data_7JI4 # _entry.id 7JI4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7JI4 pdb_00007ji4 10.2210/pdb7ji4/pdb WWPDB D_1000249740 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-26 2 'Structure model' 1 1 2021-07-21 3 'Structure model' 1 2 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7JI4 _pdbx_database_status.recvd_initial_deposition_date 2020-07-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dutta, A.' 1 ? 'Parashar, V.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 296 _citation.language ? _citation.page_first 100771 _citation.page_last 100771 _citation.title 'Structural basis of KdpD histidine kinase binding to the second messenger c-di-AMP.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2021.100771 _citation.pdbx_database_id_PubMed 33989637 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dutta, A.' 1 ? primary 'Batish, M.' 2 ? primary 'Parashar, V.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man KdpD 17653.535 1 ? ? 'Universal stress protein (USP) domain (UNP residues 213-364)' ? 2 non-polymer syn ;(2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8 ]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide ; 658.412 1 ? ? ? ? 3 water nat water 18.015 24 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Sensor protein, KdpD histidine kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TLRTVADLMSDKEKVRHNHKTSLKPHIAVAISGSIYNEAVIKEAFHIAQKEHAKFTAIYIDVFEKSRQYKDSQKQVHQHL MLAKSLGAKVKVVYSQTVALGLDEWCKNQDVTKLIIGQHIRNKRRDFFNKPLIDHLMSFEHSYKIEIVPIKQ ; _entity_poly.pdbx_seq_one_letter_code_can ;TLRTVADLMSDKEKVRHNHKTSLKPHIAVAISGSIYNEAVIKEAFHIAQKEHAKFTAIYIDVFEKSRQYKDSQKQVHQHL MLAKSLGAKVKVVYSQTVALGLDEWCKNQDVTKLIIGQHIRNKRRDFFNKPLIDHLMSFEHSYKIEIVPIKQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8 ]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide ; 2BA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 LEU n 1 3 ARG n 1 4 THR n 1 5 VAL n 1 6 ALA n 1 7 ASP n 1 8 LEU n 1 9 MET n 1 10 SER n 1 11 ASP n 1 12 LYS n 1 13 GLU n 1 14 LYS n 1 15 VAL n 1 16 ARG n 1 17 HIS n 1 18 ASN n 1 19 HIS n 1 20 LYS n 1 21 THR n 1 22 SER n 1 23 LEU n 1 24 LYS n 1 25 PRO n 1 26 HIS n 1 27 ILE n 1 28 ALA n 1 29 VAL n 1 30 ALA n 1 31 ILE n 1 32 SER n 1 33 GLY n 1 34 SER n 1 35 ILE n 1 36 TYR n 1 37 ASN n 1 38 GLU n 1 39 ALA n 1 40 VAL n 1 41 ILE n 1 42 LYS n 1 43 GLU n 1 44 ALA n 1 45 PHE n 1 46 HIS n 1 47 ILE n 1 48 ALA n 1 49 GLN n 1 50 LYS n 1 51 GLU n 1 52 HIS n 1 53 ALA n 1 54 LYS n 1 55 PHE n 1 56 THR n 1 57 ALA n 1 58 ILE n 1 59 TYR n 1 60 ILE n 1 61 ASP n 1 62 VAL n 1 63 PHE n 1 64 GLU n 1 65 LYS n 1 66 SER n 1 67 ARG n 1 68 GLN n 1 69 TYR n 1 70 LYS n 1 71 ASP n 1 72 SER n 1 73 GLN n 1 74 LYS n 1 75 GLN n 1 76 VAL n 1 77 HIS n 1 78 GLN n 1 79 HIS n 1 80 LEU n 1 81 MET n 1 82 LEU n 1 83 ALA n 1 84 LYS n 1 85 SER n 1 86 LEU n 1 87 GLY n 1 88 ALA n 1 89 LYS n 1 90 VAL n 1 91 LYS n 1 92 VAL n 1 93 VAL n 1 94 TYR n 1 95 SER n 1 96 GLN n 1 97 THR n 1 98 VAL n 1 99 ALA n 1 100 LEU n 1 101 GLY n 1 102 LEU n 1 103 ASP n 1 104 GLU n 1 105 TRP n 1 106 CYS n 1 107 LYS n 1 108 ASN n 1 109 GLN n 1 110 ASP n 1 111 VAL n 1 112 THR n 1 113 LYS n 1 114 LEU n 1 115 ILE n 1 116 ILE n 1 117 GLY n 1 118 GLN n 1 119 HIS n 1 120 ILE n 1 121 ARG n 1 122 ASN n 1 123 LYS n 1 124 ARG n 1 125 ARG n 1 126 ASP n 1 127 PHE n 1 128 PHE n 1 129 ASN n 1 130 LYS n 1 131 PRO n 1 132 LEU n 1 133 ILE n 1 134 ASP n 1 135 HIS n 1 136 LEU n 1 137 MET n 1 138 SER n 1 139 PHE n 1 140 GLU n 1 141 HIS n 1 142 SER n 1 143 TYR n 1 144 LYS n 1 145 ILE n 1 146 GLU n 1 147 ILE n 1 148 VAL n 1 149 PRO n 1 150 ILE n 1 151 LYS n 1 152 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 152 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'kdpD_1, ERS072840_01892, SAMEA1469884_01983, SAMEA1531680_02090, SAMEA1531701_02007, SAST44_02327, SAST45_02303' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus MRSA252' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 282458 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant C41 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBB75 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2BA non-polymer . ;(2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8 ]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide ; "bis-(3',5')-cyclic-dimeric-Adenosine-monophosphate" 'C20 H24 N10 O12 P2' 658.412 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 213 ? ? ? A . n A 1 2 LEU 2 214 ? ? ? A . n A 1 3 ARG 3 215 ? ? ? A . n A 1 4 THR 4 216 ? ? ? A . n A 1 5 VAL 5 217 ? ? ? A . n A 1 6 ALA 6 218 ? ? ? A . n A 1 7 ASP 7 219 ? ? ? A . n A 1 8 LEU 8 220 ? ? ? A . n A 1 9 MET 9 221 ? ? ? A . n A 1 10 SER 10 222 ? ? ? A . n A 1 11 ASP 11 223 ? ? ? A . n A 1 12 LYS 12 224 ? ? ? A . n A 1 13 GLU 13 225 ? ? ? A . n A 1 14 LYS 14 226 ? ? ? A . n A 1 15 VAL 15 227 ? ? ? A . n A 1 16 ARG 16 228 ? ? ? A . n A 1 17 HIS 17 229 ? ? ? A . n A 1 18 ASN 18 230 ? ? ? A . n A 1 19 HIS 19 231 ? ? ? A . n A 1 20 LYS 20 232 ? ? ? A . n A 1 21 THR 21 233 ? ? ? A . n A 1 22 SER 22 234 ? ? ? A . n A 1 23 LEU 23 235 ? ? ? A . n A 1 24 LYS 24 236 236 LYS LYS A . n A 1 25 PRO 25 237 237 PRO PRO A . n A 1 26 HIS 26 238 238 HIS HIS A . n A 1 27 ILE 27 239 239 ILE ILE A . n A 1 28 ALA 28 240 240 ALA ALA A . n A 1 29 VAL 29 241 241 