data_7JIW
# 
_entry.id   7JIW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.380 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7JIW         pdb_00007jiw 10.2210/pdb7jiw/pdb 
WWPDB D_1000250866 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2'                                               6WZU unspecified 
PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2, C111S mutant'                                 6WRH unspecified 
PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2 , C111S mutant, in complex with PLP_Snyder457' 7JIR unspecified 
PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2 , C111S mutant, in complex with PLP_Snyder495' 7JIT unspecified 
PDB 'The crystal structure of Papain-Like Protease of SARS CoV-2 , C111S mutant, in complex with PLP_Snyder530' 7JIV unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7JIW 
_pdbx_database_status.recvd_initial_deposition_date   2020-07-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Osipiuk, J.'                                                   1  ? 
'Tesar, C.'                                                     2  ? 
'Endres, M.'                                                    3  ? 
'Lisnyak, V.'                                                   4  ? 
'Maki, S.'                                                      5  ? 
'Taylor, C.'                                                    6  ? 
'Zhang, Y.'                                                     7  ? 
'Zhou, Z.'                                                      8  ? 
'Azizi, S.A.'                                                   9  ? 
'Jones, K.'                                                     10 ? 
'Kathayat, R.'                                                  11 ? 
'Snyder, S.A.'                                                  12 ? 
'Dickinson, B.C.'                                               13 ? 
'Joachimiak, A.'                                                14 ? 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 15 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            12 
_citation.language                  ? 
_citation.page_first                743 
_citation.page_last                 743 
_citation.title                     
'Structure of papain-like protease from SARS-CoV-2 and its complexes with non-covalent inhibitors.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-021-21060-3 
_citation.pdbx_database_id_PubMed   33531496 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Osipiuk, J.'     1  ?                   
primary 'Azizi, S.A.'     2  0000-0002-9226-9917 
primary 'Dvorkin, S.'     3  ?                   
primary 'Endres, M.'      4  ?                   
primary 'Jedrzejczak, R.' 5  ?                   
primary 'Jones, K.A.'     6  0000-0003-0711-5516 
primary 'Kang, S.'        7  ?                   
primary 'Kathayat, R.S.'  8  0000-0002-9159-2413 
primary 'Kim, Y.'         9  ?                   
primary 'Lisnyak, V.G.'   10 0000-0002-4406-8440 
primary 'Maki, S.L.'      11 0000-0001-6917-3602 
primary 'Nicolaescu, V.'  12 ?                   
primary 'Taylor, C.A.'    13 ?                   
primary 'Tesar, C.'       14 ?                   
primary 'Zhang, Y.A.'     15 ?                   
primary 'Zhou, Z.'        16 0000-0002-2792-8429 
primary 'Randall, G.'     17 ?                   
primary 'Michalska, K.'   18 ?                   
primary 'Snyder, S.A.'    19 0000-0003-3594-8769 
primary 'Dickinson, B.C.' 20 0000-0002-9616-1911 
primary 'Joachimiak, A.'  21 0000-0003-2535-6209 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7JIW 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     113.648 
_cell.length_a_esd                 ? 
_cell.length_b                     113.648 
_cell.length_b_esd                 ? 
_cell.length_c                     220.574 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7JIW 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Papain-like protease'                                                  35943.762 1  3.4.22.- ? ? 
'3 N-terminal residues (SNA) are from expression tag' 
2 non-polymer syn '5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]benzamide' 358.433   1  ?        ? ? ? 
3 non-polymer syn 'ZINC ION'                                                              65.409    4  ?        ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                                                          35.453    4  ?        ? ? ? 
5 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                  195.237   1  ?        ? ? ? 
6 water       nat water                                                                   18.015    32 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Non-structural protein 3,nsp3,PL2-PRO,Papain-like proteinase,PL-PRO' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNAEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDP
SFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNK
TVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNAEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDP
SFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNK
TVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   GLU n 
1 5   VAL n 
1 6   ARG n 
1 7   THR n 
1 8   ILE n 
1 9   LYS n 
1 10  VAL n 
1 11  PHE n 
1 12  THR n 
1 13  THR n 
1 14  VAL n 
1 15  ASP n 
1 16  ASN n 
1 17  ILE n 
1 18  ASN n 
1 19  LEU n 
1 20  HIS n 
1 21  THR n 
1 22  GLN n 
1 23  VAL n 
1 24  VAL n 
1 25  ASP n 
1 26  MET n 
1 27  SER n 
1 28  MET n 
1 29  THR n 
1 30  TYR n 
1 31  GLY n 
1 32  GLN n 
1 33  GLN n 
1 34  PHE n 
1 35  GLY n 
1 36  PRO n 
1 37  THR n 
1 38  TYR n 
1 39  LEU n 
1 40  ASP n 
1 41  GLY n 
1 42  ALA n 
1 43  ASP n 
1 44  VAL n 
1 45  THR n 
1 46  LYS n 
1 47  ILE n 
1 48  LYS n 
1 49  PRO n 
1 50  HIS n 
1 51  ASN n 
1 52  SER n 
1 53  HIS n 
1 54  GLU n 
1 55  GLY n 
1 56  LYS n 
1 57  THR n 
1 58  PHE n 
1 59  TYR n 
1 60  VAL n 
1 61  LEU n 
1 62  PRO n 
1 63  ASN n 
1 64  ASP n 
1 65  ASP n 
1 66  THR n 
1 67  LEU n 
1 68  ARG n 
1 69  VAL n 
1 70  GLU n 
1 71  ALA n 
1 72  PHE n 
1 73  GLU n 
1 74  TYR n 
1 75  TYR n 
1 76  HIS n 
1 77  THR n 
1 78  THR n 
1 79  ASP n 
1 80  PRO n 
1 81  SER n 
1 82  PHE n 
1 83  LEU n 
1 84  GLY n 
1 85  ARG n 
1 86  TYR n 
1 87  MET n 
1 88  SER n 
1 89  ALA n 
1 90  LEU n 
1 91  ASN n 
1 92  HIS n 
1 93  THR n 
1 94  LYS n 
1 95  LYS n 
1 96  TRP n 
1 97  LYS n 
1 98  TYR n 
1 99  PRO n 
1 100 GLN n 
1 101 VAL n 
1 102 ASN n 
1 103 GLY n 
1 104 LEU n 
1 105 THR n 
1 106 SER n 
1 107 ILE n 
1 108 LYS n 
1 109 TRP n 
1 110 ALA n 
1 111 ASP n 
1 112 ASN n 
1 113 ASN n 
1 114 CYS n 
1 115 TYR n 
1 116 LEU n 
1 117 ALA n 
1 118 THR n 
1 119 ALA n 
1 120 LEU n 
1 121 LEU n 
1 122 THR n 
1 123 LEU n 
1 124 GLN n 
1 125 GLN n 
1 126 ILE n 
1 127 GLU n 
1 128 LEU n 
1 129 LYS n 
1 130 PHE n 
1 131 ASN n 
1 132 PRO n 
1 133 PRO n 
1 134 ALA n 
1 135 LEU n 
1 136 GLN n 
1 137 ASP n 
1 138 ALA n 
1 139 TYR n 
1 140 TYR n 
1 141 ARG n 
1 142 ALA n 
1 143 ARG n 
1 144 ALA n 
1 145 GLY n 
1 146 GLU n 
1 147 ALA n 
1 148 ALA n 
1 149 ASN n 
1 150 PHE n 
1 151 CYS n 
1 152 ALA n 
1 153 LEU n 
1 154 ILE n 
1 155 LEU n 
1 156 ALA n 
1 157 TYR n 
1 158 CYS n 
1 159 ASN n 
1 160 LYS n 
1 161 THR n 
1 162 VAL n 
1 163 GLY n 
1 164 GLU n 
1 165 LEU n 
1 166 GLY n 
1 167 ASP n 
1 168 VAL n 
1 169 ARG n 
1 170 GLU n 
1 171 THR n 
1 172 MET n 
1 173 SER n 
1 174 TYR n 
1 175 LEU n 
1 176 PHE n 
1 177 GLN n 
1 178 HIS n 
1 179 ALA n 
1 180 ASN n 
1 181 LEU n 
1 182 ASP n 
1 183 SER n 
1 184 CYS n 
1 185 LYS n 
1 186 ARG n 
1 187 VAL n 
1 188 LEU n 
1 189 ASN n 
1 190 VAL n 
1 191 VAL n 
1 192 CYS n 
1 193 LYS n 
1 194 THR n 
1 195 CYS n 
1 196 GLY n 
1 197 GLN n 
1 198 GLN n 
1 199 GLN n 
1 200 THR n 
1 201 THR n 
1 202 LEU n 
1 203 LYS n 
1 204 GLY n 
1 205 VAL n 
1 206 GLU n 
1 207 ALA n 
1 208 VAL n 
1 209 MET n 
1 210 TYR n 
1 211 MET n 
1 212 GLY n 
1 213 THR n 
1 214 LEU n 
1 215 SER n 
1 216 TYR n 
1 217 GLU n 
1 218 GLN n 
1 219 PHE n 
1 220 LYS n 
1 221 LYS n 
1 222 GLY n 
1 223 VAL n 
1 224 GLN n 
1 225 ILE n 
1 226 PRO n 
1 227 CYS n 
1 228 THR n 
1 229 CYS n 
1 230 GLY n 
1 231 LYS n 
1 232 GLN n 
1 233 ALA n 
1 234 THR n 
1 235 LYS n 
1 236 TYR n 
1 237 LEU n 
1 238 VAL n 
1 239 GLN n 
1 240 GLN n 
1 241 GLU n 
1 242 SER n 
1 243 PRO n 
1 244 PHE n 
1 245 VAL n 
1 246 MET n 
1 247 MET n 
1 248 SER n 
1 249 ALA n 
1 250 PRO n 
1 251 PRO n 
1 252 ALA n 
1 253 GLN n 
1 254 TYR n 
1 255 GLU n 
1 256 LEU n 
1 257 LYS n 
1 258 HIS n 
1 259 GLY n 
1 260 THR n 
1 261 PHE n 
1 262 THR n 
1 263 CYS n 
1 264 ALA n 
1 265 SER n 
1 266 GLU n 
1 267 TYR n 
1 268 THR n 
1 269 GLY n 
1 270 ASN n 
1 271 TYR n 
1 272 GLN n 
1 273 CYS n 
1 274 GLY n 
1 275 HIS n 
1 276 TYR n 
1 277 LYS n 
1 278 HIS n 
1 279 ILE n 
1 280 THR n 
1 281 SER n 
1 282 LYS n 
1 283 GLU n 
1 284 THR n 
1 285 LEU n 
1 286 TYR n 
1 287 CYS n 
1 288 ILE n 
1 289 ASP n 
1 290 GLY n 
1 291 ALA n 
1 292 LEU n 
1 293 LEU n 
1 294 THR n 
1 295 LYS n 
1 296 SER n 
1 297 SER n 
1 298 GLU n 
1 299 TYR n 
1 300 LYS n 
1 301 GLY n 
1 302 PRO n 
1 303 ILE n 
1 304 THR n 
1 305 ASP n 
1 306 VAL n 
1 307 PHE n 
1 308 TYR n 
1 309 LYS n 
1 310 GLU n 
1 311 ASN n 
1 312 SER n 
1 313 TYR n 
1 314 THR n 
1 315 THR n 
1 316 THR n 
1 317 ILE n 
1 318 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   318 
_entity_src_gen.gene_src_common_name               2019-nCoV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Severe acute respiratory syndrome coronavirus 2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2697049 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMCSG53 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    R1A_SARS2 
