A . E 4 HOH 80 880 451 HOH HOH A . E 4 HOH 81 881 450 HOH HOH A . E 4 HOH 82 882 440 HOH HOH A . E 4 HOH 83 883 502 HOH HOH A . E 4 HOH 84 884 426 HOH HOH A . E 4 HOH 85 885 516 HOH HOH A . E 4 HOH 86 886 438 HOH HOH A . E 4 HOH 87 887 508 HOH HOH A . E 4 HOH 88 888 409 HOH HOH A . E 4 HOH 89 889 529 HOH HOH A . E 4 HOH 90 890 481 HOH HOH A . E 4 HOH 91 891 527 HOH HOH A . E 4 HOH 92 892 647 HOH HOH A . E 4 HOH 93 893 421 HOH HOH A . E 4 HOH 94 894 544 HOH HOH A . E 4 HOH 95 895 648 HOH HOH A . E 4 HOH 96 896 628 HOH HOH A . E 4 HOH 97 897 563 HOH HOH A . E 4 HOH 98 898 569 HOH HOH A . E 4 HOH 99 899 479 HOH HOH A . E 4 HOH 100 900 487 HOH HOH A . E 4 HOH 101 901 570 HOH HOH A . E 4 HOH 102 902 656 HOH HOH A . E 4 HOH 103 903 433 HOH HOH A . E 4 HOH 104 904 600 HOH HOH A . E 4 HOH 105 905 478 HOH HOH A . E 4 HOH 106 906 626 HOH HOH A . E 4 HOH 107 907 549 HOH HOH A . E 4 HOH 108 908 644 HOH HOH A . E 4 HOH 109 909 630 HOH HOH A . E 4 HOH 110 910 546 HOH HOH A . E 4 HOH 111 911 551 HOH HOH A . E 4 HOH 112 912 573 HOH HOH A . E 4 HOH 113 913 577 HOH HOH A . E 4 HOH 114 914 534 HOH HOH A . E 4 HOH 115 915 492 HOH HOH A . E 4 HOH 116 916 511 HOH HOH A . E 4 HOH 117 917 552 HOH HOH A . E 4 HOH 118 918 579 HOH HOH A . E 4 HOH 119 919 489 HOH HOH A . E 4 HOH 120 920 528 HOH HOH A . E 4 HOH 121 921 543 HOH HOH A . E 4 HOH 122 922 453 HOH HOH A . E 4 HOH 123 923 655 HOH HOH A . E 4 HOH 124 924 495 HOH HOH A . E 4 HOH 125 925 558 HOH HOH A . E 4 HOH 126 926 585 HOH HOH A . E 4 HOH 127 927 580 HOH HOH A . E 4 HOH 128 928 633 HOH HOH A . E 4 HOH 129 929 653 HOH HOH A . E 4 HOH 130 930 575 HOH HOH A . E 4 HOH 131 931 622 HOH HOH A . E 4 HOH 132 932 584 HOH HOH A . E 4 HOH 133 933 588 HOH HOH A . E 4 HOH 134 934 557 HOH HOH A . E 4 HOH 135 935 581 HOH HOH A . E 4 HOH 136 936 634 HOH HOH A . E 4 HOH 137 937 542 HOH HOH A . E 4 HOH 138 938 494 HOH HOH A . E 4 HOH 139 939 538 HOH HOH A . E 4 HOH 140 940 578 HOH HOH A . E 4 HOH 141 941 591 HOH HOH A . E 4 HOH 142 942 646 HOH HOH A . E 4 HOH 143 943 597 HOH HOH A . E 4 HOH 144 944 470 HOH HOH A . E 4 HOH 145 945 463 HOH HOH A . E 4 HOH 146 946 638 HOH HOH A . E 4 HOH 147 947 652 HOH HOH A . E 4 HOH 148 948 598 HOH HOH A . E 4 HOH 149 949 654 HOH HOH A . E 4 HOH 150 950 599 HOH HOH A . E 4 HOH 151 951 650 HOH HOH A . E 4 HOH 152 952 631 HOH HOH A . E 4 HOH 153 953 632 HOH HOH A . E 4 HOH 154 954 627 HOH HOH A . E 4 HOH 155 955 637 HOH HOH A . E 4 HOH 156 956 605 HOH HOH A . E 4 HOH 157 957 417 HOH HOH A . E 4 HOH 158 958 611 HOH HOH A . E 4 HOH 159 959 486 HOH HOH A . E 4 HOH 160 960 624 HOH HOH A . E 4 HOH 161 961 604 HOH HOH A . E 4 HOH 162 962 629 HOH HOH A . E 4 HOH 163 963 480 HOH HOH A . E 4 HOH 164 964 612 HOH HOH A . E 4 HOH 165 965 411 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2023-03-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 REFMAC 5.8.0267 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 2 XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 3 PDB_EXTRACT 3.22 'July. 13, 2016' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 XDS . ? program ? ? 'data reduction' ? ? ? 5 DIMPLE . ? program ? ? phasing ? ? ? # _pdbx_entry_details.entry_id 7FQZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB3 A ASP 48 ? ? O A HOH 844 ? ? 