data_7JNY # _entry.id 7JNY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7JNY pdb_00007jny 10.2210/pdb7jny/pdb WWPDB D_1000251097 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2020-10-07 _pdbx_database_PDB_obs_spr.pdb_id 7JNY _pdbx_database_PDB_obs_spr.replace_pdb_id 4ZAI _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 4ZAI _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7JNY _pdbx_database_status.recvd_initial_deposition_date 2020-08-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rosenberg Jr., E.M.' 1 ? 'Rajasekaran, D.' 2 ? 'Murphy, J.W.' 3 ? 'Pantouris, G.' 4 ? 'Lolis, E.J.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 76 _citation.language ? _citation.page_first 1033 _citation.page_last 1049 _citation.title 'The N-terminal length and side-chain composition of CXCL13 affect crystallization, structure and functional activity.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798320011687 _citation.pdbx_database_id_PubMed 33021505 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rosenberg Jr., E.M.' 1 ? primary 'Herrington, J.' 2 ? primary 'Rajasekaran, D.' 3 ? primary 'Murphy, J.W.' 4 ? primary 'Pantouris, G.' 5 ? primary 'Lolis, E.J.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7JNY _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.967 _cell.length_a_esd ? _cell.length_b 48.967 _cell.length_b_esd ? _cell.length_c 80.278 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7JNY _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'C-X-C motif chemokine 13' 10466.571 1 ? ? ? ? 2 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Angie,B cell-attracting chemokine 1,BCA-1,B lymphocyte chemoattractant,CXC chemokine BLC,Small-inducible cytokine B13' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPV PVFKRKIP ; _entity_poly.pdbx_seq_one_letter_code_can ;MVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPV PVFKRKIP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LEU n 1 4 GLU n 1 5 VAL n 1 6 TYR n 1 7 TYR n 1 8 THR n 1 9 SER n 1 10 LEU n 1 11 ARG n 1 12 CYS n 1 13 ARG n 1 14 CYS n 1 15 VAL n 1 16 GLN n 1 17 GLU n 1 18 SER n 1 19 SER n 1 20 VAL n 1 21 PHE n 1 22 ILE n 1 23 PRO n 1 24 ARG n 1 25 ARG n 1 26 PHE n 1 27 ILE n 1 28 ASP n 1 29 ARG n 1 30 ILE n 1 31 GLN n 1 32 ILE n 1 33 LEU n 1 34 PRO n 1 35 ARG n 1 36 GLY n 1 37 ASN n 1 38 GLY n 1 39 CYS n 1 40 PRO n 1 41 ARG n 1 42 LYS n 1 43 GLU n 1 44 ILE n 1 45 ILE n 1 46 VAL n 1 47 TRP n 1 48 LYS n 1 49 LYS n 1 50 ASN n 1 51 LYS n 1 52 SER n 1 53 ILE n 1 54 VAL n 1 55 CYS n 1 56 VAL n 1 57 ASP n 1 58 PRO n 1 59 GLN n 1 60 ALA n 1 61 GLU n 1 62 TRP n 1 63 ILE n 1 64 GLN n 1 65 ARG n 1 66 MET n 1 67 MET n 1 68 GLU n 1 69 VAL n 1 70 LEU n 1 71 ARG n 1 72 LYS n 1 73 ARG n 1 74 SER n 1 75 SER n 1 76 SER n 1 77 THR n 1 78 LEU n 1 79 PRO n 1 80 VAL n 1 81 PRO n 1 82 VAL n 1 83 PHE n 1 84 LYS n 1 85 ARG n 1 86 LYS n 1 87 ILE n 1 88 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 88 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CXCL13, BCA1, BLC, SCYB13' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CXL13_HUMAN _struct_ref.pdbx_db_accession O43927 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVP VFKRKIP ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7JNY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43927 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 87 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7JNY _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O43927 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7JNY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Sodium chloride 0.1 M BIS-TRIS propane pH 9.0, 25% w/v Polyethylene glycol 1,500. Crystals formed within a couple days' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type RIGAKU _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7JNY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.88 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9412 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.12 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.88 1.91 ? ? ? ? ? ? 411 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 0.754 ? ? 1.91 1.95 ? ? ? ? ? ? 461 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 0.833 ? ? 1.95 1.98 ? ? ? ? ? ? 434 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 0.865 ? ? 1.98 2.03 ? ? ? ? ? ? 465 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 0.874 ? ? 2.03 2.07 ? ? ? ? ? ? 467 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 0.941 ? ? 2.07 2.12 ? ? ? ? ? ? 478 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 0.935 ? ? 2.12 2.17 ? ? ? ? ? ? 450 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 0.952 ? ? 2.17 2.23 ? ? ? ? ? ? 476 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 0.973 ? ? 2.23 2.29 ? ? ? ? ? ? 467 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 0.979 ? ? 2.29 2.37 ? ? ? ? ? ? 448 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 0.982 ? ? 2.37 2.45 ? ? ? ? ? ? 487 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 0.988 ? ? 2.45 2.55 ? ? ? ? ? ? 462 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 0.993 ? ? 2.55 2.67 ? ? ? ? ? ? 467 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 0.993 ? ? 2.67 2.81 ? ? ? ? ? ? 477 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 0.995 ? ? 2.81 2.98 ? ? ? ? ? ? 477 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 0.996 ? ? 2.98 3.21 ? ? ? ? ? ? 475 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 0.998 ? ? 3.21 3.54 ? ? ? ? ? ? 486 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 0.999 ? ? 3.54 4.05 ? ? ? ? ? ? 487 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 0.998 ? ? 4.05 5.10 ? ? ? ? ? ? 491 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 0.999 ? ? 5.10 50.0 ? ? ? ? ? ? 546 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 118.320 _refine.B_iso_mean 39.7731 _refine.B_iso_min 14.220 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7JNY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8800 _refine.ls_d_res_low 42.4100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9388 _refine.ls_number_reflns_R_free 1756 _refine.ls_number_reflns_R_work 15321 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.1700 _refine.ls_percent_reflns_R_free 10.2800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1911 _refine.ls_R_factor_R_free 0.2244 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1874 