_struct_ref.pdbx_db_accession          P0DTC1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFL
GRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVG
ELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESP
FVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
;
_struct_ref.pdbx_align_begin           1564 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7JIW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 318 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P0DTC1 
_struct_ref_seq.db_align_beg                  1564 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1878 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       315 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7JIW SER A 1 ? UNP P0DTC1 ? ? 'expression tag' -2 1 
1 7JIW ASN A 2 ? UNP P0DTC1 ? ? 'expression tag' -1 2 
1 7JIW ALA A 3 ? UNP P0DTC1 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                         ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                          ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                  ? 'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                  ? 'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking' y METHIONINE                                                              ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                  ? 'C5 H11 N O2'    117.146 
VBY non-polymer         . '5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]benzamide' ? 'C23 H22 N2 O2'  358.433 
ZN  non-polymer         . 'ZINC ION'                                                              ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7JIW 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.95 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         75.17 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M MES buffer, 0.2 M zinc acetate, 10% PEG 8000, 4 mM PLP_Snyder530' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-06-29 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            66.3 
_reflns.entry_id                         7JIW 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.300 
_reflns.d_resolution_low                 45.51 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       32308 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  20.900 
_reflns.pdbx_Rmerge_I_obs                0.095 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         44.3 
_reflns.pdbx_netI_over_sigmaI            6.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.280 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.097 
_reflns.pdbx_Rpim_I_all                  0.021 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.300 2.340 ? 0.97 ? ? ? ? 1576 99.000  ? ? ? ? 1.731 ? ? ? ? ? ? ? ? 14.600 ? 0.890 ? ? 1.788 0.428 ? 1  1 0.605 ? ? 
2.340 2.380 ? ?    ? ? ? ? 1585 99.900  ? ? ? ? 1.629 ? ? ? ? ? ? ? ? 16.800 ? 0.886 ? ? 1.678 0.390 ? 2  1 0.806 ? ? 
2.380 2.430 ? ?    ? ? ? ? 1589 100.000 ? ? ? ? 1.434 ? ? ? ? ? ? ? ? 19.400 ? 0.903 ? ? 1.472 0.327 ? 3  1 0.821 ? ? 
2.430 2.480 ? ?    ? ? ? ? 1598 100.000 ? ? ? ? 1.486 ? ? ? ? ? ? ? ? 20.700 ? 0.893 ? ? 1.523 0.330 ? 4  1 0.877 ? ? 
2.480 2.530 ? ?    ? ? ? ? 1575 100.000 ? ? ? ? 1.105 ? ? ? ? ? ? ? ? 19.800 ? 0.917 ? ? 1.134 0.251 ? 5  1 0.923 ? ? 
2.530 2.590 ? ?    ? ? ? ? 1594 100.000 ? ? ? ? 0.995 ? ? ? ? ? ? ? ? 21.400 ? 0.934 ? ? 1.019 0.217 ? 6  1 0.949 ? ? 
2.590 2.660 ? ?    ? ? ? ? 1590 100.000 ? ? ? ? 0.756 ? ? ? ? ? ? ? ? 22.900 ? 0.968 ? ? 0.773 0.160 ? 7  1 0.962 ? ? 
2.660 2.730 ? ?    ? ? ? ? 1615 100.000 ? ? ? ? 0.559 ? ? ? ? ? ? ? ? 22.700 ? 1.070 ? ? 0.571 0.118 ? 8  1 0.980 ? ? 
2.730 2.810 ? ?    ? ? ? ? 1581 100.000 ? ? ? ? 0.465 ? ? ? ? ? ? ? ? 22.500 ? 1.120 ? ? 0.476 0.099 ? 9  1 0.985 ? ? 
2.810 2.900 ? ?    ? ? ? ? 1600 100.000 ? ? ? ? 0.395 ? ? ? ? ? ? ? ? 22.000 ? 1.201 ? ? 0.404 0.085 ? 10 1 0.987 ? ? 
2.900 3.000 ? ?    ? ? ? ? 1606 100.000 ? ? ? ? 0.296 ? ? ? ? ? ? ? ? 21.600 ? 1.332 ? ? 0.303 0.064 ? 11 1 0.991 ? ? 
3.000 3.120 ? ?    ? ? ? ? 1591 100.000 ? ? ? ? 0.237 ? ? ? ? ? ? ? ? 19.700 ? 1.435 ? ? 0.243 0.054 ? 12 1 0.994 ? ? 
3.120 3.260 ? ?    ? ? ? ? 1624 100.000 ? ? ? ? 0.184 ? ? ? ? ? ? ? ? 22.400 ? 1.531 ? ? 0.188 0.039 ? 13 1 0.995 ? ? 
3.260 3.440 ? ?    ? ? ? ? 1624 100.000 ? ? ? ? 0.156 ? ? ? ? ? ? ? ? 22.600 ? 1.626 ? ? 0.160 0.033 ? 14 1 0.997 ? ? 
3.440 3.650 ? ?    ? ? ? ? 1607 100.000 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 22.400 ? 1.632 ? ? 0.140 0.029 ? 15 1 0.997 ? ? 
3.650 3.930 ? ?    ? ? ? ? 1618 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 21.700 ? 1.635 ? ? 0.120 0.025 ? 16 1 0.997 ? ? 
3.930 4.330 ? ?    ? ? ? ? 1631 100.000 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 20.800 ? 1.595 ? ? 0.094 0.020 ? 17 1 0.998 ? ? 
4.330 4.950 ? ?    ? ? ? ? 1652 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 22.400 ? 1.576 ? ? 0.081 0.017 ? 18 1 0.998 ? ? 
4.950 6.240 ? ?    ? ? ? ? 1671 100.000 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 20.300 ? 1.543 ? ? 0.066 0.014 ? 19 1 0.999 ? ? 
6.240 45.51 ? ?    ? ? ? ? 1781 100.000 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 20.300 ? 1.559 ? ? 0.039 0.009 ? 20 1 1.000 ? ? 
# 
_refine.aniso_B[1][1]                            2.8700 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            2.8700 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            -5.7400 
_refine.B_iso_max                                174.600 
_refine.B_iso_mean                               82.6340 
_refine.B_iso_min                                58.460 
_refine.correlation_coeff_Fo_to_Fc               0.9520 
_refine.correlation_coeff_Fo_to_Fc_free          0.9450 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7JIW 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             45.5100 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     30715 
_refine.ls_number_reflns_R_free                  1564 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8500 
_refine.ls_percent_reflns_R_free                 4.8000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2135 
_refine.ls_R_factor_R_free                       0.2395 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2121 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6WZU 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.1730 
_refine.pdbx_overall_ESU_R_Free                  0.1600 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             14.9340 
_refine.overall_SU_ML                            0.1580 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        45.5100 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               2501 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       305 
_refine_hist.pdbx_B_iso_mean_ligand           85.86 
_refine_hist.pdbx_B_iso_mean_solvent          71.70 
_refine_hist.pdbx_number_atoms_protein        2422 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         47 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  0.013  2527 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.017  2252 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.489  1.674  3431 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.214  1.583  5253 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 6.843  5.000  305  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 40.544 24.068 118  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 15.408 15.000 418  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 14.762 15.000 6    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.059  0.200  331  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.007  0.020  2803 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  523  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.3040 
_refine_ls_shell.d_res_low                        2.3640 
_refine_ls_shell.number_reflns_all                2336 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             111 
_refine_ls_shell.number_reflns_R_work             2225 
_refine_ls_shell.percent_reflns_obs               98.5700 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3950 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3890 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     7JIW 
_struct.title                        
'The crystal structure of Papain-Like Protease of SARS CoV-2 in complex with PLP_Snyder530 inhibitor' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7JIW 
_struct_keywords.text            
;covid-19, coronavirus, SARS, CoV-2, papain-like protease, IDP51000, Center for Structural Genomics of Infectious Diseases, CSGID, HYDROLASE, HYDROLASE-HYDROLASE inhibitor complex
;
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 29  ? GLY A 35  ? THR A 26  GLY A 32  1 ? 7  
HELX_P HELX_P2 AA2 ASP A 64  ? HIS A 76  ? ASP A 61  HIS A 73  1 ? 13 
HELX_P HELX_P3 AA3 SER A 81  ? LYS A 94  ? SER A 78  LYS A 91  1 ? 14 
HELX_P HELX_P4 AA4 ASN A 113 ? GLN A 124 ? ASN A 110 GLN A 121 1 ? 12 
HELX_P HELX_P5 AA5 PRO A 132 ? ALA A 144 ? PRO A 129 ALA A 141 1 ? 13 
HELX_P HELX_P6 AA6 ALA A 147 ? CYS A 158 ? ALA A 144 CYS A 155 1 ? 12 
HELX_P HELX_P7 AA7 ASP A 167 ? GLN A 177 ? ASP A 164 GLN A 174 1 ? 11 
HELX_P HELX_P8 AA8 GLY A 204 ? VAL A 208 ? GLY A 201 VAL A 205 1 ? 5  
HELX_P HELX_P9 AA9 SER A 215 ? GLY A 222 ? SER A 212 GLY A 219 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A ASP 65  OD1 ? ? ? 1_555 E ZN  . ZN ? ? A ASP 62  A ZN  504 10_665 ? ? ? ? ? ? ? 1.860 ? ? 