0.87 2 1 O A ALA 278 ? ? H A MET 282 ? ? 1.43 3 1 O A ILE 261 ? ? H A THR 263 ? ? 1.56 4 1 HB A ILE 219 ? ? O A HOH 937 ? ? 1.58 5 1 CB A ASP 48 ? ? O A HOH 844 ? ? 1.83 6 1 O A HOH 818 ? ? O A HOH 847 ? ? 2.05 7 1 O A ILE 261 ? ? N A THR 263 ? ? 2.15 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 121 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 121 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CB _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 121 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 97.71 _pdbx_validate_rmsd_angle.angle_target_value 110.60 _pdbx_validate_rmsd_angle.angle_deviation -12.89 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.80 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 63 ? ? -58.04 -83.24 2 1 CYS A 121 ? ? -176.47 141.89 3 1 CYS A 215 ? ? -176.38 59.56 4 1 SER A 216 ? ? 78.58 -116.50 5 1 ALA A 217 ? ? -171.24 117.35 6 1 ILE A 219 ? ? 21.56 -76.44 7 1 ARG A 221 ? ? 34.84 -135.39 8 1 SER A 222 ? ? 30.54 -67.07 9 1 ILE A 261 ? ? 56.95 -8.25 10 1 GLN A 262 ? ? 11.84 -51.58 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 283 ? A GLY 283 3 1 Y 1 A ASP 284 ? A ASP 284 4 1 Y 1 A SER 285 ? A SER 285 5 1 Y 1 A SER 286 ? A SER 286 6 1 Y 1 A VAL 287 ? A VAL 287 7 1 Y 1 A GLN 288 ? A GLN 288 8 1 Y 1 A ASP 289 ? A ASP 289 9 1 Y 1 A GLN 290 ? A GLN 290 10 1 Y 1 A TRP 291 ? A TRP 291 11 1 Y 1 A LYS 292 ? A LYS 292 12 1 Y 1 A GLU 293 ? A GLU 293 13 1 Y 1 A LEU 294 ? A LEU 294 14 1 Y 1 A SER 295 ? A SER 295 15 1 Y 1 A HIS 296 ? A HIS 296 16 1 Y 1 A GLU 297 ? A GLU 297 17 1 Y 1 A ASP 298 ? A ASP 298 18 1 Y 1 A LEU 299 ? A LEU 299 19 1 Y 1 A GLU 300 ? A GLU 300 20 1 Y 1 A PRO 301 ? A PRO 301 21 1 Y 1 A PRO 302 ? A PRO 302 22 1 Y 1 A PRO 303 ? A PRO 303 23 1 Y 1 A GLU 304 ? A GLU 304 24 1 Y 1 A HIS 305 ? A HIS 305 25 1 Y 1 A ILE 306 ? A ILE 306 26 1 Y 1 A PRO 307 ? A PRO 307 27 1 Y 1 A PRO 308 ? A PRO 308 28 1 Y 1 A PRO 309 ? A PRO 309 29 1 Y 1 A PRO 310 ? A PRO 310 30 1 Y 1 A ARG 311 ? A ARG 311 31 1 Y 1 A PRO 312 ? A PRO 312 32 1 Y 1 A PRO 313 ? A PRO 313 33 1 Y 1 A LYS 314 ? A LYS 314 34 1 Y 1 A ARG 315 ? A ARG 315 35 1 Y 1 A ILE 316 ? A ILE 316 36 1 Y 1 A LEU 317 ? A LEU 317 37 1 Y 1 A GLU 318 ? A GLU 318 38 1 Y 1 A PRO 319 ? A PRO 319 39 1 Y 1 A HIS 320 ? A HIS 320 40 1 Y 1 A ASN 321 ? A ASN 321 # loop_ _pdbx_audit_support.ordinal _pdbx_audit_support.funding_organization _pdbx_audit_support.grant_number _pdbx_audit_support.country 1 'U.S. Department of Education Graduate Assistance in Areas of National Need (GAANN)' PA200A150068 'United States' 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' GM133769 'United States' # _pdbx_deposit_group.group_id G_1002251 _pdbx_deposit_group.group_description 'Human PTP1B re-screened with single-crystal RT crystallography at the XChem facility of Diamond Light Source' _pdbx_deposit_group.group_title 'PanDDA analysis group deposition' _pdbx_deposit_group.group_type 'changed state' # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id WV0 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id WV0 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 3 5-fluoro-1,3-dihydro-2H-indol-2-one WV0 4 water HOH #