VAL VAL A . n A 1 30 ALA 30 242 242 ALA ALA A . n A 1 31 ILE 31 243 243 ILE ILE A . n A 1 32 SER 32 244 244 SER SER A . n A 1 33 GLY 33 245 245 GLY GLY A . n A 1 34 SER 34 246 246 SER SER A . n A 1 35 ILE 35 247 247 ILE ILE A . n A 1 36 TYR 36 248 248 TYR TYR A . n A 1 37 ASN 37 249 249 ASN ASN A . n A 1 38 GLU 38 250 250 GLU GLU A . n A 1 39 ALA 39 251 251 ALA ALA A . n A 1 40 VAL 40 252 252 VAL VAL A . n A 1 41 ILE 41 253 253 ILE ILE A . n A 1 42 LYS 42 254 254 LYS LYS A . n A 1 43 GLU 43 255 255 GLU GLU A . n A 1 44 ALA 44 256 256 ALA ALA A . n A 1 45 PHE 45 257 257 PHE PHE A . n A 1 46 HIS 46 258 258 HIS HIS A . n A 1 47 ILE 47 259 259 ILE ILE A . n A 1 48 ALA 48 260 260 ALA ALA A . n A 1 49 GLN 49 261 261 GLN GLN A . n A 1 50 LYS 50 262 262 LYS LYS A . n A 1 51 GLU 51 263 263 GLU GLU A . n A 1 52 HIS 52 264 264 HIS HIS A . n A 1 53 ALA 53 265 265 ALA ALA A . n A 1 54 LYS 54 266 266 LYS LYS A . n A 1 55 PHE 55 267 267 PHE PHE A . n A 1 56 THR 56 268 268 THR THR A . n A 1 57 ALA 57 269 269 ALA ALA A . n A 1 58 ILE 58 270 270 ILE ILE A . n A 1 59 TYR 59 271 271 TYR TYR A . n A 1 60 ILE 60 272 272 ILE ILE A . n A 1 61 ASP 61 273 273 ASP ASP A . n A 1 62 VAL 62 274 274 VAL VAL A . n A 1 63 PHE 63 275 275 PHE PHE A . n A 1 64 GLU 64 276 276 GLU GLU A . n A 1 65 LYS 65 277 ? ? ? A . n A 1 66 SER 66 278 ? ? ? A . n A 1 67 ARG 67 279 ? ? ? A . n A 1 68 GLN 68 280 280 GLN GLN A . n A 1 69 TYR 69 281 281 TYR TYR A . n A 1 70 LYS 70 282 282 LYS LYS A . n A 1 71 ASP 71 283 283 ASP ASP A . n A 1 72 SER 72 284 284 SER SER A . n A 1 73 GLN 73 285 285 GLN GLN A . n A 1 74 LYS 74 286 286 LYS LYS A . n A 1 75 GLN 75 287 287 GLN GLN A . n A 1 76 VAL 76 288 288 VAL VAL A . n A 1 77 HIS 77 289 289 HIS HIS A . n A 1 78 GLN 78 290 290 GLN GLN A . n A 1 79 HIS 79 291 291 HIS HIS A . n A 1 80 LEU 80 292 292 LEU LEU A . n A 1 81 MET 81 293 293 MET MET A . n A 1 82 LEU 82 294 294 LEU LEU A . n A 1 83 ALA 83 295 295 ALA ALA A . n A 1 84 LYS 84 296 296 LYS LYS A . n A 1 85 SER 85 297 297 SER SER A . n A 1 86 LEU 86 298 298 LEU LEU A . n A 1 87 GLY 87 299 299 GLY GLY A . n A 1 88 ALA 88 300 300 ALA ALA A . n A 1 89 LYS 89 301 301 LYS LYS A . n A 1 90 VAL 90 302 302 VAL VAL A . n A 1 91 LYS 91 303 303 LYS LYS A . n A 1 92 VAL 92 304 304 VAL VAL A . n A 1 93 VAL 93 305 305 VAL VAL A . n A 1 94 TYR 94 306 306 TYR TYR A . n A 1 95 SER 95 307 307 SER SER A . n A 1 96 GLN 96 308 308 GLN GLN A . n A 1 97 THR 97 309 309 THR THR A . n A 1 98 VAL 98 310 310 VAL VAL A . n A 1 99 ALA 99 311 311 ALA ALA A . n A 1 100 LEU 100 312 312 LEU LEU A . n A 1 101 GLY 101 313 313 GLY GLY A . n A 1 102 LEU 102 314 314 LEU LEU A . n A 1 103 ASP 103 315 315 ASP ASP A . n A 1 104 GLU 104 316 316 GLU GLU A . n A 1 105 TRP 105 317 317 TRP TRP A . n A 1 106 CYS 106 318 318 CYS CYS A . n A 1 107 LYS 107 319 319 LYS LYS A . n A 1 108 ASN 108 320 320 ASN ASN A . n A 1 109 GLN 109 321 321 GLN GLN A . n A 1 110 ASP 110 322 322 ASP ASP A . n A 1 111 VAL 111 323 323 VAL VAL A . n A 1 112 THR 112 324 324 THR THR A . n A 1 113 LYS 113 325 325 LYS LYS A . n A 1 114 LEU 114 326 326 LEU LEU A . n A 1 115 ILE 115 327 327 ILE ILE A . n A 1 116 ILE 116 328 328 ILE ILE A . n A 1 117 GLY 117 329 329 GLY GLY A . n A 1 118 GLN 118 330 330 GLN GLN A . n A 1 119 HIS 119 331 331 HIS HIS A . n A 1 120 ILE 120 332 332 ILE ILE A . n A 1 121 ARG 121 333 333 ARG ARG A . n A 1 122 ASN 122 334 334 ASN ASN A . n A 1 123 LYS 123 335 335 LYS LYS A . n A 1 124 ARG 124 336 336 ARG ARG A . n A 1 125 ARG 125 337 337 ARG ARG A . n A 1 126 ASP 126 338 338 ASP ASP A . n A 1 127 PHE 127 339 339 PHE PHE A . n A 1 128 PHE 128 340 340 PHE PHE A . n A 1 129 ASN 129 341 341 ASN ASN A . n A 1 130 LYS 130 342 342 LYS LYS A . n A 1 131 PRO 131 343 343 PRO PRO A . n A 1 132 LEU 132 344 344 LEU LEU A . n A 1 133 ILE 133 345 345 ILE ILE A . n A 1 134 ASP 134 346 346 ASP ASP A . n A 1 135 HIS 135 347 347 HIS HIS A . n A 1 136 LEU 136 348 348 LEU LEU A . n A 1 137 MET 137 349 349 MET MET A . n A 1 138 SER 138 350 350 SER SER A . n A 1 139 PHE 139 351 351 PHE PHE A . n A 1 140 GLU 140 352 352 GLU GLU A . n A 1 141 HIS 141 353 353 HIS HIS A . n A 1 142 SER 142 354 354 SER SER A . n A 1 143 TYR 143 355 355 TYR TYR A . n A 1 144 LYS 144 356 356 LYS LYS A . n A 1 145 ILE 145 357 357 ILE ILE A . n A 1 146 GLU 146 358 358 GLU GLU A . n A 1 147 ILE 147 359 359 ILE ILE A . n A 1 148 VAL 148 360 360 VAL VAL A . n A 1 149 PRO 149 361 361 PRO PRO A . n A 1 150 ILE 150 362 362 ILE ILE A . n A 1 151 LYS 151 363 363 LYS LYS A . n A 1 152 GLN 152 364 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 2BA 1 401 1 2BA 2BA A . C 3 HOH 1 501 22 HOH HOH A . C 3 HOH 2 502 2 HOH HOH A . C 3 HOH 3 503 18 HOH HOH A . C 3 HOH 4 504 1 HOH HOH A . C 3 HOH 5 505 8 HOH HOH A . C 3 HOH 6 506 21 HOH HOH A . C 3 HOH 7 507 4 HOH HOH A . C 3 HOH 8 508 23 HOH HOH A . C 3 HOH 9 509 17 HOH HOH A . C 3 HOH 10 510 3 HOH HOH A . C 3 HOH 11 511 6 HOH HOH A . C 3 HOH 12 512 28 HOH HOH A . C 3 HOH 13 513 20 HOH HOH A . C 3 HOH 14 514 16 HOH HOH A . C 3 HOH 15 515 9 HOH HOH A . C 3 HOH 16 516 11 HOH HOH A . C 3 HOH 17 517 14 HOH HOH A . C 3 HOH 18 518 10 HOH HOH A . C 3 HOH 19 519 7 HOH HOH A . C 3 HOH 20 520 24 HOH HOH A . C 3 HOH 21 521 25 HOH HOH A . C 3 HOH 22 522 15 HOH HOH A . C 3 HOH 23 