data_7JRQ # _entry.id 7JRQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7JRQ pdb_00007jrq 10.2210/pdb7jrq/pdb WWPDB D_1000251292 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7JRQ _pdbx_database_status.recvd_initial_deposition_date 2020-08-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mann, S.I.' 1 0000-0003-3392-3170 'DeGrado, W.F.' 2 0000-0003-4745-263X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 143 _citation.language ? _citation.page_first 252 _citation.page_last 259 _citation.title ;De Novo Design, Solution Characterization, and Crystallographic Structure of an Abiological Mn-Porphyrin-Binding Protein Capable of Stabilizing a Mn(V) Species. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.0c10136 _citation.pdbx_database_id_PubMed 33373215 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mann, S.I.' 1 ? primary 'Nayak, A.' 2 ? primary 'Gassner, G.T.' 3 ? primary 'Therien, M.J.' 4 ? primary 'DeGrado, W.F.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7JRQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.322 _cell.length_a_esd ? _cell.length_b 45.322 _cell.length_b_esd ? _cell.length_c 164.220 _cell.length_c_esd ? _cell.volume 337321.623 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7JRQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man MPP1 15495.198 1 ? ? ? ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 non-polymer syn '[5,15-diphenylporphyrinato(2-)-kappa~4~N~21~,N~22~,N~23~,N~24~]manganese' 515.466 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 37 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHENLYFQSSEKEELFEKLKQTADEAVQLFQRLREIFDKGDDDSFEQVLEELEEALQKHRQLADQGRKKGLLTSEA AKQGDQFVQLFQRFREAWDKGDKDSLEQILEELEQVAQKAVELGLKILKTQ ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHENLYFQSSEKEELFEKLKQTADEAVQLFQRLREIFDKGDDDSFEQVLEELEEALQKHRQLADQGRKKGLLTSEA AKQGDQFVQLFQRFREAWDKGDKDSLEQILEELEQVAQKAVELGLKILKTQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 GLU n 1 8 ASN n 1 9 LEU n 1 10 TYR n 1 11 PHE n 1 12 GLN n 1 13 SER n 1 14 SER n 1 15 GLU n 1 16 LYS n 1 17 GLU n 1 18 GLU n 1 19 LEU n 1 20 PHE n 1 21 GLU n 1 22 LYS n 1 23 LEU n 1 24 LYS n 1 25 GLN n 1 26 THR n 1 27 ALA n 1 28 ASP n 1 29 GLU n 1 30 ALA n 1 31 VAL n 1 32 GLN n 1 33 LEU n 1 34 PHE n 1 35 GLN n 1 36 ARG n 1 37 LEU n 1 38 ARG n 1 39 GLU n 1 40 ILE n 1 41 PHE n 1 42 ASP n 1 43 LYS n 1 44 GLY n 1 45 ASP n 1 46 ASP n 1 47 ASP n 1 48 SER n 1 49 PHE n 1 50 GLU n 1 51 GLN n 1 52 VAL n 1 53 LEU n 1 54 GLU n 1 55 GLU n 1 56 LEU n 1 57 GLU n 1 58 GLU n 1 59 ALA n 1 60 LEU n 1 61 GLN n 1 62 LYS n 1 63 HIS n 1 64 ARG n 1 65 GLN n 1 66 LEU n 1 67 ALA n 1 68 ASP n 1 69 GLN n 1 70 GLY n 1 71 ARG n 1 72 LYS n 1 73 LYS n 1 74 GLY n 1 75 LEU n 1 76 LEU n 1 77 THR n 1 78 SER n 1 79 GLU n 1 80 ALA n 1 81 ALA n 1 82 LYS n 1 83 GLN n 1 84 GLY n 1 85 ASP n 1 86 GLN n 1 87 PHE n 1 88 VAL n 1 89 GLN n 1 90 LEU n 1 91 PHE n 1 92 GLN n 1 93 ARG n 1 94 PHE n 1 95 ARG n 1 96 GLU n 1 97 ALA n 1 98 TRP n 1 99 ASP n 1 100 LYS n 1 101 GLY n 1 102 ASP n 1 103 LYS n 1 104 ASP n 1 105 SER n 1 106 LEU n 1 107 GLU n 1 108 GLN n 1 109 ILE n 1 110 LEU n 1 111 GLU n 1 112 GLU n 1 113 LEU n 1 114 GLU n 1 115 GLN n 1 116 VAL n 1 117 ALA n 1 118 GLN n 1 119 LYS n 1 120 ALA n 1 121 VAL n 1 122 GLU n 1 123 LEU n 1 124 GLY n 1 125 LEU n 1 126 LYS n 1 127 ILE n 1 128 LEU n 1 129 LYS n 1 130 THR n 1 131 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 131 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7JRQ _struct_ref.pdbx_db_accession 7JRQ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7JRQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7JRQ _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SMU non-polymer . '[5,15-diphenylporphyrinato(2-)-kappa~4~N~21~,N~22~,N~23~,N~24~]manganese' ? 