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZAI _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.7600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8800 _refine_hist.d_res_low 42.4100 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 736 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 80 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 37.81 _refine_hist.pdbx_number_atoms_protein 661 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8800 1.9300 . . 121 1038 90.0000 . . . 0.3630 0.0000 0.3101 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9300 1.9900 . . 131 1139 95.0000 . . . 0.3278 0.0000 0.2653 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9900 2.0500 . . 137 1194 98.0000 . . . 0.2998 0.0000 0.2506 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0600 2.1300 . . 138 1196 98.0000 . . . 0.2673 0.0000 0.2337 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1300 2.2100 . . 134 1165 99.0000 . . . 0.2467 0.0000 0.2025 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2100 2.3100 . . 136 1187 98.0000 . . . 0.2021 0.0000 0.1934 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3100 2.4400 . . 137 1212 99.0000 . . . 0.2444 0.0000 0.2136 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4400 2.5900 . . 135 1201 100.0000 . . . 0.2705 0.0000 0.2075 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5900 2.7900 . . 136 1183 100.0000 . . . 0.2432 0.0000 0.2036 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7900 3.0700 . . 149 1204 100.0000 . . . 0.2049 0.0000 0.1984 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0700 3.5100 . . 132 1205 100.0000 . . . 0.2257 0.0000 0.1685 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5100 4.4200 . . 144 1186 100.0000 . . . 0.1729 0.0000 0.1504 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4300 42.4100 . . 126 1211 99.0000 . . . 0.2009 0.0000 0.1553 . . . . . . . . . . . # _struct.entry_id 7JNY _struct.title 'Crystal structure of CXCL13' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7JNY _struct_keywords.text 'Chemokine, CXCL13, CYTOKINE' _struct_keywords.pdbx_keywords CYTOKINE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 23 ? ARG A 25 ? PRO A 22 ARG A 24 5 ? 3 HELX_P HELX_P2 AA2 ALA A 60 ? ARG A 73 ? ALA A 59 ARG A 72 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 11 A CYS 38 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 13 A CYS 54 1_555 ? ? ? ? ? ? ? 2.045 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 2 ? VAL A 5 ? VAL A 1 VAL A 4 AA1 2 ILE A 27 ? LEU A 33 ? ILE A 26 LEU A 32 AA1 3 GLU A 43 ? LYS A 48 ? GLU A 42 LYS A 47 AA1 4 ILE A 53 ? VAL A 56 ? ILE A 52 VAL A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 4 ? N GLU A 3 O ILE A 32 ? O ILE A 31 AA1 2 3 N ARG A 29 ? N ARG A 28 O TRP A 47 ? O TRP A 46 AA1 3 4 N ILE A 44 ? N ILE A 43 O VAL A 56 ? O VAL A 55 # _atom_sites.entry_id 7JNY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020422 _atom_sites.fract_transf_matrix[1][2] 0.011791 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023581 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012457 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 GLU 4 3 3 GLU GLU A . n A 1 5 VAL 5 4 4 VAL