523 26 HOH HOH A . C 3 HOH 24 524 29 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 236 ? CG ? A LYS 24 CG 2 1 Y 1 A LYS 236 ? CD ? A LYS 24 CD 3 1 Y 1 A LYS 236 ? CE ? A LYS 24 CE 4 1 Y 1 A LYS 236 ? NZ ? A LYS 24 NZ 5 1 Y 1 A GLU 250 ? CG ? A GLU 38 CG 6 1 Y 1 A GLU 250 ? CD ? A GLU 38 CD 7 1 Y 1 A GLU 250 ? OE1 ? A GLU 38 OE1 8 1 Y 1 A GLU 250 ? OE2 ? A GLU 38 OE2 9 1 Y 1 A LYS 262 ? CG ? A LYS 50 CG 10 1 Y 1 A LYS 262 ? CD ? A LYS 50 CD 11 1 Y 1 A LYS 262 ? CE ? A LYS 50 CE 12 1 Y 1 A LYS 262 ? NZ ? A LYS 50 NZ 13 1 Y 1 A GLU 276 ? CG ? A GLU 64 CG 14 1 Y 1 A GLU 276 ? CD ? A GLU 64 CD 15 1 Y 1 A GLU 276 ? OE1 ? A GLU 64 OE1 16 1 Y 1 A GLU 276 ? OE2 ? A GLU 64 OE2 17 1 Y 1 A GLN 280 ? CG ? A GLN 68 CG 18 1 Y 1 A GLN 280 ? CD ? A GLN 68 CD 19 1 Y 1 A GLN 280 ? OE1 ? A GLN 68 OE1 20 1 Y 1 A GLN 280 ? NE2 ? A GLN 68 NE2 21 1 Y 1 A LYS 282 ? CG ? A LYS 70 CG 22 1 Y 1 A LYS 282 ? CD ? A LYS 70 CD 23 1 Y 1 A LYS 282 ? CE ? A LYS 70 CE 24 1 Y 1 A LYS 282 ? NZ ? A LYS 70 NZ 25 1 Y 1 A ASP 283 ? CG ? A ASP 71 CG 26 1 Y 1 A ASP 283 ? OD1 ? A ASP 71 OD1 27 1 Y 1 A ASP 283 ? OD2 ? A ASP 71 OD2 28 1 Y 1 A SER 284 ? OG ? A SER 72 OG 29 1 Y 1 A GLN 285 ? CG ? A GLN 73 CG 30 1 Y 1 A GLN 285 ? CD ? A GLN 73 CD 31 1 Y 1 A GLN 285 ? OE1 ? A GLN 73 OE1 32 1 Y 1 A GLN 285 ? NE2 ? A GLN 73 NE2 33 1 Y 1 A LYS 286 ? CG ? A LYS 74 CG 34 1 Y 1 A LYS 286 ? CD ? A LYS 74 CD 35 1 Y 1 A LYS 286 ? CE ? A LYS 74 CE 36 1 Y 1 A LYS 286 ? NZ ? A LYS 74 NZ 37 1 Y 1 A LYS 301 ? CG ? A LYS 89 CG 38 1 Y 1 A LYS 301 ? CD ? A LYS 89 CD 39 1 Y 1 A LYS 301 ? CE ? A LYS 89 CE 40 1 Y 1 A LYS 301 ? NZ ? A LYS 89 NZ 41 1 Y 1 A LYS 319 ? CG ? A LYS 107 CG 42 1 Y 1 A LYS 319 ? CD ? A LYS 107 CD 43 1 Y 1 A LYS 319 ? CE ? A LYS 107 CE 44 1 Y 1 A LYS 319 ? NZ ? A LYS 107 NZ 45 1 Y 1 A LYS 335 ? CG ? A LYS 123 CG 46 1 Y 1 A LYS 335 ? CD ? A LYS 123 CD 47 1 Y 1 A LYS 335 ? CE ? A LYS 123 CE 48 1 Y 1 A LYS 335 ? NZ ? A LYS 123 NZ 49 1 Y 1 A ARG 336 ? CG ? A ARG 124 CG 50 1 Y 1 A ARG 336 ? CD ? A ARG 124 CD 51 1 Y 1 A ARG 336 ? NE ? A ARG 124 NE 52 1 Y 1 A ARG 336 ? CZ ? A ARG 124 CZ 53 1 Y 1 A ARG 336 ? NH1 ? A ARG 124 NH1 54 1 Y 1 A ARG 336 ? NH2 ? A ARG 124 NH2 55 1 Y 1 A ARG 337 ? CG ? A ARG 125 CG 56 1 Y 1 A ARG 337 ? CD ? A ARG 125 CD 57 1 Y 1 A ARG 337 ? NE ? A ARG 125 NE 58 1 Y 1 A ARG 337 ? CZ ? A ARG 125 CZ 59 1 Y 1 A ARG 337 ? NH1 ? A ARG 125 NH1 60 1 Y 1 A ARG 337 ? NH2 ? A ARG 125 NH2 61 1 Y 1 A LYS 363 ? CG ? A LYS 151 CG 62 1 Y 1 A LYS 363 ? CD ? A LYS 151 CD 63 1 Y 1 A LYS 363 ? CE ? A LYS 151 CE 64 1 Y 1 A LYS 363 ? NZ ? A LYS 151 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1-3660-000 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7JI4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.411 _cell.length_a_esd ? _cell.length_b 54.411 _cell.length_b_esd ? _cell.length_c 96.526 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7JI4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7JI4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.11 M lithium sulfate, 0.1 M Tris-HCl, pH 8.5, 21% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-07-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(220)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97741 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97741 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7JI4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.300 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6957 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.700 _reflns.pdbx_Rmerge_I_obs 0.112 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.003 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.115 _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 164630 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.300 2.340 ? ? ? ? ? ? 331 99.100 ? ? ? ? 0.444 ? ? ? ? ? ? ? ? 21.800 ? 0.987 ? ? 0.454 0.092 ? 1 1 0.982 ? ? 2.340 2.380 ? ? ? ? ? ? 340 100.000 ? ? ? ? 0.474 ? ? ? ? ? ? ? ? 21.400 ? 0.957 ? ? 0.485 0.101 ? 2 1 0.986 ? ? 2.380 2.430 ? ? ? ? ? ? 340 100.000 ? ? ? ? 0.407 ? ? ? ? ? ? ? ? 23.100 ? 1.004 ? ? 0.415 0.084 ? 3 1 0.984 ? ? 2.430 2.480 ? ? ? ? ? ? 339 100.000 ? ? ? ? 0.394 ? ? ? ? ? ? ? ? 24.400 ? 0.996 ? ? 0.402 0.079 ? 4 1 0.989 ? ? 2.480 2.530 ? ? ? ? ? ? 327 100.000 ? ? ? ? 0.361 ? ? ? ? ? ? ? ? 25.000 ? 1.044 ? ? 0.368 0.072 ? 5 1 0.988 ? ? 2.530 2.590 ? ? ? ? ? ? 345 100.000 ? ? ? ? 0.295 ? ? ? ? ? ? ? ? 24.300 ? 0.961 ? ? 0.302 0.060 ? 6 1 0.993 ? ? 2.590 2.660 ? ? ? ? ? ? 324 100.000 ? ? ? ? 0.274 ? ? ? ? ? ? ? ? 24.300 ? 1.025 ? ? 0.280 0.056 ? 7 1 0.990 ? ? 2.660 2.730 ? ? ? ? ? ? 352 100.000 ? ? ? ? 0.242 ? ? ? ? ? ? ? ? 23.200 ? 1.001 ? ? 0.248 0.050 ? 8 1 0.991 ? ? 2.730 2.810 ? ? ? ? ? ? 336 100.000 ? ? ? ? 0.214 ? ? ? ? ? ? ? ? 25.000 ? 0.993 ? ? 0.219 0.043 ? 9 1 0.995 ? ? 2.810 2.900 ? ? ? ? ? ? 334 100.000 ? ? ? ? 0.187 ? ? ? ? ? ? ? ? 24.500 ? 1.002 ? ? 0.191 0.038 ? 10 1 0.996 ? ? 2.900 3.000 ? ? ? ? ? ? 344 100.000 ? ? ? ? 0.174 ? ? ? ? ? ? ? ? 23.800 ? 0.989 ? ? 0.178 0.035 ? 11 1 0.995 ? ? 3.000 3.120 ? ? ? ? ? ? 345 100.000 ? ? ? ? 0.161 ? ? ? ? ? ? ? ? 25.400 ? 1.012 ? ? 0.164 0.032 ? 12 1 0.994 ? ? 3.120 3.260 ? ? ? ? ? ? 344 100.000 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 24.700 ? 1.000 ? ? 0.149 0.029 ? 13 1 0.994 ? ? 