metalc2  metalc ? ? A HIS 76  ND1 ? ? ? 1_555 E ZN  . ZN ? ? A HIS 73  A ZN  504 1_555  ? ? ? ? ? ? ? 2.093 ? ? 
metalc3  metalc ? ? A HIS 92  ND1 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 89  A ZN  503 1_555  ? ? ? ? ? ? ? 2.092 ? ? 
metalc4  metalc ? ? A ASP 111 OD2 ? ? ? 1_555 D ZN  . ZN ? ? A ASP 108 A ZN  503 1_555  ? ? ? ? ? ? ? 2.145 ? ? 
metalc5  metalc ? ? A CYS 114 SG  ? ? ? 1_555 F ZN  . ZN ? ? A CYS 111 A ZN  505 1_555  ? ? ? ? ? ? ? 2.398 ? ? 
metalc6  metalc ? ? A CYS 192 SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 189 A ZN  502 1_555  ? ? ? ? ? ? ? 2.779 ? ? 
metalc7  metalc ? ? A CYS 195 SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 192 A ZN  502 1_555  ? ? ? ? ? ? ? 2.373 ? ? 
metalc8  metalc ? ? A CYS 227 SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 224 A ZN  502 1_555  ? ? ? ? ? ? ? 2.429 ? ? 
metalc9  metalc ? ? A CYS 229 SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 226 A ZN  502 1_555  ? ? ? ? ? ? ? 2.549 ? ? 
metalc10 metalc ? ? A CYS 273 SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 270 A ZN  503 15_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc11 metalc ? ? A HIS 275 ND1 ? ? ? 1_555 F ZN  . ZN ? ? A HIS 272 A ZN  505 1_555  ? ? ? ? ? ? ? 2.044 ? ? 
metalc12 metalc ? ? F ZN  .   ZN  ? ? ? 1_555 L HOH . O  ? ? A ZN  505 A HOH 621 1_555  ? ? ? ? ? ? ? 2.147 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA5 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 20  ? THR A 21  ? HIS A 17  THR A 18  
AA1 2 PHE A 11  ? THR A 13  ? PHE A 8   THR A 10  
AA1 3 THR A 57  ? VAL A 60  ? THR A 54  VAL A 57  
AA1 4 THR A 37  ? LEU A 39  ? THR A 34  LEU A 36  
AA1 5 ALA A 42  ? ASP A 43  ? ALA A 39  ASP A 40  
AA2 1 GLN A 100 ? VAL A 101 ? GLN A 97  VAL A 98  
AA2 2 LEU A 104 ? THR A 105 ? LEU A 101 THR A 102 
AA3 1 GLY A 196 ? LYS A 203 ? GLY A 193 LYS A 200 
AA3 2 LYS A 185 ? CYS A 192 ? LYS A 182 CYS A 189 
AA3 3 GLN A 232 ? GLU A 241 ? GLN A 229 GLU A 238 
AA3 4 VAL A 223 ? PRO A 226 ? VAL A 220 PRO A 223 
AA4 1 GLY A 196 ? LYS A 203 ? GLY A 193 LYS A 200 
AA4 2 LYS A 185 ? CYS A 192 ? LYS A 182 CYS A 189 
AA4 3 GLN A 232 ? GLU A 241 ? GLN A 229 GLU A 238 
AA4 4 SER A 312 ? THR A 314 ? SER A 309 THR A 311 
AA5 1 MET A 209 ? MET A 211 ? MET A 206 MET A 208 
AA5 2 PHE A 244 ? LYS A 257 ? PHE A 241 LYS A 254 
AA5 3 GLU A 298 ? LYS A 309 ? GLU A 295 LYS A 306 
AA5 4 CYS A 263 ? THR A 268 ? CYS A 260 THR A 265 
AA5 5 HIS A 275 ? SER A 281 ? HIS A 272 SER A 278 
AA5 6 LEU A 285 ? ASP A 289 ? LEU A 282 ASP A 286 
AA5 7 LEU A 292 ? SER A 296 ? LEU A 289 SER A 293 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O HIS A 20  ? O HIS A 17  N THR A 12  ? N THR A 9   
AA1 2 3 N PHE A 11  ? N PHE A 8   O PHE A 58  ? O PHE A 55  
AA1 3 4 O TYR A 59  ? O TYR A 56  N TYR A 38  ? N TYR A 35  
AA1 4 5 N LEU A 39  ? N LEU A 36  O ALA A 42  ? O ALA A 39  
AA2 1 2 N VAL A 101 ? N VAL A 98  O LEU A 104 ? O LEU A 101 
AA3 1 2 O LEU A 202 ? O LEU A 199 N ARG A 186 ? N ARG A 183 
AA3 2 3 N VAL A 187 ? N VAL A 184 O VAL A 238 ? O VAL A 235 
AA3 3 4 O ALA A 233 ? O ALA A 230 N ILE A 225 ? N ILE A 222 
AA4 1 2 O LEU A 202 ? O LEU A 199 N ARG A 186 ? N ARG A 183 
AA4 2 3 N VAL A 187 ? N VAL A 184 O VAL A 238 ? O VAL A 235 
AA4 3 4 N GLN A 240 ? N GLN A 237 O TYR A 313 ? O TYR A 310 
AA5 1 2 N TYR A 210 ? N TYR A 207 O SER A 248 ? O SER A 245 
AA5 2 3 N MET A 247 ? N MET A 244 O VAL A 306 ? O VAL A 303 
AA5 3 4 O PHE A 307 ? O PHE A 304 N CYS A 263 ? N CYS A 260 
AA5 4 5 N GLU A 266 ? N GLU A 263 O LYS A 277 ? O LYS A 274 
AA5 5 6 N HIS A 278 ? N HIS A 275 O ILE A 288 ? O ILE A 285 
AA5 6 7 N ASP A 289 ? N ASP A 286 O LEU A 292 ? O LEU A 289 
# 
_atom_sites.entry_id                    7JIW 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.008799 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008799 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004534 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
ZN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   -2  ?   ?   ?   A . n 
A 1 2   ASN 2   -1  ?   ?   ?   A . n 
A 1 3   ALA 3   0   ?   ?   ?   A . n 
A 1 4   GLU 4   1   ?   ?   ?   A . n 
A 1 5   VAL 5   2   ?   ?   ?   A . n 
A 1 6   ARG 6   3   ?   ?   ?   A . n 
A 1 7   THR 7   4   ?   ?   ?   A . n 
A 1 8   ILE 8   5   ?   ?   ?   A . n 
A 1 9   LYS 9   6   ?   ?   ?   A . n 
A 1 10  VAL 10  7   7   VAL VAL A . n 
A 1 11  PHE 11  8   8   PHE PHE A . n 
A 1 12  THR 12  9   9   THR THR A . n 
A 1 13  THR 13  10  10  THR THR A . n 
A 1 14  VAL 14  11  11  VAL VAL A . n 
A 1 15  ASP 15  12  12  ASP ASP A . n 
A 1 16  ASN 16  13  13  ASN ASN A . n 
A 1 17  ILE 17  14  14  ILE ILE A . n 
A 1 18  ASN 18  15  15  ASN ASN A . n 
A 1 19  LEU 19  16  16  LEU LEU A . n 
A 1 20  HIS 20  17  17  HIS HIS A . n 
A 1 21  THR 21  18  18  THR THR A . n 
A 1 22  GLN 22  19  19  GLN GLN A . n 
A 1 23  VAL 23  20  20  VAL VAL A . n 
A 1 24  VAL 24  21  ?   ?   ?   A . n 
A 1 25  ASP 25  22  ?   ?   ?   A . n 
A 1 26  MET 26  23  ?   ?   ?   A . n 
A 1 27  SER 27  24  ?   ?   ?   A . n 
A 1 28  MET 28  25  25  MET MET A . n 
A 1 29  THR 29  26  26  THR THR A . n 
A 1 30  TYR 30  27  27  TYR TYR A . n 
A 1 31  GLY 31  28  28  GLY GLY A . n 
A 1 32  GLN 32  29  29  GLN GLN A . n 
A 1 33  GLN 33  30  30  GLN GLN A . n 
A 1 34  PHE 34  31  31  PHE PHE A . n 
A 1 35  GLY 35  32  32  GLY GLY A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  THR 37  34  34  THR THR A . n 
A 1 38  TYR 38  35  35  TYR TYR A . n 
A 1 39  LEU 39  36  36  LEU LEU A . n 
A 1 40  ASP 40  37  37  ASP ASP A . n 
A 1 41  GLY 41  38  38  GLY GLY A . n 
A 1 42  ALA 42  39  39  ALA ALA A . n 
A 1 43  ASP 43  40  40  ASP ASP A . n 
A 1 44  VAL 44  41  41  VAL VAL A . n 
A 1 45  THR 45  42  42  THR THR A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  ILE 47  44  44  ILE ILE A . n 
A 1 48  LYS 48  45  45  LYS LYS A . n 
A 1 49  PRO 49  46  46  PRO PRO A . n 
A 1 50  HIS 50  47  47  HIS HIS A . n 
A 1 51  ASN 51  48  48  ASN ASN A . n 
A 1 52  SER 52  49  49  SER SER A . n 
A 1 53  HIS 53  50  50  HIS HIS A . n 
A 1 54  GLU 54  51  51  GLU GLU A . n 
A 1 55  GLY 55  52  52  GLY GLY A . n 
A 1 56  LYS 56  53  53  LYS LYS A . n 
A 1 57  THR 57  54  54  THR THR A . n 
A 1 58  PHE 58  55  55  PHE PHE A . n 
A 1 59  TYR 59  56  56  TYR TYR A . n 