'C32 H20 Mn N4 2' 515.466 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7JRQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH 7.5, 0.8 M NaH2PO4, 0.8 M KH2PO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength .99 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list .99 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 19.57 _reflns.entry_id 7JRQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 39.68 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18042 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half .977 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.8 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1510 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half .48 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 25.08 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7JRQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 39.68 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18042 _refine.ls_number_reflns_R_free 1796 _refine.ls_number_reflns_R_work 16246 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.21 _refine.ls_percent_reflns_R_free 9.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1981 _refine.ls_R_factor_R_free 0.2295 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1947 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5tgy _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.0354 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1883 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 39.68 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1172 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1054 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 81 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0076 ? 1203 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7246 ? 1641 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0361 ? 158 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0176 ? 214 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 22.4839 ? 176 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.75 1.80 . . 125 1144 94.63 . . . 0.3814 . 0.3259 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.80 1.85 . . 133 1191 98.29 . . . 0.2962 . 0.2834 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.85 1.91 . . 139 1239 99.28 . . . 0.3212 . 0.2607 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.91 1.98 . . 134 1214 99.34 . . . 0.2590 . 0.2361 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.98 2.06 . . 137 1242 99.49 . . . 0.2449 . 0.2290 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.06 2.15 . . 136 1228 99.93 . . . 0.2789 . 0.1967 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.15 2.26 . . 137 1237 99.49 . . . 0.2000 . 0.1755 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.26 2.41 . . 137 1243 99.86 . . . 0.2215 . 0.1718 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.41 2.59 . . 138 1247 99.93 . . . 0.2385 . 0.1727 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.59 2.85 . . 141 1269 100.00 . . . 0.2431 . 0.1856 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.85 3.26 . . 141 1284 99.65 . . . 0.2082 . 0.1834 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.27 4.11 . . 144 1305 100.00 . . . 0.1949 . 0.1680 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.12 39.68 . . 154 1403 99.62 . . . 0.2104 . 