3.260 3.440 ? ? ? ? ? ? 345 100.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 24.000 ? 0.994 ? ? 0.138 0.028 ? 14 1 0.995 ? ? 3.440 3.650 ? ? ? ? ? ? 353 100.000 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 23.600 ? 1.037 ? ? 0.130 0.026 ? 15 1 0.996 ? ? 3.650 3.930 ? ? ? ? ? ? 352 100.000 ? ? ? ? 0.120 ? ? ? ? ? ? ? ? 23.600 ? 0.912 ? ? 0.123 0.025 ? 16 1 0.998 ? ? 3.930 4.330 ? ? ? ? ? ? 349 100.000 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 24.700 ? 0.989 ? ? 0.111 0.022 ? 17 1 0.996 ? ? 4.330 4.950 ? ? ? ? ? ? 367 100.000 ? ? ? ? 0.101 ? ? ? ? ? ? ? ? 23.500 ? 1.014 ? ? 0.104 0.021 ? 18 1 0.997 ? ? 4.950 6.240 ? ? ? ? ? ? 367 100.000 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 22.900 ? 1.058 ? ? 0.094 0.019 ? 19 1 0.998 ? ? 6.240 50.000 ? ? ? ? ? ? 423 100.000 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 20.800 ? 1.071 ? ? 0.091 0.019 ? 20 1 0.997 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 100.260 _refine.B_iso_mean 63.4322 _refine.B_iso_min 41.420 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7JI4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 47.4000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6897 _refine.ls_number_reflns_R_free 692 _refine.ls_number_reflns_R_work 6205 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8300 _refine.ls_percent_reflns_R_free 10.0300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2118 _refine.ls_R_factor_R_free 0.2490 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2077 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.8900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 47.4000 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1025 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 125 _refine_hist.pdbx_B_iso_mean_ligand 56.72 _refine_hist.pdbx_B_iso_mean_solvent 65.43 _refine_hist.pdbx_number_atoms_protein 957 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 44 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3000 2.4800 1336 . 134 1202 99.0000 . . . 0.3117 0.0000 0.2399 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.4800 2.7300 1341 . 136 1205 100.0000 . . . 0.3490 0.0000 0.2406 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.7300 3.1200 1353 . 135 1218 100.0000 . . . 0.3134 0.0000 0.2485 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.1200 3.9300 1387 . 138 1249 100.0000 . . . 0.2555 0.0000 0.2241 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.9300 47.4000 1480 . 149 1331 100.0000 . . . 0.2089 0.0000 0.1835 . . . . . . . 5 . . . # _struct.entry_id 7JI4 _struct.title 'Universal stress protein (USP) domain of KdpD histidine kinase in complex with second messenger c-di-AMP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7JI4 _struct_keywords.text 'Universal stress protein, histidine kinase, second messenger, two component system, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A167RS01_STAAU _struct_ref.pdbx_db_accession A0A167RS01 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TLRTVADLMSDKEKVRHNHKTSLKPHIAVAISGSIYNEAVIKEAFHIAQKEHAKFTAIYIDVFEKSRQYKDSQKQVHQHL MLAKSLGAKVKVVYSQTVALGLDEWCKNQDVTKLIIGQHIRNKRRDFFNKPLIDHLMSFEHSYKIEIVPIKQ ; _struct_ref.pdbx_align_begin 213 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7JI4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A167RS01 _struct_ref_seq.db_align_beg 213 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 364 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 213 _struct_ref_seq.pdbx_auth_seq_align_end 364 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 36 ? GLU A 51 ? TYR A 248 GLU A 263 1 ? 16 HELX_P HELX_P2 AA2 SER A 72 ? LEU A 86 ? SER A 284 LEU A 298 1 ? 15 HELX_P HELX_P3 AA3 THR A 97 ? GLN A 109 ? THR A 309 GLN A 321 1 ? 13 HELX_P HELX_P4 AA4 ASP A 126 ? LYS A 130 ? ASP A 338 LYS A 342 5 ? 5 HELX_P HELX_P5 AA5 PRO A 131 ? PHE A 139 ? PRO A 343 PHE A 351 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 89 ? TYR A 94 ? LYS A 301 TYR A 306 AA1 2 LYS A 54 ? ASP A 61 ? LYS A 266 ASP A 273 AA1 3 HIS A 26 ? ILE A 31 ? HIS A 238 ILE A 243 AA1 4 LYS A 113 ? GLY A 117 ? LYS A 325 GLY A 329 AA1 5 LYS A 144 ? VAL A 148 ? LYS A 356 VAL A 360 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 93 ? O VAL A 305 N ASP A 61 ? N ASP A 273 AA1 2 3 O LYS A 54 ? O LYS A 266 N ILE A 27 ? N ILE A 239 AA1 3 4 N ALA A 28 ? N ALA A 240 O ILE A 115 ? O ILE A 327 AA1 4 5 N LEU A 114 ? N LEU A 326 O LYS A 144 ? O LYS A 356 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 2BA _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 25 _struct_site.details 'binding site for residue 2BA A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 25 ALA A 30 ? ALA A 242 . ? 1_555 ? 2 AC1 25 ILE A 31 ? ILE A 243 . ? 1_555 ? 3 AC1 25 SER A 32 ? SER A 244 . ? 1_555 ? 4 AC1 25 GLY A 33 ? GLY A 245 . ? 1_555 ? 5 AC1 25 SER A 34 ? SER A 246 . ? 1_555 ? 6 AC1 25 TYR A 36 ? TYR A 248 . ? 1_555 ? 7 AC1 25 ASN A 37 ? ASN A 249 . ? 1_555 ? 8 AC1 25 ILE A 58 ? ILE A 270 . ? 1_555 ? 9 AC1 25 ILE A 60 ? ILE A 272 . ? 1_555 ? 10 AC1 25 TYR A 69 ? TYR A 281 . ? 1_555 ? 11 AC1 25 VAL A 98 ? VAL A 310 . ? 1_555 ? 12 AC1 25 ILE A 116 ? ILE A 328 . ? 1_555 ? 13 AC1 25 GLY A 117 ? GLY A 329 . ? 1_555 ? 14 AC1 25 HIS A 119 ? HIS A 331 . ? 