A 1 60  VAL 60  57  57  VAL VAL A . n 
A 1 61  LEU 61  58  58  LEU LEU A . n 
A 1 62  PRO 62  59  59  PRO PRO A . n 
A 1 63  ASN 63  60  60  ASN ASN A . n 
A 1 64  ASP 64  61  61  ASP ASP A . n 
A 1 65  ASP 65  62  62  ASP ASP A . n 
A 1 66  THR 66  63  63  THR THR A . n 
A 1 67  LEU 67  64  64  LEU LEU A . n 
A 1 68  ARG 68  65  65  ARG ARG A . n 
A 1 69  VAL 69  66  66  VAL VAL A . n 
A 1 70  GLU 70  67  67  GLU GLU A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  PHE 72  69  69  PHE PHE A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  TYR 74  71  71  TYR TYR A . n 
A 1 75  TYR 75  72  72  TYR TYR A . n 
A 1 76  HIS 76  73  73  HIS HIS A . n 
A 1 77  THR 77  74  74  THR THR A . n 
A 1 78  THR 78  75  75  THR THR A . n 
A 1 79  ASP 79  76  76  ASP ASP A . n 
A 1 80  PRO 80  77  77  PRO PRO A . n 
A 1 81  SER 81  78  78  SER SER A . n 
A 1 82  PHE 82  79  79  PHE PHE A . n 
A 1 83  LEU 83  80  80  LEU LEU A . n 
A 1 84  GLY 84  81  81  GLY GLY A . n 
A 1 85  ARG 85  82  82  ARG ARG A . n 
A 1 86  TYR 86  83  83  TYR TYR A . n 
A 1 87  MET 87  84  84  MET MET A . n 
A 1 88  SER 88  85  85  SER SER A . n 
A 1 89  ALA 89  86  86  ALA ALA A . n 
A 1 90  LEU 90  87  87  LEU LEU A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  HIS 92  89  89  HIS HIS A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  LYS 95  92  92  LYS LYS A . n 
A 1 96  TRP 96  93  93  TRP TRP A . n 
A 1 97  LYS 97  94  94  LYS LYS A . n 
A 1 98  TYR 98  95  95  TYR TYR A . n 
A 1 99  PRO 99  96  96  PRO PRO A . n 
A 1 100 GLN 100 97  97  GLN GLN A . n 
A 1 101 VAL 101 98  98  VAL VAL A . n 
A 1 102 ASN 102 99  99  ASN ASN A . n 
A 1 103 GLY 103 100 100 GLY GLY A . n 
A 1 104 LEU 104 101 101 LEU LEU A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 SER 106 103 103 SER SER A . n 
A 1 107 ILE 107 104 104 ILE ILE A . n 
A 1 108 LYS 108 105 105 LYS LYS A . n 
A 1 109 TRP 109 106 106 TRP TRP A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 ASP 111 108 108 ASP ASP A . n 
A 1 112 ASN 112 109 109 ASN ASN A . n 
A 1 113 ASN 113 110 110 ASN ASN A . n 
A 1 114 CYS 114 111 111 CYS CYS A . n 
A 1 115 TYR 115 112 112 TYR TYR A . n 
A 1 116 LEU 116 113 113 LEU LEU A . n 
A 1 117 ALA 117 114 114 ALA ALA A . n 
A 1 118 THR 118 115 115 THR THR A . n 
A 1 119 ALA 119 116 116 ALA ALA A . n 
A 1 120 LEU 120 117 117 LEU LEU A . n 
A 1 121 LEU 121 118 118 LEU LEU A . n 
A 1 122 THR 122 119 119 THR THR A . n 
A 1 123 LEU 123 120 120 LEU LEU A . n 
A 1 124 GLN 124 121 121 GLN GLN A . n 
A 1 125 GLN 125 122 122 GLN GLN A . n 
A 1 126 ILE 126 123 123 ILE ILE A . n 
A 1 127 GLU 127 124 124 GLU GLU A . n 
A 1 128 LEU 128 125 125 LEU LEU A . n 
A 1 129 LYS 129 126 126 LYS LYS A . n 
A 1 130 PHE 130 127 127 PHE PHE A . n 
A 1 131 ASN 131 128 128 ASN ASN A . n 
A 1 132 PRO 132 129 129 PRO PRO A . n 
A 1 133 PRO 133 130 130 PRO PRO A . n 
A 1 134 ALA 134 131 131 ALA ALA A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 ASP 137 134 134 ASP ASP A . n 
A 1 138 ALA 138 135 135 ALA ALA A . n 
A 1 139 TYR 139 136 136 TYR TYR A . n 
A 1 140 TYR 140 137 137 TYR TYR A . n 
A 1 141 ARG 141 138 138 ARG ARG A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ARG 143 140 140 ARG ARG A . n 
A 1 144 ALA 144 141 141 ALA ALA A . n 
A 1 145 GLY 145 142 142 GLY GLY A . n 
A 1 146 GLU 146 143 143 GLU GLU A . n 
A 1 147 ALA 147 144 144 ALA ALA A . n 
A 1 148 ALA 148 145 145 ALA ALA A . n 
A 1 149 ASN 149 146 146 ASN ASN A . n 
A 1 150 PHE 150 147 147 PHE PHE A . n 
A 1 151 CYS 151 148 148 CYS CYS A . n 
A 1 152 ALA 152 149 149 ALA ALA A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 ILE 154 151 151 ILE ILE A . n 
A 1 155 LEU 155 152 152 LEU LEU A . n 
A 1 156 ALA 156 153 153 ALA ALA A . n 
A 1 157 TYR 157 154 154 TYR TYR A . n 
A 1 158 CYS 158 155 155 CYS CYS A . n 
A 1 159 ASN 159 156 156 ASN ASN A . n 
A 1 160 LYS 160 157 157 LYS LYS A . n 
A 1 161 THR 161 158 158 THR THR A . n 
A 1 162 VAL 162 159 159 VAL VAL A . n 
A 1 163 GLY 163 160 160 GLY GLY A . n 
A 1 164 GLU 164 161 161 GLU GLU A . n 
A 1 165 LEU 165 162 162 LEU LEU A . n 
A 1 166 GLY 166 163 163 GLY GLY A . n 
A 1 167 ASP 167 164 164 ASP ASP A . n 
A 1 168 VAL 168 165 165 VAL VAL A . n 
A 1 169 ARG 169 166 166 ARG ARG A . n 
A 1 170 GLU 170 167 167 GLU GLU A . n 
A 1 171 THR 171 168 168 THR THR A . n 
A 1 172 MET 172 169 169 MET MET A . n 
A 1 173 SER 173 170 170 SER SER A . n 
A 1 174 TYR 174 171 171 TYR TYR A . n 
A 1 175 LEU 175 172 172 LEU LEU A . n 
A 1 176 PHE 176 173 173 PHE PHE A . n 
A 1 177 GLN 177 174 174 GLN GLN A . n 
A 1 178 HIS 178 175 175 HIS HIS A . n 
A 1 179 ALA 179 176 176 ALA ALA A . n 
A 1 180 ASN 180 177 177 ASN ASN A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 ASP 182 179 179 ASP ASP A . n 
A 1 183 SER 183 180 180 SER SER A . n 
A 1 184 CYS 184 181 181 CYS CYS A . n 
A 1 185 LYS 185 182 182 LYS LYS A . n 
A 1 186 ARG 186 183 183 ARG ARG A . n 
A 1 187 VAL 187 184 184 VAL VAL A . n 
A 1 188 LEU 188 185 185 LEU LEU A . n 
A 1 189 ASN 189 186 186 ASN ASN A . n 
A 1 190 VAL 190 187 187 VAL VAL A . n 
A 1 191 VAL 191 188 188 VAL VAL A . n 
A 1 192 CYS 192 189 189 CYS CYS A . n 
A 1 193 LYS 193 190 190 LYS LYS A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 CYS 195 192 192 CYS CYS A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 GLN 197 194 194 GLN GLN A . n 
A 1 198 GLN 198 195 195 GLN GLN A . n 
A 1 199 GLN 199 196 196 GLN GLN A . n 
A 1 200 THR 200 197 197 THR THR A . n 
A 1 201 THR 201 198 198 THR THR A . n 
A 1 202 LEU 202 199 199 LEU LEU A . n 
A 1 203 LYS 203 200 200 LYS LYS A . n 
A 1 204 GLY 204 201 201 GLY GLY A . n 
A 1 205 VAL 205 202 202 VAL VAL A . n 
A 1 206 GLU 206 203 203 GLU GLU A . n 
A 1 207 ALA 207 204 204 ALA ALA A . n 
A 1 208 VAL 208 205 205 VAL VAL A . n 
A 1 209 MET 209 206 206 MET MET A . n 
A 1 210 TYR 210 207 207 TYR TYR A . n 
A 1 211 MET 211 208 208 MET MET A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 LEU 214 211 211 LEU LEU A . n 
A 1 215 SER 215 212 212 SER SER A . n 
A 1 216 TYR 216 213 213 TYR TYR A . n 
A 1 217 GLU 217 214 214 GLU GLU A . n 
A 1 218 GLN 218 215 215 GLN GLN A . n 
A 1 219 PHE 219 216 216 PHE PHE A . n 
A 1 220 LYS 220 217 217 LYS LYS A . n 
A 1 221 LYS 221 218 218 LYS LYS A . n 
A 1 222 GLY 222 219 219 GLY GLY A . n 
A 1 223 VAL 223 220 220 VAL VAL A . n 
A 1 224 GLN 224 221 221 GLN GLN A . n 