VAL A . n A 1 6 TYR 6 5 5 TYR TYR A . n A 1 7 TYR 7 6 6 TYR TYR A . n A 1 8 THR 8 7 7 THR THR A . n A 1 9 SER 9 8 8 SER SER A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 ARG 11 10 10 ARG ARG A . n A 1 12 CYS 12 11 11 CYS CYS A . n A 1 13 ARG 13 12 12 ARG ARG A . n A 1 14 CYS 14 13 13 CYS CYS A . n A 1 15 VAL 15 14 14 VAL VAL A . n A 1 16 GLN 16 15 15 GLN GLN A . n A 1 17 GLU 17 16 16 GLU GLU A . n A 1 18 SER 18 17 17 SER SER A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 VAL 20 19 19 VAL VAL A . n A 1 21 PHE 21 20 20 PHE PHE A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 PRO 23 22 22 PRO PRO A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 ARG 25 24 24 ARG ARG A . n A 1 26 PHE 26 25 25 PHE PHE A . n A 1 27 ILE 27 26 26 ILE ILE A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 ARG 29 28 28 ARG ARG A . n A 1 30 ILE 30 29 29 ILE ILE A . n A 1 31 GLN 31 30 30 GLN GLN A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 ASN 37 36 36 ASN ASN A . n A 1 38 GLY 38 37 37 GLY GLY A . n A 1 39 CYS 39 38 38 CYS CYS A . n A 1 40 PRO 40 39 39 PRO PRO A . n A 1 41 ARG 41 40 40 ARG ARG A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 ILE 44 43 43 ILE ILE A . n A 1 45 ILE 45 44 44 ILE ILE A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 TRP 47 46 46 TRP TRP A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 ASN 50 49 49 ASN ASN A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 SER 52 51 51 SER SER A . n A 1 53 ILE 53 52 52 ILE ILE A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 CYS 55 54 54 CYS CYS A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 PRO 58 57 57 PRO PRO A . n A 1 59 GLN 59 58 58 GLN GLN A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 TRP 62 61 61 TRP TRP A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 GLN 64 63 63 GLN GLN A . n A 1 65 ARG 65 64 64 ARG ARG A . n A 1 66 MET 66 65 65 MET MET A . n A 1 67 MET 67 66 66 MET MET A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 ARG 71 70 70 ARG ARG A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 ARG 73 72 72 ARG ARG A . n A 1 74 SER 74 73 73 SER SER A . n A 1 75 SER 75 74 74 SER SER A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 THR 77 76 76 THR THR A . n A 1 78 LEU 78 77 77 LEU LEU A . n A 1 79 PRO 79 78 78 PRO PRO A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 PRO 81 80 ? ? ? A . n A 1 82 VAL 82 81 ? ? ? A . n A 1 83 PHE 83 82 ? ? ? A . n A 1 84 LYS 84 83 ? ? ? A . n A 1 85 ARG 85 84 ? ? ? A . n A 1 86 LYS 86 85 ? ? ? A . n A 1 87 ILE 87 86 ? ? ? A . n A 1 88 PRO 88 87 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 40 HOH HOH A . B 2 HOH 2 102 23 HOH HOH A . B 2 HOH 3 103 79 HOH HOH A . B 2 HOH 4 104 45 HOH HOH A . B 2 HOH 5 105 37 HOH HOH A . B 2 HOH 6 106 51 HOH HOH A . B 2 HOH 7 107 25 HOH HOH A . B 2 HOH 8 108 78 HOH HOH A . B 2 HOH 9 109 50 HOH HOH A . B 2 HOH 10 110 29 HOH HOH A . B 2 HOH 11 111 33 HOH HOH A . B 2 HOH 12 112 41 HOH HOH A . B 2 HOH 13 113 18 HOH HOH A . B 2 HOH 14 114 77 HOH HOH A . B 2 HOH 15 115 9 HOH HOH A . B 2 HOH 16 116 5 HOH HOH A . B 2 HOH 17 117 36 HOH HOH A . B 2 HOH 18 118 14 HOH HOH A . B 2 HOH 19 119 12 HOH HOH A . B 2 HOH 20 120 47 HOH HOH A . B 2 HOH 21 121 10 HOH