1_555 ? 15 AC1 25 PRO A 131 ? PRO A 343 . ? 1_555 ? 16 AC1 25 LEU A 132 ? LEU A 344 . ? 1_555 ? 17 AC1 25 HOH C . ? HOH A 502 . ? 1_555 ? 18 AC1 25 HOH C . ? HOH A 504 . ? 1_555 ? 19 AC1 25 HOH C . ? HOH A 509 . ? 1_555 ? 20 AC1 25 HOH C . ? HOH A 510 . ? 1_555 ? 21 AC1 25 HOH C . ? HOH A 511 . ? 1_555 ? 22 AC1 25 HOH C . ? HOH A 514 . ? 1_555 ? 23 AC1 25 HOH C . ? HOH A 516 . ? 1_555 ? 24 AC1 25 HOH C . ? HOH A 518 . ? 1_555 ? 25 AC1 25 HOH C . ? HOH A 519 . ? 1_555 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 334 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -127.75 _pdbx_validate_torsion.psi -164.31 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 506 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_phasing_MR.entry_id 7JI4 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.300 _pdbx_phasing_MR.d_res_low_rotation 47.400 _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 7JI4 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 213 ? A THR 1 2 1 Y 1 A LEU 214 ? A LEU 2 3 1 Y 1 A ARG 215 ? A ARG 3 4 1 Y 1 A THR 216 ? A THR 4 5 1 Y 1 A VAL 217 ? A VAL 5 6 1 Y 1 A ALA 218 ? A ALA 6 7 1 Y 1 A ASP 219 ? A ASP 7 8 1 Y 1 A LEU 220 ? A LEU 8 9 1 Y 1 A MET 221 ? A MET 9 10 1 Y 1 A SER 222 ? A SER 10 11 1 Y 1 A ASP 223 ? A ASP 11 12 1 Y 1 A LYS 224 ? A LYS 12 13 1 Y 1 A GLU 225 ? A GLU 13 14 1 Y 1 A LYS 226 ? A LYS 14 15 1 Y 1 A VAL 227 ? A VAL 15 16 1 Y 1 A ARG 228 ? A ARG 16 17 1 Y 1 A HIS 229 ? A HIS 17 18 1 Y 1 A ASN 230 ? A ASN 18 19 1 Y 1 A HIS 231 ? A HIS 19 20 1 Y 1 A LYS 232 ? A LYS 20 21 1 Y 1 A THR 233 ? A THR 21 22 1 Y 1 A SER 234 ? A SER 22 23 1 Y 1 A LEU 235 ? A LEU 23 24 1 Y 1 A LYS 277 ? A LYS 65 25 1 Y 1 A SER 278 ? A SER 66 26 1 Y 1 A ARG 279 ? A ARG 67 27 1 Y 1 A GLN 364 ? A GLN 152 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2BA P P N R 1 2BA O1P O N N 2 2BA O2P O N N 3 2BA "O5'" O N N 4 2BA "C5'" C N N 5 2BA "C4'" C N R 6 2BA "O4'" O N N 7 2BA "C3'" C N S 8 2BA "O3'" O N N 9 2BA "C2'" C N R 10 2BA "O2'" O N N 11 2BA "C1'" C N R 12 2BA N9 N Y N 13 2BA C8 C Y N 14 2BA N7 N Y N 15 2BA C5 C Y N 16 2BA C6 C Y N 17 2BA N6 N N N 18 2BA N1 N Y N 19 2BA C2 C Y N 20 2BA N3 N Y N 21 2BA C4 C Y N 22 2BA P1 P N R 23 2BA O1P1 O N N 24 2BA O2P1 O N N 25 2BA "O5'1" O N N 26 2BA "C5'1" C N N 27 2BA "C4'1" C N R 28 2BA "O4'1" O N N 29 2BA "C3'1" C N S 30 2BA "O3'1" O N N 31 2BA "C2'1" C N R 32 2BA "O2'1" O N N 33 2BA "C1'1" C N R 34 2BA N91 N Y N 35 2BA C81 C Y N 36 2BA N71 N Y N 37 2BA C51 C Y N 38 2BA C61 C Y N 39 2BA N61 N N N 40 2BA N11 N Y N 41 2BA C21 C Y N 42 2BA N31 N Y N 43 2BA C41 C Y N 44 2BA "H5'" H N N 45 2BA "H5'A" H N N 46 2BA "H4'" H N N 47 2BA "H3'" H N N 48 2BA "H2'" H N N 49 2BA "HO2'" H N N 50 2BA "H1'" H N N 51 2BA H8 H N N 52 2BA HN6 H N N 53 2BA HN6A H N N 54 2BA H2 H N N 55 2BA "HC5'" H N N 56 2BA HC5A H N N 57 2BA "HC4'" H N N 58 2BA "HC3'" H N N 59 2BA "HC2'" H N N 60 2BA HO2A H N N 61 2BA "HC1'" H N N 62 2BA HC8 H N N 63 2BA H1N6 H N N 64 2BA H1NA H N N 65 2BA HC2 H N N 66 2BA H2P H N N 67 2BA H2OP H N N 68 ALA N N N N 69 ALA CA C N S 70 ALA C C N N 71 ALA O O N N 72 ALA CB C N N 73 ALA OXT O N N 74 ALA H H N N 75 ALA H2 H N N 76 ALA HA H N N 77 ALA HB1 H N N 78 ALA HB2 H N N 79 ALA HB3 H N N 80 ALA HXT H N N 81 ARG N N N N 82 ARG CA C N S 83 ARG C C N N 84 ARG O O N N 85 ARG CB C N N 86 ARG CG C N N 87 ARG CD C N N 88 ARG NE N N N 89 ARG CZ C N N 90 ARG NH1 N N N 91 ARG NH2 N N N 92 ARG OXT O N N 93 ARG H H N N 94 ARG H2 H N N 95 ARG HA H N N 96 ARG HB2 H N N 97 ARG HB3 H N N 98 ARG HG2 H N N 99 ARG HG3 H N N 100 ARG HD2 H N N 101 ARG HD3 H N N 102 ARG HE H N N 103 ARG HH11 H N N 104 ARG HH12 H N N 105 ARG HH21 H N N 106 ARG HH22 H N N 107 ARG HXT H N N 108 ASN N N N N 109 ASN CA C N S 110 ASN C C N N 111 ASN O O N N 112 ASN CB C N N 113 ASN CG C N N 114 ASN OD1 O N N 115 ASN ND2 N N N 116 ASN OXT O N N 117 ASN H H N N 118 ASN H2 H N N 119 ASN HA H N N 120 ASN HB2 H N N 121 ASN HB3 H N N 122 ASN HD21 H N N 123 ASN HD22 H N N 124 ASN HXT H N N 125 ASP N N N N 126 ASP CA C N S 127 ASP C C N N 128 ASP O O N N 129 ASP CB C N N 130 ASP CG C N N 131 ASP OD1 O N N 132 ASP OD2 O N N 133 ASP OXT O N N 134 ASP H H N N 135 ASP H2 H N N 136 ASP HA H N N 137 ASP HB2 H N N 138 ASP HB3 H N N 139 ASP HD2 H N N 140 ASP HXT H N N 141 CYS N N N N 142 CYS CA C N R 143 CYS C C N N 144 CYS O O N N 145 CYS CB C N N 146 CYS SG S N N 147 CYS OXT O N N 148 CYS H H N N 149 CYS H2 H N N 150 CYS HA H N N 151 CYS HB2 H N N 152 CYS HB3 H N N 153 CYS HG H N N 154 CYS HXT H N N 155 GLN N N N N 156 GLN CA C N S 157 GLN C C N N 158 GLN O O N N 159 GLN CB C N N 160 GLN CG C N N 161 GLN CD C N N 162 GLN OE1 O N N 163 GLN NE2 N N N 164 GLN OXT O N N 165 GLN H H N N 166 GLN H2 H N N 167 GLN HA H N N 168 GLN HB2 H N N 169 GLN HB3 H N N 170 GLN HG2 H N N 171 GLN HG3 H N N 172 GLN HE21 H N N 173 GLN HE22 H N N 174 GLN HXT H N N 175 GLU N N N N 176 GLU CA C N S 177 GLU C C N N 178 GLU O O N N 179 GLU CB C N N 180 GLU CG C N N 181 GLU CD C N N 182 GLU OE1 O N N 183 GLU OE2 O N N 184 GLU OXT O N N 185 GLU H H N N 186 GLU H2 H N N 187 GLU HA H N N 188 GLU HB2 H N N 189 GLU HB3 H N N 190 GLU HG2 H N N 191 GLU HG3 H N N 192 GLU HE2 H N N 193 GLU HXT H N N 194 GLY N N N N 195 GLY CA C N N 196 GLY C C N N 197 GLY O