A 1 225 ILE 225 222 222 ILE ILE A . n 
A 1 226 PRO 226 223 223 PRO PRO A . n 
A 1 227 CYS 227 224 224 CYS CYS A . n 
A 1 228 THR 228 225 225 THR THR A . n 
A 1 229 CYS 229 226 226 CYS CYS A . n 
A 1 230 GLY 230 227 227 GLY GLY A . n 
A 1 231 LYS 231 228 228 LYS LYS A . n 
A 1 232 GLN 232 229 229 GLN GLN A . n 
A 1 233 ALA 233 230 230 ALA ALA A . n 
A 1 234 THR 234 231 231 THR THR A . n 
A 1 235 LYS 235 232 232 LYS LYS A . n 
A 1 236 TYR 236 233 233 TYR TYR A . n 
A 1 237 LEU 237 234 234 LEU LEU A . n 
A 1 238 VAL 238 235 235 VAL VAL A . n 
A 1 239 GLN 239 236 236 GLN GLN A . n 
A 1 240 GLN 240 237 237 GLN GLN A . n 
A 1 241 GLU 241 238 238 GLU GLU A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 PRO 243 240 240 PRO PRO A . n 
A 1 244 PHE 244 241 241 PHE PHE A . n 
A 1 245 VAL 245 242 242 VAL VAL A . n 
A 1 246 MET 246 243 243 MET MET A . n 
A 1 247 MET 247 244 244 MET MET A . n 
A 1 248 SER 248 245 245 SER SER A . n 
A 1 249 ALA 249 246 246 ALA ALA A . n 
A 1 250 PRO 250 247 247 PRO PRO A . n 
A 1 251 PRO 251 248 248 PRO PRO A . n 
A 1 252 ALA 252 249 249 ALA ALA A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 TYR 254 251 251 TYR TYR A . n 
A 1 255 GLU 255 252 252 GLU GLU A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 HIS 258 255 255 HIS HIS A . n 
A 1 259 GLY 259 256 256 GLY GLY A . n 
A 1 260 THR 260 257 257 THR THR A . n 
A 1 261 PHE 261 258 258 PHE PHE A . n 
A 1 262 THR 262 259 259 THR THR A . n 
A 1 263 CYS 263 260 260 CYS CYS A . n 
A 1 264 ALA 264 261 261 ALA ALA A . n 
A 1 265 SER 265 262 262 SER SER A . n 
A 1 266 GLU 266 263 263 GLU GLU A . n 
A 1 267 TYR 267 264 264 TYR TYR A . n 
A 1 268 THR 268 265 265 THR THR A . n 
A 1 269 GLY 269 266 266 GLY GLY A . n 
A 1 270 ASN 270 267 267 ASN ASN A . n 
A 1 271 TYR 271 268 268 TYR TYR A . n 
A 1 272 GLN 272 269 269 GLN GLN A . n 
A 1 273 CYS 273 270 270 CYS CYS A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 HIS 275 272 272 HIS HIS A . n 
A 1 276 TYR 276 273 273 TYR TYR A . n 
A 1 277 LYS 277 274 274 LYS LYS A . n 
A 1 278 HIS 278 275 275 HIS HIS A . n 
A 1 279 ILE 279 276 276 ILE ILE A . n 
A 1 280 THR 280 277 277 THR THR A . n 
A 1 281 SER 281 278 278 SER SER A . n 
A 1 282 LYS 282 279 279 LYS LYS A . n 
A 1 283 GLU 283 280 280 GLU GLU A . n 
A 1 284 THR 284 281 281 THR THR A . n 
A 1 285 LEU 285 282 282 LEU LEU A . n 
A 1 286 TYR 286 283 283 TYR TYR A . n 
A 1 287 CYS 287 284 284 CYS CYS A . n 
A 1 288 ILE 288 285 285 ILE ILE A . n 
A 1 289 ASP 289 286 286 ASP ASP A . n 
A 1 290 GLY 290 287 287 GLY GLY A . n 
A 1 291 ALA 291 288 288 ALA ALA A . n 
A 1 292 LEU 292 289 289 LEU LEU A . n 
A 1 293 LEU 293 290 290 LEU LEU A . n 
A 1 294 THR 294 291 291 THR THR A . n 
A 1 295 LYS 295 292 292 LYS LYS A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 SER 297 294 294 SER SER A . n 
A 1 298 GLU 298 295 295 GLU GLU A . n 
A 1 299 TYR 299 296 296 TYR TYR A . n 
A 1 300 LYS 300 297 297 LYS LYS A . n 
A 1 301 GLY 301 298 298 GLY GLY A . n 
A 1 302 PRO 302 299 299 PRO PRO A . n 
A 1 303 ILE 303 300 300 ILE ILE A . n 
A 1 304 THR 304 301 301 THR THR A . n 
A 1 305 ASP 305 302 302 ASP ASP A . n 
A 1 306 VAL 306 303 303 VAL VAL A . n 
A 1 307 PHE 307 304 304 PHE PHE A . n 
A 1 308 TYR 308 305 305 TYR TYR A . n 
A 1 309 LYS 309 306 306 LYS LYS A . n 
A 1 310 GLU 310 307 307 GLU GLU A . n 
A 1 311 ASN 311 308 308 ASN ASN A . n 
A 1 312 SER 312 309 309 SER SER A . n 
A 1 313 TYR 313 310 310 TYR TYR A . n 
A 1 314 THR 314 311 311 THR THR A . n 
A 1 315 THR 315 312 312 THR THR A . n 
A 1 316 THR 316 313 313 THR THR A . n 
A 1 317 ILE 317 314 314 ILE ILE A . n 
A 1 318 LYS 318 315 315 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 VBY 1  501 501 VBY X30 A . 
C 3 ZN  1  502 502 ZN  ZN  A . 
D 3 ZN  1  503 504 ZN  ZN  A . 
E 3 ZN  1  504 505 ZN  ZN  A . 
F 3 ZN  1  505 506 ZN  ZN  A . 
G 4 CL  1  506 508 CL  CL  A . 
H 4 CL  1  507 509 CL  CL  A . 
I 4 CL  1  508 511 CL  CL  A . 
J 4 CL  1  509 512 CL  CL  A . 
K 5 MES 1  510 520 MES MES A . 
L 6 HOH 1  601 10  HOH HOH A . 
L 6 HOH 2  602 6   HOH HOH A . 
L 6 HOH 3  603 31  HOH HOH A . 
L 6 HOH 4  604 25  HOH HOH A . 
L 6 HOH 5  605 13  HOH HOH A . 
L 6 HOH 6  606 22  HOH HOH A . 
L 6 HOH 7  607 24  HOH HOH A . 
L 6 HOH 8  608 5   HOH HOH A . 
L 6 HOH 9  609 2   HOH HOH A . 
L 6 HOH 10 610 23  HOH HOH A . 
L 6 HOH 11 611 32  HOH HOH A . 
L 6 HOH 12 612 7   HOH HOH A . 
L 6 HOH 13 613 12  HOH HOH A . 
L 6 HOH 14 614 3   HOH HOH A . 
L 6 HOH 15 615 1   HOH HOH A . 
L 6 HOH 16 616 17  HOH HOH A . 
L 6 HOH 17 617 4   HOH HOH A . 
L 6 HOH 18 618 21  HOH HOH A . 
L 6 HOH 19 619 9   HOH HOH A . 
L 6 HOH 20 620 18  HOH HOH A . 
L 6 HOH 21 621 28  HOH HOH A . 
L 6 HOH 22 622 16  HOH HOH A . 
L 6 HOH 23 623 20  HOH HOH A . 
L 6 HOH 24 624 29  HOH HOH A . 
L 6 HOH 25 625 15  HOH HOH A . 
L 6 HOH 26 626 11  HOH HOH A . 
L 6 HOH 27 627 14  HOH HOH A . 
L 6 HOH 28 628 26  HOH HOH A . 
L 6 HOH 29 629 27  HOH HOH A . 
L 6 HOH 30 630 30  HOH HOH A . 
L 6 HOH 31 631 19  HOH HOH A . 
L 6 HOH 32 632 8   HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 65  ? A ASP 62  ? 1_555 ZN ? E ZN . ? A ZN 504 ? 10_665 ND1 ? A HIS 76  ? A HIS 73  ? 1_555 111.1 ? 
2  ND1 ? A HIS 92  ? A HIS 89  ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555  OD2 ? A ASP 111 ? A ASP 108 ? 1_555 113.3 ? 
3  ND1 ? A HIS 92  ? A HIS 89  ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555  SG  ? A CYS 273 ? A CYS 270 ? 1_555 111.6 ? 
4  OD2 ? A ASP 111 ? A ASP 108 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555  SG  ? A CYS 273 ? A CYS 270 ? 1_555 37.4  ? 
5  SG  ? A CYS 114 ? A CYS 111 ? 1_555 ZN ? F ZN . ? A ZN 505 ? 1_555  ND1 ? A HIS 275 ? A HIS 272 ? 1_555 112.4 ? 
6  SG  ? A CYS 114 ? A CYS 111 ? 1_555 ZN ? F ZN . ? A ZN 505 ? 1_555  O   ? L HOH .   ? A HOH 621 ? 1_555 103.7 ? 
7  ND1 ? A HIS 275 ? A HIS 272 ? 1_555 ZN ? F ZN . ? A ZN 505 ? 1_555  O   ? L HOH .   ? A HOH 621 ? 1_555 99.6  ? 
8  SG  ? A CYS 192 ? A CYS 189 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555  SG  ? A CYS 195 ? A CYS 192 ? 1_555 142.0 ? 
9  SG  ? A CYS 192 ? A CYS 189 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555  SG  ? A CYS 227 ? A CYS 224 ? 1_555 95.4  ? 
10 SG  ? A CYS 195 ? A CYS 192 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555  SG  ? A CYS 227 ? A CYS 224 ? 1_555 105.8 ? 