0.1930 . . . . . . . . . . . # _struct.entry_id 7JRQ _struct.title 'Crystallographically Characterized De Novo Designed Mn-Diphenylporphyrin Binding Protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7JRQ _struct_keywords.text 'metalloprotein, porphyrin, oxidation, sulfoxidation, high-talent, helical bundle, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 8 ? PHE A 11 ? ASN A 9 PHE A 12 5 ? 4 HELX_P HELX_P2 AA2 GLN A 12 ? GLY A 44 ? GLN A 13 GLY A 45 1 ? 33 HELX_P HELX_P3 AA3 ASP A 45 ? LYS A 73 ? ASP A 46 LYS A 74 1 ? 29 HELX_P HELX_P4 AA4 SER A 78 ? GLY A 101 ? SER A 79 GLY A 102 1 ? 24 HELX_P HELX_P5 AA5 ASP A 102 ? LYS A 129 ? ASP A 103 LYS A 130 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 57 OE1 ? ? ? 1_555 D SMU . MN1 ? ? A GLU 58 A SMU 203 1_555 ? ? ? ? ? ? ? 2.614 ? ? metalc2 metalc ? ? A HIS 63 NE2 ? ? ? 1_555 C SMU . MN1 ? ? A HIS 64 A SMU 202 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc3 metalc ? ? C SMU . MN1 ? ? ? 1_555 F HOH . O ? ? A SMU 202 A HOH 322 1_555 ? ? ? ? ? ? ? 2.618 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7JRQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022064 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022064 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006089 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 2 ? ? ? A . n A 1 2 HIS 2 3 ? ? ? A . n A 1 3 HIS 3 4 ? ? ? A . n A 1 4 HIS 4 5 ? ? ? A . n A 1 5 HIS 5 6 6 HIS HIS A . n A 1 6 HIS 6 7 7 HIS HIS A . n A 1 7 GLU 7 8 8 GLU GLU A . n A 1 8 ASN 8 9 9 ASN ASN A . n A 1 9 LEU 9 10 10 LEU LEU A . n A 1 10 TYR 10 11 11 TYR TYR A . n A 1 11 PHE 11 12 12 PHE PHE A . n A 1 12 GLN 12 13 13 GLN GLN A . n A 1 13 SER 13 14 14 SER SER A . n A 1 14 SER 14 15 15 SER SER A . n A 1 15 GLU 15 16 16 GLU GLU A . n A 1 16 LYS 16 17 17 LYS LYS A . n A 1 17 GLU 17 18 18 GLU GLU A . n A 1 18 GLU 18 19 19 GLU GLU A . n A 1 19 LEU 19 20 20 LEU LEU A . n A 1 20 PHE 20 21 21 PHE PHE A . n A 1 21 GLU 21 22 22 GLU GLU A . n A 1 22 LYS 22 23 23 LYS LYS A . n A 1 23 LEU 23 24 24 LEU LEU A . n A 1 24 LYS 24 25 25 LYS LYS A . n A 1 25 GLN 25 26 26 GLN GLN A . n A 1 26 THR 26 27 27 THR THR A . n A 1 27 ALA 27 28 28 ALA ALA A . n A 1 28 ASP 28 29 29 ASP ASP A . n A 1 29 GLU 29 30 30 GLU GLU A . n A 1 30 ALA 30 31 31 ALA ALA A . n A 1 31 VAL 31 32 32 VAL VAL A . n A 1 32 GLN 32 33 33 GLN GLN A . n A 1 33 LEU 33 34 34 LEU LEU A . n A 1 34 PHE 34 35 35 PHE PHE A . n A 1 35 GLN 35 36 36 GLN GLN A . n A 1 36 ARG 36 37 37 ARG ARG A . n A 1 37 LEU 37 38 38 LEU LEU A . n A 1 38 ARG 38 39 39 ARG ARG A . n A 1 39 GLU 39 40 40 GLU GLU A . n A 1 40 ILE 40 41 41 ILE ILE A . n A 1 41 PHE 41 42 42 PHE PHE A . n A 1 42 ASP 42 43 43 ASP ASP A . n A 1 43 LYS 43 44 44 LYS LYS A . n A 1 44 GLY 44 45 45 GLY GLY A . n A 1 45 ASP 45 46 46 ASP ASP A . n A 1 46 ASP 46 47 47 ASP ASP A . n A 1 47 ASP 47 48 48 ASP ASP A . n A 1 48 SER 48 49 49 SER SER A . n A 1 49 PHE 49 50 50 PHE PHE A . n A 1 50 GLU 50 51 51 GLU GLU A . n A 1 51 GLN 51 52 52 GLN GLN A . n A 1 52 VAL 52 53 53 VAL VAL A . n A 1 53 LEU 53 54 54 LEU LEU A . n A 1 54 GLU 54 55 55 GLU GLU A . n A 1 55 GLU 55 56 56 GLU GLU A . n A 1 56 LEU 56 57 57 LEU LEU A . n A 1 57 GLU 57 58 58 GLU GLU A . n A 1 58 GLU 58 59 59 GLU GLU A . n A 1 59 ALA 59 60 60 ALA ALA A . n A 1 60 LEU 60 61 61 LEU LEU A . n A 1 61 GLN 61 62 62 GLN GLN A . n A 1 62 LYS 62 63 63 LYS LYS A . n A 1 63 HIS 63 64 64 HIS HIS A . n A 1 64 ARG 64 65 65 ARG ARG A . n A 1 65 GLN 65 66 66 GLN GLN A . n A 1 66 LEU 66 67 67 LEU LEU A . n A 1 67 ALA 67 68 68 ALA ALA A . n A 1 68 ASP 68 69 69 ASP ASP A . n A 1 69 GLN 69 70 70 GLN GLN A . n A 1 70 GLY 70 71 71 GLY GLY A . n A 1 71 ARG 71 72 72 