O N N 198 GLY OXT O N N 199 GLY H H N N 200 GLY H2 H N N 201 GLY HA2 H N N 202 GLY HA3 H N N 203 GLY HXT H N N 204 HIS N N N N 205 HIS CA C N S 206 HIS C C N N 207 HIS O O N N 208 HIS CB C N N 209 HIS CG C Y N 210 HIS ND1 N Y N 211 HIS CD2 C Y N 212 HIS CE1 C Y N 213 HIS NE2 N Y N 214 HIS OXT O N N 215 HIS H H N N 216 HIS H2 H N N 217 HIS HA H N N 218 HIS HB2 H N N 219 HIS HB3 H N N 220 HIS HD1 H N N 221 HIS HD2 H N N 222 HIS HE1 H N N 223 HIS HE2 H N N 224 HIS HXT H N N 225 HOH O O N N 226 HOH H1 H N N 227 HOH H2 H N N 228 ILE N N N N 229 ILE CA C N S 230 ILE C C N N 231 ILE O O N N 232 ILE CB C N S 233 ILE CG1 C N N 234 ILE CG2 C N N 235 ILE CD1 C N N 236 ILE OXT O N N 237 ILE H H N N 238 ILE H2 H N N 239 ILE HA H N N 240 ILE HB H N N 241 ILE HG12 H N N 242 ILE HG13 H N N 243 ILE HG21 H N N 244 ILE HG22 H N N 245 ILE HG23 H N N 246 ILE HD11 H N N 247 ILE HD12 H N N 248 ILE HD13 H N N 249 ILE HXT H N N 250 LEU N N N N 251 LEU CA C N S 252 LEU C C N N 253 LEU O O N N 254 LEU CB C N N 255 LEU CG C N N 256 LEU CD1 C N N 257 LEU CD2 C N N 258 LEU OXT O N N 259 LEU H H N N 260 LEU H2 H N N 261 LEU HA H N N 262 LEU HB2 H N N 263 LEU HB3 H N N 264 LEU HG H N N 265 LEU HD11 H N N 266 LEU HD12 H N N 267 LEU HD13 H N N 268 LEU HD21 H N N 269 LEU HD22 H N N 270 LEU HD23 H N N 271 LEU HXT H N N 272 LYS N N N N 273 LYS CA C N S 274 LYS C C N N 275 LYS O O N N 276 LYS CB C N N 277 LYS CG C N N 278 LYS CD C N N 279 LYS CE C N N 280 LYS NZ N N N 281 LYS OXT O N N 282 LYS H H N N 283 LYS H2 H N N 284 LYS HA H N N 285 LYS HB2 H N N 286 LYS HB3 H N N 287 LYS HG2 H N N 288 LYS HG3 H N N 289 LYS HD2 H N N 290 LYS HD3 H N N 291 LYS HE2 H N N 292 LYS HE3 H N N 293 LYS HZ1 H N N 294 LYS HZ2 H N N 295 LYS HZ3 H N N 296 LYS HXT H N N 297 MET N N N N 298 MET CA C N S 299 MET C C N N 300 MET O O N N 301 MET CB C N N 302 MET CG C N N 303 MET SD S N N 304 MET CE C N N 305 MET OXT O N N 306 MET H H N N 307 MET H2 H N N 308 MET HA H N N 309 MET HB2 H N N 310 MET HB3 H N N 311 MET HG2 H N N 312 MET HG3 H N N 313 MET HE1 H N N 314 MET HE2 H N N 315 MET HE3 H N N 316 MET HXT H N N 317 PHE N N N N 318 PHE CA C N S 319 PHE C C N N 320 PHE O O N N 321 PHE CB C N N 322 PHE CG C Y N 323 PHE CD1 C Y N 324 PHE CD2 C Y N 325 PHE CE1 C Y N 326 PHE CE2 C Y N 327 PHE CZ C Y N 328 PHE OXT O N N 329 PHE H H N N 330 PHE H2 H N N 331 PHE HA H N N 332 PHE HB2 H N N 333 PHE HB3 H N N 334 PHE HD1 H N N 335 PHE HD2 H N N 336 PHE HE1 H N N 337 PHE HE2 H N N 338 PHE HZ H N N 339 PHE HXT H N N 340 PRO N N N N 341 PRO CA C N S 342 PRO C C N N 343 PRO O O N N 344 PRO CB C N N 345 PRO CG C N N 346 PRO CD C N N 347 PRO OXT O N N 348 PRO H H N N 349 PRO HA H N N 350 PRO HB2 H N N 351 PRO HB3 H N N 352 PRO HG2 H N N 353 PRO HG3 H N N 354 PRO HD2 H N N 355 PRO HD3 H N N 356 PRO HXT H N N 357 SER N N N N 358 SER CA C N S 359 SER C C N N 360 SER O O N N 361 SER CB C N N 362 SER OG O N N 363 SER OXT O N N 364 SER H H N N 365 SER H2 H N N 366 SER HA H N N 367 SER HB2 H N N 368 SER HB3 H N N 369 SER HG H N N 370 SER HXT H N N 371 THR N N N N 372 THR CA C N S 373 THR C C N N 374 THR O O N N 375 THR CB C N R 376 THR OG1 O N N 377 THR CG2 C N N 378 THR OXT O N N 379 THR H H N N 380 THR H2 H N N 381 THR HA H N N 382 THR HB H N N 383 THR HG1 H N N 384 THR HG21 H N N 385 THR HG22 H N N 386 THR HG23 H N N 387 THR HXT H N N 388 TRP N N N N 389 TRP CA C N S 390 TRP C C N N 391 TRP O O N N 392 TRP CB C N N 393 TRP CG C Y N 394 TRP CD1 C Y N 395 TRP CD2 C Y N 396 TRP NE1 N Y N 397 TRP CE2 C Y N 398 TRP CE3 C Y N 399 TRP CZ2 C Y N 400 TRP CZ3 C Y N 401 TRP CH2 C Y N 402 TRP OXT O N N 403 TRP H H N N 404 TRP H2 H N N 405 TRP HA H N N 406 TRP HB2 H N N 407 TRP HB3 H N N 408 TRP HD1 H N N 409 TRP HE1 H N N 410 TRP HE3 H N N 411 TRP HZ2 H N N 412 TRP HZ3 H N N 413 TRP HH2 H N N 414 TRP HXT H N N 415 TYR N N N N 416 TYR CA C N S 417 TYR C C N N 418 TYR O O N N 419 TYR CB C N N 420 TYR CG C Y N 421 TYR CD1 C Y N 422 TYR CD2 C Y N 423 TYR CE1 C Y N 424 TYR CE2 C Y N 425 TYR CZ C Y N 426 TYR OH O N N 427 TYR OXT O N N 428 TYR H H N N 429 TYR H2 H N N 430 TYR HA H N N 431 TYR HB2 H N N 432 TYR HB3 H N N 433 TYR HD1 H N N 434 TYR HD2 H N N 435 TYR HE1 H N N 436 TYR HE2 H N N 437 TYR HH H N N 438 TYR HXT H N N 439 VAL N N N N 440 VAL CA C N S 441 VAL C C N N 442 VAL O O N N 443 VAL CB C N N 444 VAL CG1 C N N 445 VAL CG2 C N N 446 VAL OXT O N N 447 VAL H H N N 448 VAL H2 H N N 449 VAL HA H N N 450 VAL HB H N N 451 VAL HG11 H N N 452 VAL HG12 H N N 453 VAL HG13 H N N 454 VAL HG21 H N N 455 VAL HG22 H N N 456 VAL HG23 H N N 457 VAL HXT H N N 458 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2BA P O1P doub N N 1 2BA P O2P sing N N 2 2BA P "O5'" sing N N 3 2BA P "O3'1" sing N N 4 2BA "O5'" "C5'" sing N N 5 2BA "C5'" "C4'" sing N N 6 2BA "C4'" "O4'" sing N N 7 2BA "C4'" "C3'" sing N N 8 2BA "O4'" "C1'" sing N N 9 2BA "C3'" "O3'" sing N N 10 2BA "C3'" "C2'" sing N N 11 2BA "O3'" P1 sing N N 12 2BA "C2'" "O2'" sing N N 13 2BA "C2'" "C1'" sing N N 14 2BA "C1'" N9 sing N N 15 2BA N9 C8 sing Y N 16 2BA N9 C4 sing Y N 17 2BA C8 N7 doub Y N 18 2BA N7 C5 sing Y N 19 2BA C5 C6 doub Y N 20 2BA C5 C4 sing Y N 21 2BA C6 N6 sing N N 22 2BA C6 N1 sing Y N 23 2BA N1 C2 doub Y N 24 2BA C2 N3 sing Y N 25 2BA N3 C4 doub Y N 26 2BA P1 O1P1 doub N N 27 2BA