11 SG  ? A CYS 192 ? A CYS 189 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555  SG  ? A CYS 229 ? A CYS 226 ? 1_555 94.5  ? 
12 SG  ? A CYS 195 ? A CYS 192 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555  SG  ? A CYS 229 ? A CYS 226 ? 1_555 113.5 ? 
13 SG  ? A CYS 227 ? A CYS 224 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555  SG  ? A CYS 229 ? A CYS 226 ? 1_555 96.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-08-05 
2 'Structure model' 1 1 2021-01-27 
3 'Structure model' 1 2 2021-02-10 
4 'Structure model' 1 3 2021-03-31 
5 'Structure model' 1 4 2023-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'      
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Structure summary'      
4 5 'Structure model' 'Data collection'        
5 5 'Structure model' 'Database references'    
6 5 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' entity                        
2  2 'Structure model' entity_name_com               
3  3 'Structure model' citation                      
4  3 'Structure model' citation_author               
5  4 'Structure model' entity                        
6  4 'Structure model' entity_name_com               
7  4 'Structure model' struct                        
8  4 'Structure model' struct_keywords               
9  5 'Structure model' chem_comp_atom                
10 5 'Structure model' chem_comp_bond                
11 5 'Structure model' database_2                    
12 5 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_entity.pdbx_description'            
2  2 'Structure model' '_entity.pdbx_ec'                     
3  3 'Structure model' '_citation.country'                   
4  3 'Structure model' '_citation.journal_abbrev'            
5  3 'Structure model' '_citation.journal_id_CSD'            
6  3 'Structure model' '_citation.journal_id_ISSN'           
7  3 'Structure model' '_citation.journal_volume'            
8  3 'Structure model' '_citation.page_first'                
9  3 'Structure model' '_citation.page_last'                 
10 3 'Structure model' '_citation.pdbx_database_id_DOI'      
11 3 'Structure model' '_citation.pdbx_database_id_PubMed'   
12 3 'Structure model' '_citation.title'                     
13 3 'Structure model' '_citation.year'                      
14 4 'Structure model' '_entity.pdbx_description'            
15 4 'Structure model' '_entity.pdbx_ec'                     
16 4 'Structure model' '_entity_name_com.name'               
17 4 'Structure model' '_struct.title'                       
18 4 'Structure model' '_struct_keywords.pdbx_keywords'      
19 4 'Structure model' '_struct_keywords.text'               
20 5 'Structure model' '_database_2.pdbx_DOI'                
21 5 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         50.052 
_pdbx_refine_tls.origin_y         36.701 
_pdbx_refine_tls.origin_z         14.440 
_pdbx_refine_tls.T[1][1]          0.1786 
_pdbx_refine_tls.T[2][2]          0.0986 
_pdbx_refine_tls.T[3][3]          0.1351 
_pdbx_refine_tls.T[1][2]          -0.0098 
_pdbx_refine_tls.T[1][3]          -0.0495 
_pdbx_refine_tls.T[2][3]          0.0768 
_pdbx_refine_tls.L[1][1]          0.1821 
_pdbx_refine_tls.L[2][2]          0.7360 
_pdbx_refine_tls.L[3][3]          1.1556 
_pdbx_refine_tls.L[1][2]          -0.0725 
_pdbx_refine_tls.L[1][3]          -0.3353 
_pdbx_refine_tls.L[2][3]          -0.3861 
_pdbx_refine_tls.S[1][1]          -0.0057 
_pdbx_refine_tls.S[2][2]          -0.1176 
_pdbx_refine_tls.S[3][3]          0.1233 
_pdbx_refine_tls.S[1][2]          0.0158 
_pdbx_refine_tls.S[1][3]          -0.0287 
_pdbx_refine_tls.S[2][3]          0.1057 
_pdbx_refine_tls.S[2][1]          -0.1050 
_pdbx_refine_tls.S[3][1]          0.1028 
_pdbx_refine_tls.S[3][2]          0.1654 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 7   A 315 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 A 501 A 510 ? ? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0258 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-3000    ? ? ? .        2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-3000    ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? HKL-3000    ? ? ? .        5 
# 
_pdbx_entry_details.entry_id                 7JIW 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   Y 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    263 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OH 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   TYR 
_pdbx_validate_close_contact.auth_seq_id_2    296 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A TYR 136 ? ? CG A TYR 136 ? ? CD2 A TYR 136 ? ? 117.23 121.00 -3.77 0.60 N 
2 1 CB A TYR 136 ? ? CG A TYR 136 ? ? CD1 A TYR 136 ? ? 124.88 121.00 3.88  0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 47  ? ? -62.97  -171.98 
2  1 SER A 103 ? ? -100.18 -168.79 
3  1 THR A 191 ? ? -90.84  -64.96  
4  1 THR A 191 ? ? -90.59  -65.17  
5  1 HIS A 255 ? ? -36.05  128.53  
6  1 TYR A 268 ? ? -33.99  125.80  
7  1 GLN A 269 ? ? 76.96   -49.56  
8  1 LYS A 279 ? ? -108.28 -129.10 
9  1 ASN A 308 ? ? -136.61 -65.85  
10 1 THR A 313 ? ? -105.12 61.72   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER -2 ? A SER 1  
2  1 Y 1 A ASN -1 ? A ASN 2  
3  1 Y 1 A ALA 0  ? A ALA 3  
4  1 Y 1 A GLU 1  ? A GLU 4  
5  1 Y 1 A VAL 2  ? A VAL 5  
6  1 Y 1 A ARG 3  ? A ARG 6  
7  1 Y 1 A THR 4  ? A THR 7  
8  1 Y 1 A ILE 5  ? A ILE 8  
9  1 Y 1 A LYS 6  ? A LYS 9  
10 1 Y 1 A VAL 21 ? A VAL 24 
11 1 Y 1 A ASP 22 ? A ASP 25 
12 1 Y 1 A MET 23 ? A MET 26 
13 1 Y 1 A SER 24 ? A SER 27 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CL  CL   CL N N 74  
CYS N    N  N N 75  
CYS CA   C  N R 76  
CYS C    C  N N 77  
CYS O    O  N N 78  
CYS CB   C  N N 79  
CYS SG   S  N N 80  
CYS OXT  O  N N 81  
CYS H    H  N N 82  
CYS H2   H  N N 83  
CYS HA   H  N N 84  
CYS HB2  H  N N 85  
CYS HB3  H  N N 86  
CYS HG   H  N N 87  
CYS HXT  H  N N 88  
GLN N    N  N N 89  
GLN CA   C  N S 90  
GLN C    C  N N 91  
GLN O    O  N N 92  
GLN CB   C  N N 93  
GLN CG   C  N N 94  
GLN CD   C  N N 95  
GLN OE1  O  N N 96  
GLN NE2  N  N N 97  
GLN OXT  O  N N 98  
GLN H    H  N N 99  
GLN H2   H  N N 100 
GLN HA   H  N N 101 
GLN HB2  H  N N 102 
GLN HB3  H  N N 103 
GLN HG2  H  N N 104 
GLN HG3  H  N N 105 
GLN HE21 H  N N 106 
GLN HE22 H  N N 107 
GLN HXT  H  N N 108 
GLU N    N  N N 109 
GLU CA   C  N S 110 
GLU C    C  N N 111 
GLU O    O  N N 112 
GLU CB   C  N N 113 
GLU CG   C  N N 114 
GLU CD   C  N N 115 
GLU OE1  O  N N 116 
GLU OE2  O  N N 117 
GLU OXT  O  N N 118 
GLU H    H  N N 119 
GLU H2   H  N N 120 
GLU HA   H  N N 121 
GLU HB2  H  N N 122 
GLU HB3  H  N N 123 
GLU HG2  H  N N 124 
GLU HG3  H  N N 125 
GLU HE2  H  N N 126 
GLU HXT  H  N N 127 
GLY N    N  N N 128 
GLY CA   C  N N 129 
GLY C    C  N N 130 
GLY O    O  N N 131 
GLY OXT  O  N N 132 
GLY H    H  N N 133 
GLY H2   H  N N 134 
GLY HA2  H  N N 135 
GLY HA3  H  N N 136 
GLY HXT  H  N N 137 
HIS N    N  N N 138 
HIS CA   C  N S 139 