HOH A . B 2 HOH 22 122 13 HOH HOH A . B 2 HOH 23 123 30 HOH HOH A . B 2 HOH 24 124 16 HOH HOH A . B 2 HOH 25 125 11 HOH HOH A . B 2 HOH 26 126 34 HOH HOH A . B 2 HOH 27 127 4 HOH HOH A . B 2 HOH 28 128 3 HOH HOH A . B 2 HOH 29 129 64 HOH HOH A . B 2 HOH 30 130 27 HOH HOH A . B 2 HOH 31 131 70 HOH HOH A . B 2 HOH 32 132 26 HOH HOH A . B 2 HOH 33 133 60 HOH HOH A . B 2 HOH 34 134 21 HOH HOH A . B 2 HOH 35 135 6 HOH HOH A . B 2 HOH 36 136 58 HOH HOH A . B 2 HOH 37 137 44 HOH HOH A . B 2 HOH 38 138 65 HOH HOH A . B 2 HOH 39 139 28 HOH HOH A . B 2 HOH 40 140 2 HOH HOH A . B 2 HOH 41 141 7 HOH HOH A . B 2 HOH 42 142 1 HOH HOH A . B 2 HOH 43 143 8 HOH HOH A . B 2 HOH 44 144 32 HOH HOH A . B 2 HOH 45 145 55 HOH HOH A . B 2 HOH 46 146 38 HOH HOH A . B 2 HOH 47 147 20 HOH HOH A . B 2 HOH 48 148 17 HOH HOH A . B 2 HOH 49 149 66 HOH HOH A . B 2 HOH 50 150 76 HOH HOH A . B 2 HOH 51 151 42 HOH HOH A . B 2 HOH 52 152 49 HOH HOH A . B 2 HOH 53 153 63 HOH HOH A . B 2 HOH 54 154 54 HOH HOH A . B 2 HOH 55 155 46 HOH HOH A . B 2 HOH 56 156 56 HOH HOH A . B 2 HOH 57 157 53 HOH HOH A . B 2 HOH 58 158 75 HOH HOH A . B 2 HOH 59 159 24 HOH HOH A . B 2 HOH 60 160 19 HOH HOH A . B 2 HOH 61 161 15 HOH HOH A . B 2 HOH 62 162 72 HOH HOH A . B 2 HOH 63 163 52 HOH HOH A . B 2 HOH 64 164 57 HOH HOH A . B 2 HOH 65 165 61 HOH HOH A . B 2 HOH 66 166 71 HOH HOH A . B 2 HOH 67 167 39 HOH HOH A . B 2 HOH 68 168 68 HOH HOH A . B 2 HOH 69 169 48 HOH HOH A . B 2 HOH 70 170 67 HOH HOH A . B 2 HOH 71 171 35 HOH HOH A . B 2 HOH 72 172 22 HOH HOH A . B 2 HOH 73 173 73 HOH HOH A . B 2 HOH 74 174 31 HOH HOH A . B 2 HOH 75 175 62 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-07 2 'Structure model' 1 1 2020-10-21 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 29.2790 3.3403 -4.5933 0.3105 ? -0.0635 ? -0.0235 ? 0.1741 ? 0.0146 ? 0.2780 ? 1.4287 ? 0.5630 ? 1.1010 ? 1.4816 ? 2.5817 ? 5.9592 ? 0.0419 ? -0.0909 ? -0.0564 ? 0.3342 ? -0.1615 ? -0.1653 ? 0.0193 ? 0.3048 ? 0.1300 ? 2 'X-RAY DIFFRACTION' ? refined 25.4519 18.8980 -8.6927 0.8360 ? -0.0674 ? -0.0744 ? 0.1716 ? 0.0315 ? 0.2837 ? 3.2776 ? -0.2598 ? -0.9234 ? 4.2169 ? -1.4094 ? 4.7097 ? -0.2605 ? -0.4275 ? 0.1524 ? 0.6406 ? -0.3094 ? -0.2098 ? -0.2013 ? 0.2962 ? -0.4268 ? 3 'X-RAY DIFFRACTION' ? refined 27.4631 8.5599 -7.9843 0.3424 ? -0.1141 ? -0.0156 ? 0.1807 ? 0.0033 ? 0.2485 ? 2.8580 ? 0.5361 ? -0.1571 ? 2.2257 ? -1.5331 ? 5.9907 ? 0.2221 ? -0.0216 ? -0.0515 ? 0.4723 ? -0.2834 ? -0.0548 ? -0.7571 ? 0.5522 ? 0.1292 ? 4 'X-RAY DIFFRACTION' ? refined 28.8829 14.7952 -9.2420 0.6769 ? -0.2181 ? -0.0637 ? 0.2408 ? 0.0261 ? 0.2423 ? 1.7830 ? 0.3628 ? 1.8187 ? 2.2237 ? -0.3942 ? 2.1062 ? -0.4589 ? 0.4250 ? 0.3450 ? 0.4320 ? -0.0022 ? -0.0781 ? -0.9843 ? 0.4720 ? 0.0275 ? 5 'X-RAY DIFFRACTION' ? refined 17.3476 7.7909 -18.6401 0.3479 ? 0.1181 ? -0.0240 ? 0.1703 ? -0.0087 ? 0.2985 ? 1.5604 ? -0.1977 ? -1.2536 ? 5.5513 ? 4.6790 ? 4.7560 ? -0.0835 ? 0.0846 ? -0.0753 ? 0.1823 ? -0.3537 ? 0.4804 ? -0.6650 ? -0.6794 ? 