P1 O2P1 sing N N 28 2BA P1 "O5'1" sing N N 29 2BA "O5'1" "C5'1" sing N N 30 2BA "C5'1" "C4'1" sing N N 31 2BA "C4'1" "O4'1" sing N N 32 2BA "C4'1" "C3'1" sing N N 33 2BA "O4'1" "C1'1" sing N N 34 2BA "C3'1" "O3'1" sing N N 35 2BA "C3'1" "C2'1" sing N N 36 2BA "C2'1" "O2'1" sing N N 37 2BA "C2'1" "C1'1" sing N N 38 2BA "C1'1" N91 sing N N 39 2BA N91 C81 sing Y N 40 2BA N91 C41 sing Y N 41 2BA C81 N71 doub Y N 42 2BA N71 C51 sing Y N 43 2BA C51 C61 doub Y N 44 2BA C51 C41 sing Y N 45 2BA C61 N61 sing N N 46 2BA C61 N11 sing Y N 47 2BA N11 C21 doub Y N 48 2BA C21 N31 sing Y N 49 2BA N31 C41 doub Y N 50 2BA "C5'" "H5'" sing N N 51 2BA "C5'" "H5'A" sing N N 52 2BA "C4'" "H4'" sing N N 53 2BA "C3'" "H3'" sing N N 54 2BA "C2'" "H2'" sing N N 55 2BA "O2'" "HO2'" sing N N 56 2BA "C1'" "H1'" sing N N 57 2BA C8 H8 sing N N 58 2BA N6 HN6 sing N N 59 2BA N6 HN6A sing N N 60 2BA C2 H2 sing N N 61 2BA "C5'1" "HC5'" sing N N 62 2BA "C5'1" HC5A sing N N 63 2BA "C4'1" "HC4'" sing N N 64 2BA "C3'1" "HC3'" sing N N 65 2BA "C2'1" "HC2'" sing N N 66 2BA "O2'1" HO2A sing N N 67 2BA "C1'1" "HC1'" sing N N 68 2BA C81 HC8 sing N N 69 2BA N61 H1N6 sing N N 70 2BA N61 H1NA sing N N 71 2BA C21 HC2 sing N N 72 2BA O2P H2P sing N N 73 2BA O2P1 H2OP sing N N 74 ALA N CA sing N N 75 ALA N H sing N N 76 ALA N H2 sing N N 77 ALA CA C sing N N 78 ALA CA CB sing N N 79 ALA CA HA sing N N 80 ALA C O doub N N 81 ALA C OXT sing N N 82 ALA CB HB1 sing N N 83 ALA CB HB2 sing N N 84 ALA CB HB3 sing N N 85 ALA OXT HXT sing N N 86 ARG N CA sing N N 87 ARG N H sing N N 88 ARG N H2 sing N N 89 ARG CA C sing N N 90 ARG CA CB sing N N 91 ARG CA HA sing N N 92 ARG C O doub N N 93 ARG C OXT sing N N 94 ARG CB CG sing N N 95 ARG CB HB2 sing N N 96 ARG CB HB3 sing N N 97 ARG CG CD sing N N 98 ARG CG HG2 sing N N 99 ARG CG HG3 sing N N 100 ARG CD NE sing N N 101 ARG CD HD2 sing N N 102 ARG CD HD3 sing N N 103 ARG NE CZ sing N N 104 ARG NE HE sing N N 105 ARG CZ NH1 sing N N 106 ARG CZ NH2 doub N N 107 ARG NH1 HH11 sing N N 108 ARG NH1 HH12 sing N N 109 ARG NH2 HH21 sing N N 110 ARG NH2 HH22 sing N N 111 ARG OXT HXT sing N N 112 ASN N CA sing N N 113 ASN N H sing N N 114 ASN N H2 sing N N 115 ASN CA C sing N N 116 ASN CA CB sing N N 117 ASN CA HA sing N N 118 ASN C O doub N N 119 ASN C OXT sing N N 120 ASN CB CG sing N N 121 ASN CB HB2 sing N N 122 ASN CB HB3 sing N N 123 ASN CG OD1 doub N N 124 ASN CG ND2 sing N N 125 ASN ND2 HD21 sing N N 126 ASN ND2 HD22 sing N N 127 ASN OXT HXT sing N N 128 ASP N CA sing N N 129 ASP N H sing N N 130 ASP N H2 sing N N 131 ASP CA C sing N N 132 ASP CA CB sing N N 133 ASP CA HA sing N N 134 ASP C O doub N N 135 ASP C OXT sing N N 136 ASP CB CG sing N N 137 ASP CB HB2 sing N N 138 ASP CB HB3 sing N N 139 ASP CG OD1 doub N N 140 ASP CG OD2 sing N N 141 ASP OD2 HD2 sing N N 142 ASP OXT HXT sing N N 143 CYS N CA sing N N 144 CYS N H sing N N 145 CYS N H2 sing N N 146 CYS CA C sing N N 147 CYS CA CB sing N N 148 CYS CA HA sing N N 149 CYS C O doub N N 150 CYS C OXT sing N N 151 CYS CB SG sing N N 152 CYS CB HB2 sing N N 153 CYS CB HB3 sing N N 154 CYS SG HG sing N N 155 CYS OXT HXT sing N N 156 GLN N CA sing N N 157 GLN N H sing N N 158 GLN N H2 sing N N 159 GLN CA C sing N N 160 GLN CA CB sing N N 161 GLN CA HA sing N N 162 GLN C O doub N N 163 GLN C OXT sing N N 164 GLN CB CG sing N N 165 GLN CB HB2 sing N N 166 GLN CB HB3 sing N N 167 GLN CG CD sing N N 168 GLN CG HG2 sing N N 169 GLN CG HG3 sing N N 170 GLN CD OE1 doub N N 171 GLN CD NE2 sing N N 172 GLN NE2 HE21 sing N N 173 GLN NE2 HE22 sing N N 174 GLN OXT HXT sing N N 175 GLU N CA sing N N 176 GLU N H sing N N 177 GLU N H2 sing N N 178 GLU CA C sing N N 179 GLU CA CB sing N N 180 GLU CA HA sing N N 181 GLU C O doub N N 182 GLU C OXT sing N N 183 GLU CB CG sing N N 184 GLU CB HB2 sing N N 185 GLU CB HB3 sing N N 186 GLU CG CD sing N N 187 GLU CG HG2 sing N N 188 GLU CG HG3 sing N N 189 GLU CD OE1 doub N N 190 GLU CD OE2 sing N N 191 GLU OE2 HE2 sing N N 192 GLU OXT HXT sing N N 193 GLY N CA sing N N 194 GLY N H sing N N 195 GLY N H2 sing N N 196 GLY CA C sing N N 197 GLY CA HA2 sing N N 198 GLY CA HA3 sing N N 199 GLY C O doub N N 200 GLY C OXT sing N N 201 GLY OXT HXT sing N N 202 HIS N CA sing N N 203 HIS N H sing N N 204 HIS N H2 sing N N 205 HIS CA C sing N N 206 HIS CA CB sing N N 207 HIS CA HA sing N N 208 HIS C O doub N N 209 HIS C OXT sing N N 210 HIS CB CG sing N N 211 HIS CB HB2 sing N N 212 HIS CB HB3 sing N N 213 HIS CG ND1 sing Y N 214 HIS CG CD2 doub Y N 215 HIS ND1 CE1 doub Y N 216 HIS ND1 HD1 sing N N 217 HIS CD2 NE2 sing Y N 218 HIS CD2 HD2 sing N N 219 HIS CE1 NE2 sing Y N 220 HIS CE1 HE1 sing N N 221 HIS NE2 HE2 sing N N 222 HIS OXT HXT sing N N 223 HOH O H1 sing N N 224 HOH O H2 sing N N 225 ILE N CA sing N N 226 ILE N H sing N N 227 ILE N H2 sing N N 228 ILE CA C sing N N 229 ILE CA CB sing N N 230 ILE CA HA sing N N 231 ILE C O doub N N 232 ILE C OXT sing N N 233 ILE CB CG1 sing N N 234 ILE CB CG2 sing N N 235 ILE CB HB sing N N 236 ILE CG1 CD1 sing N N 237 ILE CG1 HG12 sing N N 238 ILE CG1 HG13 sing N N 239 ILE CG2 HG21 sing N N 240 ILE CG2 HG22 sing N N 241 ILE CG2 HG23 sing N N 242 ILE CD1 HD11 sing N N 243 ILE CD1 HD12 sing N N 244 ILE CD1 HD13 sing N N 245 ILE OXT HXT sing N N 246 LEU N