HIS C    C  N N 140 
HIS O    O  N N 141 
HIS CB   C  N N 142 
HIS CG   C  Y N 143 
HIS ND1  N  Y N 144 
HIS CD2  C  Y N 145 
HIS CE1  C  Y N 146 
HIS NE2  N  Y N 147 
HIS OXT  O  N N 148 
HIS H    H  N N 149 
HIS H2   H  N N 150 
HIS HA   H  N N 151 
HIS HB2  H  N N 152 
HIS HB3  H  N N 153 
HIS HD1  H  N N 154 
HIS HD2  H  N N 155 
HIS HE1  H  N N 156 
HIS HE2  H  N N 157 
HIS HXT  H  N N 158 
HOH O    O  N N 159 
HOH H1   H  N N 160 
HOH H2   H  N N 161 
ILE N    N  N N 162 
ILE CA   C  N S 163 
ILE C    C  N N 164 
ILE O    O  N N 165 
ILE CB   C  N S 166 
ILE CG1  C  N N 167 
ILE CG2  C  N N 168 
ILE CD1  C  N N 169 
ILE OXT  O  N N 170 
ILE H    H  N N 171 
ILE H2   H  N N 172 
ILE HA   H  N N 173 
ILE HB   H  N N 174 
ILE HG12 H  N N 175 
ILE HG13 H  N N 176 
ILE HG21 H  N N 177 
ILE HG22 H  N N 178 
ILE HG23 H  N N 179 
ILE HD11 H  N N 180 
ILE HD12 H  N N 181 
ILE HD13 H  N N 182 
ILE HXT  H  N N 183 
LEU N    N  N N 184 
LEU CA   C  N S 185 
LEU C    C  N N 186 
LEU O    O  N N 187 
LEU CB   C  N N 188 
LEU CG   C  N N 189 
LEU CD1  C  N N 190 
LEU CD2  C  N N 191 
LEU OXT  O  N N 192 
LEU H    H  N N 193 
LEU H2   H  N N 194 
LEU HA   H  N N 195 
LEU HB2  H  N N 196 
LEU HB3  H  N N 197 
LEU HG   H  N N 198 
LEU HD11 H  N N 199 
LEU HD12 H  N N 200 
LEU HD13 H  N N 201 
LEU HD21 H  N N 202 
LEU HD22 H  N N 203 
LEU HD23 H  N N 204 
LEU HXT  H  N N 205 
LYS N    N  N N 206 
LYS CA   C  N S 207 
LYS C    C  N N 208 
LYS O    O  N N 209 
LYS CB   C  N N 210 
LYS CG   C  N N 211 
LYS CD   C  N N 212 
LYS CE   C  N N 213 
LYS NZ   N  N N 214 
LYS OXT  O  N N 215 
LYS H    H  N N 216 
LYS H2   H  N N 217 
LYS HA   H  N N 218 
LYS HB2  H  N N 219 
LYS HB3  H  N N 220 
LYS HG2  H  N N 221 
LYS HG3  H  N N 222 
LYS HD2  H  N N 223 
LYS HD3  H  N N 224 
LYS HE2  H  N N 225 
LYS HE3  H  N N 226 
LYS HZ1  H  N N 227 
LYS HZ2  H  N N 228 
LYS HZ3  H  N N 229 
LYS HXT  H  N N 230 
MES O1   O  N N 231 
MES C2   C  N N 232 
MES C3   C  N N 233 
MES N4   N  N N 234 
MES C5   C  N N 235 
MES C6   C  N N 236 
MES C7   C  N N 237 
MES C8   C  N N 238 
MES S    S  N N 239 
MES O1S  O  N N 240 
MES O2S  O  N N 241 
MES O3S  O  N N 242 
MES H21  H  N N 243 
MES H22  H  N N 244 
MES H31  H  N N 245 
MES H32  H  N N 246 
MES HN4  H  N N 247 
MES H51  H  N N 248 
MES H52  H  N N 249 
MES H61  H  N N 250 
MES H62  H  N N 251 
MES H71  H  N N 252 
MES H72  H  N N 253 
MES H81  H  N N 254 
MES H82  H  N N 255 
MET N    N  N N 256 
MET CA   C  N S 257 
MET C    C  N N 258 
MET O    O  N N 259 
MET CB   C  N N 260 
MET CG   C  N N 261 
MET SD   S  N N 262 
MET CE   C  N N 263 
MET OXT  O  N N 264 
MET H    H  N N 265 
MET H2   H  N N 266 
MET HA   H  N N 267 
MET HB2  H  N N 268 
MET HB3  H  N N 269 
MET HG2  H  N N 270 
MET HG3  H  N N 271 
MET HE1  H  N N 272 
MET HE2  H  N N 273 
MET HE3  H  N N 274 
MET HXT  H  N N 275 
PHE N    N  N N 276 
PHE CA   C  N S 277 
PHE C    C  N N 278 
PHE O    O  N N 279 
PHE CB   C  N N 280 
PHE CG   C  Y N 281 
PHE CD1  C  Y N 282 
PHE CD2  C  Y N 283 
PHE CE1  C  Y N 284 
PHE CE2  C  Y N 285 
PHE CZ   C  Y N 286 
PHE OXT  O  N N 287 
PHE H    H  N N 288 
PHE H2   H  N N 289 
PHE HA   H  N N 290 
PHE HB2  H  N N 291 
PHE HB3  H  N N 292 
PHE HD1  H  N N 293 
PHE HD2  H  N N 294 
PHE HE1  H  N N 295 
PHE HE2  H  N N 296 
PHE HZ   H  N N 297 
PHE HXT  H  N N 298 
PRO N    N  N N 299 
PRO CA   C  N S 300 
PRO C    C  N N 301 
PRO O    O  N N 302 
PRO CB   C  N N 303 
PRO CG   C  N N 304 
PRO CD   C  N N 305 
PRO OXT  O  N N 306 
PRO H    H  N N 307 
PRO HA   H  N N 308 
PRO HB2  H  N N 309 
PRO HB3  H  N N 310 
PRO HG2  H  N N 311 
PRO HG3  H  N N 312 
PRO HD2  H  N N 313 
PRO HD3  H  N N 314 
PRO HXT  H  N N 315 
SER N    N  N N 316 
SER CA   C  N S 317 
SER C    C  N N 318 
SER O    O  N N 319 
SER CB   C  N N 320 
SER OG   O  N N 321 
SER OXT  O  N N 322 
SER H    H  N N 323 
SER H2   H  N N 324 
SER HA   H  N N 325 
SER HB2  H  N N 326 
SER HB3  H  N N 327 
SER HG   H  N N 328 
SER HXT  H  N N 329 
THR N    N  N N 330 
THR CA   C  N S 331 
THR C    C  N N 332 
THR O    O  N N 333 
THR CB   C  N R 334 
THR OG1  O  N N 335 
THR CG2  C  N N 336 
THR OXT  O  N N 337 
THR H    H  N N 338 
THR H2   H  N N 339 
THR HA   H  N N 340 
THR HB   H  N N 341 
THR HG1  H  N N 342 
THR HG21 H  N N 343 
THR HG22 H  N N 344 
THR HG23 H  N N 345 
THR HXT  H  N N 346 
TRP N    N  N N 347 
TRP CA   C  N S 348 
TRP C    C  N N 349 
TRP O    O  N N 350 
TRP CB   C  N N 351 
TRP CG   C  Y N 352 
TRP CD1  C  Y N 353 
TRP CD2  C  Y N 354 
TRP NE1  N  Y N 355 
TRP CE2  C  Y N 356 
TRP CE3  C  Y N 357 
TRP CZ2  C  Y N 358 
TRP CZ3  C  Y N 359 
TRP CH2  C  Y N 360 
TRP OXT  O  N N 361 
TRP H    H  N N 362 
TRP H2   H  N N 363 
TRP HA   H  N N 364 
TRP HB2  H  N N 365 
TRP HB3  H  N N 366 
TRP HD1  H  N N 367 
TRP HE1  H  N N 368 
TRP HE3  H  N N 369 
TRP HZ2  H  N N 370 
TRP HZ3  H  N N 371 
TRP HH2  H  N N 372 
TRP HXT  H  N N 373 
TYR N    N  N N 374 
TYR CA   C  N S 375 
TYR C    C  N N 376 
TYR O    O  N N 377 
TYR CB   C  N N 378 
TYR CG   C  Y N 379 
TYR CD1  C  Y N 380 
TYR CD2  C  Y N 381 
TYR CE1  C  Y N 382 
TYR CE2  C  Y N 383 
TYR CZ   C  Y N 384 
TYR OH   O  N N 385 
TYR OXT  O  N N 386 
TYR H    H  N N 387 
TYR H2   H  N N 388 
TYR HA   H  N N 389 
TYR HB2  H  N N 390 
TYR HB3  H  N N 391 
TYR HD1  H  N N 392 
TYR HD2  H  N N 393 
TYR HE1  H  N N 394 
TYR HE2  H  N N 395 
TYR HH   H  N N 396 
TYR HXT  H  N N 397 
VAL N    N  N N 398 
VAL CA   C  N S 399 
VAL C    C  N N 400 
VAL O    O  N N 401 
VAL CB   C  N N 402 
VAL CG1  C  N N 403 
VAL CG2  C  N N 404 
VAL OXT  O  N N 405 
VAL H    H  N N 406 
VAL H2   H  N N 407 
VAL HA   H  N N 408 
VAL HB   H  N N 409 
VAL HG11 H  N N 410 
VAL HG12 H  N N 411 
VAL HG13 H  N N 412 
VAL HG21 H  N N 413 
VAL HG22 H  N N 414 
VAL HG23 H  N N 415 
VAL HXT  H  N N 416 
VBY C1   C  N N 417 
VBY C10  C  Y N 418 
VBY C11  C  Y N 419 
VBY C12  C  Y N 420 
VBY C13  C  Y N 421 
VBY C14  C  Y N 422 
VBY C16  C  N N 423 
VBY C17  C  Y N 424 
VBY C18  C  Y N 425 
VBY C19  C  Y N 426 
VBY C20  C  Y N 427 
VBY C21  C  Y N 428 
VBY C22  C  Y N 429 
VBY C24  C  N N 430 
VBY C25  C  N N 431 
VBY C27  C  N N 432 
VBY C3   C  Y N 433 
VBY C4   C  Y N 434 
VBY C5   C  Y N 435 
VBY C6   C  N R 436 
VBY C8   C  Y N 437 
VBY C9   C  Y N 438 
VBY N2   N  N N 439 
VBY O7   O  N N 440 
VBY N01  N  N N 441 
VBY O26  O  N N 442 
VBY C01  C  N N 443 
VBY H1   H  N N 444 
VBY H2   H  N N 445 
VBY H3   H  N N 446 
VBY H4   H  N N 447 
VBY H5   H  N N 448 
VBY H6   H  N N 449 
VBY H7   H  N N 450 
VBY H8   H  N N 451 
VBY H9   H  N N 452 
VBY H10  H  N N 453 
VBY H11  H  N N 454 
VBY H12  H  N N 455 
VBY H13  H  N N 456 
VBY H14  H  N N 457 
VBY H15  H  N N 458 
VBY H16  H  N N 459 
VBY H17  H  N N 460 
VBY H18  H  N N 461 
VBY H19  H  N N 462 
VBY H20  H  N N 463 
VBY H21  H  N N 464 
VBY H22  H  N N 465 
ZN  ZN   ZN N N 466 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MES O1  C2   sing N N 218 
MES O1  C6   sing N N 219 
MES C2  C3   sing N N 220 