0.3509 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? ? A 14 ? ? ;chain 'A' and (resid 0 through 14 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 15 ? ? ? A 22 ? ? ;chain 'A' and (resid 15 through 22 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 23 ? ? ? A 47 ? ? ;chain 'A' and (resid 23 through 47 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 48 ? ? ? A 59 ? ? ;chain 'A' and (resid 48 through 59 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 60 ? ? ? A 79 ? ? ;chain 'A' and (resid 60 through 79 ) ; # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_3946 1 ? 'data reduction' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 2 ? 'data scaling' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 3 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk ? ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Apr. 1, 2019' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.25 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 80 ? A PRO 81 2 1 Y 1 A VAL 81 ? A VAL 82 3 1 Y 1 A PHE 82 ? A PHE 83 4 1 Y 1 A LYS 83 ? A LYS 84 5 1 Y 1 A ARG 84 ? A ARG 85 6 1 Y 1 A LYS 85 ? A LYS 86 7 1 Y 1 A ILE 86 ? A ILE 87 8 1 Y 1 A PRO 87 ? A PRO 88 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MET N N N N 209 MET CA C N S 210 MET C C N N 211 MET O O N N 212 MET CB C N N 213 MET CG C N N 214 MET SD S N N 215 MET CE C N N 216 MET OXT O N N 217 MET H H N N 218 MET H2 H N N 219 MET HA H N N 220 MET HB2 H N N 221 MET HB3 H N N 222 MET HG2 H N N 223 MET HG3 H N N 224 MET HE1 H N N 225 MET HE2 H N N 226 MET HE3 H N N 227 MET HXT H N N 228 PHE N N N N 229 PHE CA C N S 230 PHE C C N N 231 PHE O O N N 232 PHE CB C N N 233 PHE CG C Y N 234 PHE CD1 C Y N 235 PHE CD2 C Y N 236 PHE CE1 C Y N 237 PHE CE2 C Y N 238 PHE CZ C Y N 239 PHE OXT O N N 240 PHE H H N N 241 PHE H2 H N N 242 PHE HA H N N 243 PHE HB2 H N N 244 PHE HB3 H N N 245 PHE HD1 H N N 246 PHE HD2 H N N 247 PHE HE1 H N N 248 PHE HE2 H N N 249 PHE HZ H N N 250 PHE HXT H N N 251 PRO N N N N 252 PRO CA C N S 253 PRO C C N N 254 PRO O O N N 255 PRO CB C N N 256 PRO CG C N N 257 PRO CD C N N 258 PRO OXT O N N 259 PRO H H N N 260 PRO HA H N N 261 PRO HB2 H N N 262 PRO HB3 H N N 263 PRO HG2 H N N 264 PRO HG3 H N N 265 PRO HD2 H N N 266 PRO HD3 H N N 267 PRO HXT H N N 268 SER N N N N 269 SER CA C N S 270 SER C C N N 271 SER O O N N 272 SER CB C N N 273 SER OG O N N 274 SER OXT O N N 275 SER H H N N 276 SER H2 H N N 277 SER HA H N N 278 SER HB2 H N N 279 SER HB3 H N N 280 SER HG H N N 281 SER HXT H N N 282 THR N N N N 283 THR CA C N S 284 THR C C N N 285 THR O O N N 286 THR CB C N R 287 THR OG1 O N N 288 THR CG2 C N N 289 THR OXT O N N 290 THR H H N N 291 THR H2 H N N 292 THR HA H N N 293 THR HB H N N 294 THR HG1 H N N 295 THR HG21 H N N 296 THR HG22 H N N 297 THR HG23 H N N 298 THR HXT H N N 299 TRP N N N N 300 TRP CA C N S 301 TRP C C N N 302 TRP O O N N 303 TRP CB C N N 304 TRP CG C Y N 305 TRP CD1 C Y N 306 TRP CD2 C Y N 307 TRP NE1 N Y N 308 TRP CE2 C Y N 309 TRP CE3 C Y N 310 TRP CZ2 C Y N 311 TRP CZ3 C Y N 312 TRP CH2 C Y N 313 TRP OXT O N N 314 TRP H H N N 315 TRP H2 H N N 316 TRP HA H N N 317 TRP HB2 H N N 318 TRP HB3 H N N 319 TRP HD1 H N N 320 TRP HE1 H N N 321 TRP HE3 H N N 322 TRP HZ2 H N N 323 TRP HZ3 H N N 324 TRP HH2 H N N 325 TRP HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R21AI113606 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ZAI _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? #