ARG ARG A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 LYS 73 74 74 LYS LYS A . n A 1 74 GLY 74 75 75 GLY GLY A . n A 1 75 LEU 75 76 76 LEU LEU A . n A 1 76 LEU 76 77 77 LEU LEU A . n A 1 77 THR 77 78 78 THR THR A . n A 1 78 SER 78 79 79 SER SER A . n A 1 79 GLU 79 80 80 GLU GLU A . n A 1 80 ALA 80 81 81 ALA ALA A . n A 1 81 ALA 81 82 82 ALA ALA A . n A 1 82 LYS 82 83 83 LYS LYS A . n A 1 83 GLN 83 84 84 GLN GLN A . n A 1 84 GLY 84 85 85 GLY GLY A . n A 1 85 ASP 85 86 86 ASP ASP A . n A 1 86 GLN 86 87 87 GLN GLN A . n A 1 87 PHE 87 88 88 PHE PHE A . n A 1 88 VAL 88 89 89 VAL VAL A . n A 1 89 GLN 89 90 90 GLN GLN A . n A 1 90 LEU 90 91 91 LEU LEU A . n A 1 91 PHE 91 92 92 PHE PHE A . n A 1 92 GLN 92 93 93 GLN GLN A . n A 1 93 ARG 93 94 94 ARG ARG A . n A 1 94 PHE 94 95 95 PHE PHE A . n A 1 95 ARG 95 96 96 ARG ARG A . n A 1 96 GLU 96 97 97 GLU GLU A . n A 1 97 ALA 97 98 98 ALA ALA A . n A 1 98 TRP 98 99 99 TRP TRP A . n A 1 99 ASP 99 100 100 ASP ASP A . n A 1 100 LYS 100 101 101 LYS LYS A . n A 1 101 GLY 101 102 102 GLY GLY A . n A 1 102 ASP 102 103 103 ASP ASP A . n A 1 103 LYS 103 104 104 LYS LYS A . n A 1 104 ASP 104 105 105 ASP ASP A . n A 1 105 SER 105 106 106 SER SER A . n A 1 106 LEU 106 107 107 LEU LEU A . n A 1 107 GLU 107 108 108 GLU GLU A . n A 1 108 GLN 108 109 109 GLN GLN A . n A 1 109 ILE 109 110 110 ILE ILE A . n A 1 110 LEU 110 111 111 LEU LEU A . n A 1 111 GLU 111 112 112 GLU GLU A . n A 1 112 GLU 112 113 113 GLU GLU A . n A 1 113 LEU 113 114 114 LEU LEU A . n A 1 114 GLU 114 115 115 GLU GLU A . n A 1 115 GLN 115 116 116 GLN GLN A . n A 1 116 VAL 116 117 117 VAL VAL A . n A 1 117 ALA 117 118 118 ALA ALA A . n A 1 118 GLN 118 119 119 GLN GLN A . n A 1 119 LYS 119 120 120 LYS LYS A . n A 1 120 ALA 120 121 121 ALA ALA A . n A 1 121 VAL 121 122 122 VAL VAL A . n A 1 122 GLU 122 123 123 GLU GLU A . n A 1 123 LEU 123 124 124 LEU LEU A . n A 1 124 GLY 124 125 125 GLY GLY A . n A 1 125 LEU 125 126 126 LEU LEU A . n A 1 126 LYS 126 127 127 LYS LYS A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 LEU 128 129 129 LEU LEU A . n A 1 129 LYS 129 130 130 LYS LYS A . n A 1 130 THR 130 131 131 THR THR A . n A 1 131 GLN 131 132 132 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 201 GOL GOL A . C 3 SMU 1 202 1 SMU SM0 A . D 3 SMU 1 203 2 SMU SM0 A . E 4 CL 1 204 1 CL CL A . F 5 HOH 1 301 74 HOH HOH A . F 5 HOH 2 302 28 HOH HOH A . F 5 HOH 3 303 51 HOH HOH A . F 5 HOH 4 304 5 HOH HOH A . F 5 HOH 5 305 11 HOH HOH A . F 5 HOH 6 306 25 HOH HOH A . F 5 HOH 7 307 78 HOH HOH A . F 5 HOH 8 308 71 HOH HOH A . F 5 HOH 9 309 77 HOH HOH A . F 5 HOH 10 310 30 HOH HOH A . F 5 HOH 11 311 3 HOH HOH A . F 5 HOH 12 312 17 HOH HOH A . F 5 HOH 13 313 6 HOH HOH A . F 5 HOH 14 314 8 HOH HOH A . F 5 HOH 15 315 12 HOH HOH A . F 5 HOH 16 316 23 HOH HOH A . F 5 HOH 17 317 7 HOH HOH A . F 5 HOH 18 318 56 HOH HOH A . F 5 HOH 19 319 9 HOH HOH A . F 5 HOH 20 320 26 HOH HOH A . F 5 HOH 21 321 10 HOH HOH A . F 5 HOH 22 322 1 HOH HOH A . F 5 HOH 23 323 61 HOH HOH A . F 5 HOH 24 324 33 HOH HOH A . F 5 HOH 25 325 24 HOH HOH A . F 5 HOH 26 326 2 HOH HOH A . F 5 HOH 27 327 20 HOH HOH A . F 5 HOH 28 328 15 HOH HOH A . F 5 HOH 29 329 21 HOH HOH A . F 5 HOH 30 330 69 HOH HOH A . F 5 HOH 31 331 75 HOH HOH A . F 5 HOH 32 332 83 HOH HOH A . F 5 HOH 33 333 60 HOH HOH A . F 5 HOH 34 334 80 HOH HOH A . F 5 HOH 35 335 45 HOH HOH A . F 5 HOH 36 336 19 HOH HOH A . F 5 HOH 37 337 73 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id SMU _pdbx_struct_special_symmetry.auth_seq_id 203 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id SMU _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 57 ? A GLU 58 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N3 ? D SMU . ? A SMU 203 ? 