MES C2  H21  sing N N 221 
MES C2  H22  sing N N 222 
MES C3  N4   sing N N 223 
MES C3  H31  sing N N 224 
MES C3  H32  sing N N 225 
MES N4  C5   sing N N 226 
MES N4  C7   sing N N 227 
MES N4  HN4  sing N N 228 
MES C5  C6   sing N N 229 
MES C5  H51  sing N N 230 
MES C5  H52  sing N N 231 
MES C6  H61  sing N N 232 
MES C6  H62  sing N N 233 
MES C7  C8   sing N N 234 
MES C7  H71  sing N N 235 
MES C7  H72  sing N N 236 
MES C8  S    sing N N 237 
MES C8  H81  sing N N 238 
MES C8  H82  sing N N 239 
MES S   O1S  doub N N 240 
MES S   O2S  doub N N 241 
MES S   O3S  sing N N 242 
MET N   CA   sing N N 243 
MET N   H    sing N N 244 
MET N   H2   sing N N 245 
MET CA  C    sing N N 246 
MET CA  CB   sing N N 247 
MET CA  HA   sing N N 248 
MET C   O    doub N N 249 
MET C   OXT  sing N N 250 
MET CB  CG   sing N N 251 
MET CB  HB2  sing N N 252 
MET CB  HB3  sing N N 253 
MET CG  SD   sing N N 254 
MET CG  HG2  sing N N 255 
MET CG  HG3  sing N N 256 
MET SD  CE   sing N N 257 
MET CE  HE1  sing N N 258 
MET CE  HE2  sing N N 259 
MET CE  HE3  sing N N 260 
MET OXT HXT  sing N N 261 
PHE N   CA   sing N N 262 
PHE N   H    sing N N 263 
PHE N   H2   sing N N 264 
PHE CA  C    sing N N 265 
PHE CA  CB   sing N N 266 
PHE CA  HA   sing N N 267 
PHE C   O    doub N N 268 
PHE C   OXT  sing N N 269 
PHE CB  CG   sing N N 270 
PHE CB  HB2  sing N N 271 
PHE CB  HB3  sing N N 272 
PHE CG  CD1  doub Y N 273 
PHE CG  CD2  sing Y N 274 
PHE CD1 CE1  sing Y N 275 
PHE CD1 HD1  sing N N 276 
PHE CD2 CE2  doub Y N 277 
PHE CD2 HD2  sing N N 278 
PHE CE1 CZ   doub Y N 279 
PHE CE1 HE1  sing N N 280 
PHE CE2 CZ   sing Y N 281 
PHE CE2 HE2  sing N N 282 
PHE CZ  HZ   sing N N 283 
PHE OXT HXT  sing N N 284 
PRO N   CA   sing N N 285 
PRO N   CD   sing N N 286 
PRO N   H    sing N N 287 
PRO CA  C    sing N N 288 
PRO CA  CB   sing N N 289 
PRO CA  HA   sing N N 290 
PRO C   O    doub N N 291 
PRO C   OXT  sing N N 292 
PRO CB  CG   sing N N 293 
PRO CB  HB2  sing N N 294 
PRO CB  HB3  sing N N 295 
PRO CG  CD   sing N N 296 
PRO CG  HG2  sing N N 297 
PRO CG  HG3  sing N N 298 
PRO CD  HD2  sing N N 299 
PRO CD  HD3  sing N N 300 
PRO OXT HXT  sing N N 301 
SER N   CA   sing N N 302 
SER N   H    sing N N 303 
SER N   H2   sing N N 304 
SER CA  C    sing N N 305 
SER CA  CB   sing N N 306 
SER CA  HA   sing N N 307 
SER C   O    doub N N 308 
SER C   OXT  sing N N 309 
SER CB  OG   sing N N 310 
SER CB  HB2  sing N N 311 
SER CB  HB3  sing N N 312 
SER OG  HG   sing N N 313 
SER OXT HXT  sing N N 314 
THR N   CA   sing N N 315 
THR N   H    sing N N 316 
THR N   H2   sing N N 317 
THR CA  C    sing N N 318 
THR CA  CB   sing N N 319 
THR CA  HA   sing N N 320 
THR C   O    doub N N 321 
THR C   OXT  sing N N 322 
THR CB  OG1  sing N N 323 
THR CB  CG2  sing N N 324 
THR CB  HB   sing N N 325 
THR OG1 HG1  sing N N 326 
THR CG2 HG21 sing N N 327 
THR CG2 HG22 sing N N 328 
THR CG2 HG23 sing N N 329 
THR OXT HXT  sing N N 330 
TRP N   CA   sing N N 331 
TRP N   H    sing N N 332 
TRP N   H2   sing N N 333 
TRP CA  C    sing N N 334 
TRP CA  CB   sing N N 335 
TRP CA  HA   sing N N 336 
TRP C   O    doub N N 337 
TRP C   OXT  sing N N 338 
TRP CB  CG   sing N N 339 
TRP CB  HB2  sing N N 340 
TRP CB  HB3  sing N N 341 
TRP CG  CD1  doub Y N 342 
TRP CG  CD2  sing Y N 343 
TRP CD1 NE1  sing Y N 344 
TRP CD1 HD1  sing N N 345 
TRP CD2 CE2  doub Y N 346 
TRP CD2 CE3  sing Y N 347 
TRP NE1 CE2  sing Y N 348 
TRP NE1 HE1  sing N N 349 
TRP CE2 CZ2  sing Y N 350 
TRP CE3 CZ3  doub Y N 351 
TRP CE3 HE3  sing N N 352 
TRP CZ2 CH2  doub Y N 353 
TRP CZ2 HZ2  sing N N 354 
TRP CZ3 CH2  sing Y N 355 
TRP CZ3 HZ3  sing N N 356 
TRP CH2 HH2  sing N N 357 
TRP OXT HXT  sing N N 358 
TYR N   CA   sing N N 359 
TYR N   H    sing N N 360 
TYR N   H2   sing N N 361 
TYR CA  C    sing N N 362 
TYR CA  CB   sing N N 363 
TYR CA  HA   sing N N 364 
TYR C   O    doub N N 365 
TYR C   OXT  sing N N 366 
TYR CB  CG   sing N N 367 
TYR CB  HB2  sing N N 368 
TYR CB  HB3  sing N N 369 
TYR CG  CD1  doub Y N 370 
TYR CG  CD2  sing Y N 371 
TYR CD1 CE1  sing Y N 372 
TYR CD1 HD1  sing N N 373 
TYR CD2 CE2  doub Y N 374 
TYR CD2 HD2  sing N N 375 
TYR CE1 CZ   doub Y N 376 
TYR CE1 HE1  sing N N 377 
TYR CE2 CZ   sing Y N 378 
TYR CE2 HE2  sing N N 379 
TYR CZ  OH   sing N N 380 
TYR OH  HH   sing N N 381 
TYR OXT HXT  sing N N 382 
VAL N   CA   sing N N 383 
VAL N   H    sing N N 384 
VAL N   H2   sing N N 385 
VAL CA  C    sing N N 386 
VAL CA  CB   sing N N 387 
VAL CA  HA   sing N N 388 
VAL C   O    doub N N 389 
VAL C   OXT  sing N N 390 
VAL CB  CG1  sing N N 391 
VAL CB  CG2  sing N N 392 
VAL CB  HB   sing N N 393 
VAL CG1 HG11 sing N N 394 
VAL CG1 HG12 sing N N 395 
VAL CG1 HG13 sing N N 396 
VAL CG2 HG21 sing N N 397 
VAL CG2 HG22 sing N N 398 
VAL CG2 HG23 sing N N 399 
VAL OXT HXT  sing N N 400 
VBY C22 C18  doub Y N 401 
VBY C22 C20  sing Y N 402 
VBY C18 C11  sing Y N 403 
VBY C20 C14  doub Y N 404 
VBY C11 C12  doub Y N 405 
VBY C11 C8   sing Y N 406 
VBY C14 C8   sing Y N 407 
VBY C25 C27  doub N N 408 
VBY C25 C24  sing N N 409 
VBY O26 C24  doub N N 410 
VBY C12 C9   sing Y N 411 
VBY C8  C5   doub Y N 412 
VBY C24 N01  sing N N 413 
VBY O7  C1   doub N N 414 
VBY N01 C19  sing N N 415 
VBY C9  C4   doub Y N 416 
VBY C13 C19  doub Y N 417 
VBY C13 C3   sing Y N 418 
VBY C19 C21  sing Y N 419 
VBY C5  C4   sing Y N 420 
VBY C5  C6   sing N N 421 
VBY C1  C3   sing N N 422 
VBY C1  N2   sing N N 423 
VBY C3  C10  doub Y N 424 
VBY C21 C17  doub Y N 425 
VBY C10 C17  sing Y N 426 
VBY C10 C16  sing N N 427 
VBY C6  N2   sing N N 428 
VBY C6  C01  sing N N 429 
VBY C12 H1   sing N N 430 
VBY C13 H2   sing N N 431 
VBY C14 H3   sing N N 432 
VBY C16 H4   sing N N 433 
VBY C16 H5   sing N N 434 
VBY C16 H6   sing N N 435 
VBY C17 H7   sing N N 436 
VBY C18 H8   sing N N 437 
VBY C20 H9   sing N N 438 
VBY C21 H10  sing N N 439 
VBY C22 H11  sing N N 440 
VBY C25 H12  sing N N 441 
VBY C27 H13  sing N N 442 
VBY C27 H14  sing N N 443 
VBY C4  H15  sing N N 444 
VBY C6  H16  sing N N 445 
VBY C9  H17  sing N N 446 
VBY N2  H18  sing N N 447 
VBY N01 H19  sing N N 448 
VBY C01 H20  sing N N 449 
VBY C01 H21  sing N N 450 
VBY C01 H22  sing N N 451 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 
HHSN272201200026C 1 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 
HHSN272201700060C 2 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        VBY 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   VBY 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]benzamide' VBY 
3 'ZINC ION'                                                              ZN  
4 'CHLORIDE ION'                                                          CL  
5 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                  MES 
6 water                                                                   HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   6WZU 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#