CA sing N N 247 LEU N H sing N N 248 LEU N H2 sing N N 249 LEU CA C sing N N 250 LEU CA CB sing N N 251 LEU CA HA sing N N 252 LEU C O doub N N 253 LEU C OXT sing N N 254 LEU CB CG sing N N 255 LEU CB HB2 sing N N 256 LEU CB HB3 sing N N 257 LEU CG CD1 sing N N 258 LEU CG CD2 sing N N 259 LEU CG HG sing N N 260 LEU CD1 HD11 sing N N 261 LEU CD1 HD12 sing N N 262 LEU CD1 HD13 sing N N 263 LEU CD2 HD21 sing N N 264 LEU CD2 HD22 sing N N 265 LEU CD2 HD23 sing N N 266 LEU OXT HXT sing N N 267 LYS N CA sing N N 268 LYS N H sing N N 269 LYS N H2 sing N N 270 LYS CA C sing N N 271 LYS CA CB sing N N 272 LYS CA HA sing N N 273 LYS C O doub N N 274 LYS C OXT sing N N 275 LYS CB CG sing N N 276 LYS CB HB2 sing N N 277 LYS CB HB3 sing N N 278 LYS CG CD sing N N 279 LYS CG HG2 sing N N 280 LYS CG HG3 sing N N 281 LYS CD CE sing N N 282 LYS CD HD2 sing N N 283 LYS CD HD3 sing N N 284 LYS CE NZ sing N N 285 LYS CE HE2 sing N N 286 LYS CE HE3 sing N N 287 LYS NZ HZ1 sing N N 288 LYS NZ HZ2 sing N N 289 LYS NZ HZ3 sing N N 290 LYS OXT HXT sing N N 291 MET N CA sing N N 292 MET N H sing N N 293 MET N H2 sing N N 294 MET CA C sing N N 295 MET CA CB sing N N 296 MET CA HA sing N N 297 MET C O doub N N 298 MET C OXT sing N N 299 MET CB CG sing N N 300 MET CB HB2 sing N N 301 MET CB HB3 sing N N 302 MET CG SD sing N N 303 MET CG HG2 sing N N 304 MET CG HG3 sing N N 305 MET SD CE sing N N 306 MET CE HE1 sing N N 307 MET CE HE2 sing N N 308 MET CE HE3 sing N N 309 MET OXT HXT sing N N 310 PHE N CA sing N N 311 PHE N H sing N N 312 PHE N H2 sing N N 313 PHE CA C sing N N 314 PHE CA CB sing N N 315 PHE CA HA sing N N 316 PHE C O doub N N 317 PHE C OXT sing N N 318 PHE CB CG sing N N 319 PHE CB HB2 sing N N 320 PHE CB HB3 sing N N 321 PHE CG CD1 doub Y N 322 PHE CG CD2 sing Y N 323 PHE CD1 CE1 sing Y N 324 PHE CD1 HD1 sing N N 325 PHE CD2 CE2 doub Y N 326 PHE CD2 HD2 sing N N 327 PHE CE1 CZ doub Y N 328 PHE CE1 HE1 sing N N 329 PHE CE2 CZ sing Y N 330 PHE CE2 HE2 sing N N 331 PHE CZ HZ sing N N 332 PHE OXT HXT sing N N 333 PRO N CA sing N N 334 PRO N CD sing N N 335 PRO N H sing N N 336 PRO CA C sing N N 337 PRO CA CB sing N N 338 PRO CA HA sing N N 339 PRO C O doub N N 340 PRO C OXT sing N N 341 PRO CB CG sing N N 342 PRO CB HB2 sing N N 343 PRO CB HB3 sing N N 344 PRO CG CD sing N N 345 PRO CG HG2 sing N N 346 PRO CG HG3 sing N N 347 PRO CD HD2 sing N N 348 PRO CD HD3 sing N N 349 PRO OXT HXT sing N N 350 SER N CA sing N N 351 SER N H sing N N 352 SER N H2 sing N N 353 SER CA C sing N N 354 SER CA CB sing N N 355 SER CA HA sing N N 356 SER C O doub N N 357 SER C OXT sing N N 358 SER CB OG sing N N 359 SER CB HB2 sing N N 360 SER CB HB3 sing N N 361 SER OG HG sing N N 362 SER OXT HXT sing N N 363 THR N CA sing N N 364 THR N H sing N N 365 THR N H2 sing N N 366 THR CA C sing N N 367 THR CA CB sing N N 368 THR CA HA sing N N 369 THR C O doub N N 370 THR C OXT sing N N 371 THR CB OG1 sing N N 372 THR CB CG2 sing N N 373 THR CB HB sing N N 374 THR OG1 HG1 sing N N 375 THR CG2 HG21 sing N N 376 THR CG2 HG22 sing N N 377 THR CG2 HG23 sing N N 378 THR OXT HXT sing N N 379 TRP N CA sing N N 380 TRP N H sing N N 381 TRP N H2 sing N N 382 TRP CA C sing N N 383 TRP CA CB sing N N 384 TRP CA HA sing N N 385 TRP C O doub N N 386 TRP C OXT sing N N 387 TRP CB CG sing N N 388 TRP CB HB2 sing N N 389 TRP CB HB3 sing N N 390 TRP CG CD1 doub Y N 391 TRP CG CD2 sing Y N 392 TRP CD1 NE1 sing Y N 393 TRP CD1 HD1 sing N N 394 TRP CD2 CE2 doub Y N 395 TRP CD2 CE3 sing Y N 396 TRP NE1 CE2 sing Y N 397 TRP NE1 HE1 sing N N 398 TRP CE2 CZ2 sing Y N 399 TRP CE3 CZ3 doub Y N 400 TRP CE3 HE3 sing N N 401 TRP CZ2 CH2 doub Y N 402 TRP CZ2 HZ2 sing N N 403 TRP CZ3 CH2 sing Y N 404 TRP CZ3 HZ3 sing N N 405 TRP CH2 HH2 sing N N 406 TRP OXT HXT sing N N 407 TYR N CA sing N N 408 TYR N H sing N N 409 TYR N H2 sing N N 410 TYR CA C sing N N 411 TYR CA CB sing N N 412 TYR CA HA sing N N 413 TYR C O doub N N 414 TYR C OXT sing N N 415 TYR CB CG sing N N 416 TYR CB HB2 sing N N 417 TYR CB HB3 sing N N 418 TYR CG CD1 doub Y N 419 TYR CG CD2 sing Y N 420 TYR CD1 CE1 sing Y N 421 TYR CD1 HD1 sing N N 422 TYR CD2 CE2 doub Y N 423 TYR CD2 HD2 sing N N 424 TYR CE1 CZ doub Y N 425 TYR CE1 HE1 sing N N 426 TYR CE2 CZ sing Y N 427 TYR CE2 HE2 sing N N 428 TYR CZ OH sing N N 429 TYR OH HH sing N N 430 TYR OXT HXT sing N N 431 VAL N CA sing N N 432 VAL N H sing N N 433 VAL N H2 sing N N 434 VAL CA C sing N N 435 VAL CA CB sing N N 436 VAL CA HA sing N N 437 VAL C O doub N N 438 VAL C OXT sing N N 439 VAL CB CG1 sing N N 440 VAL CB CG2 sing N N 441 VAL CB HB sing N N 442 VAL CG1 HG11 sing N N 443 VAL CG1 HG12 sing N N 444 VAL CG1 HG13 sing N N 445 VAL CG2 HG21 sing N N 446 VAL CG2 HG22 sing N N 447 VAL CG2 HG23 sing N N 448 VAL OXT HXT sing N N 449 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R35GM119504 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 2BA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 2BA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 7JI4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018379 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018379 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010360 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S SE # loop_