1_555 93.0 ? 2 OE1 ? A GLU 57 ? A GLU 58 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N4 ? D SMU . ? A SMU 203 ? 1_555 105.1 ? 3 N3 ? D SMU . ? A SMU 203 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N4 ? D SMU . ? A SMU 203 ? 1_555 84.2 ? 4 OE1 ? A GLU 57 ? A GLU 58 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N2 ? D SMU . ? A SMU 203 ? 1_555 82.0 ? 5 N3 ? D SMU . ? A SMU 203 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N2 ? D SMU . ? A SMU 203 ? 1_555 92.2 ? 6 N4 ? D SMU . ? A SMU 203 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N2 ? D SMU . ? A SMU 203 ? 1_555 172.2 ? 7 OE1 ? A GLU 57 ? A GLU 58 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N1 ? D SMU . ? A SMU 203 ? 1_555 98.6 ? 8 N3 ? D SMU . ? A SMU 203 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N1 ? D SMU . ? A SMU 203 ? 1_555 167.2 ? 9 N4 ? D SMU . ? A SMU 203 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N1 ? D SMU . ? A SMU 203 ? 1_555 87.5 ? 10 N2 ? D SMU . ? A SMU 203 ? 1_555 MN1 ? D SMU . ? A SMU 203 ? 1_555 N1 ? D SMU . ? A SMU 203 ? 1_555 94.7 ? 11 NE2 ? A HIS 63 ? A HIS 64 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N3 ? C SMU . ? A SMU 202 ? 1_555 94.4 ? 12 NE2 ? A HIS 63 ? A HIS 64 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N4 ? C SMU . ? A SMU 202 ? 1_555 94.8 ? 13 N3 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N4 ? C SMU . ? A SMU 202 ? 1_555 88.0 ? 14 NE2 ? A HIS 63 ? A HIS 64 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N2 ? C SMU . ? A SMU 202 ? 1_555 94.1 ? 15 N3 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N2 ? C SMU . ? A SMU 202 ? 1_555 92.7 ? 16 N4 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N2 ? C SMU . ? A SMU 202 ? 1_555 171.0 ? 17 NE2 ? A HIS 63 ? A HIS 64 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N1 ? C SMU . ? A SMU 202 ? 1_555 91.8 ? 18 N3 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N1 ? C SMU . ? A SMU 202 ? 1_555 173.2 ? 19 N4 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N1 ? C SMU . ? A SMU 202 ? 1_555 88.7 ? 20 N2 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 N1 ? C SMU . ? A SMU 202 ? 1_555 89.6 ? 21 NE2 ? A HIS 63 ? A HIS 64 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 O ? F HOH . ? A HOH 322 ? 1_555 176.7 ? 22 N3 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 O ? F HOH . ? A HOH 322 ? 1_555 87.2 ? 23 N4 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 O ? F HOH . ? A HOH 322 ? 1_555 88.2 ? 24 N2 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 O ? F HOH . ? A HOH 322 ? 1_555 82.9 ? 25 N1 ? C SMU . ? A SMU 202 ? 1_555 MN1 ? C SMU . ? A SMU 202 ? 1_555 O ? F HOH . ? A HOH 322 ? 1_555 86.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2021-01-20 3 'Structure model' 1 2 2021-01-27 4 'Structure model' 1 3 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 9 4 'Structure model' software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation.year' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_software.classification' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18_3861 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 # _pdbx_entry_details.entry_id 7JRQ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 N3 ? A SMU 202 ? PLANAR . 2 1 N4 ? A SMU 202 ? PLANAR . 3 1 N2 ? A SMU 203 ? PLANAR . 4 1 N3 ? A SMU 203 ? PLANAR . 5 1 N4 ? A SMU 203 ? PLANAR . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLU 19 ? CD ? A GLU 18 CD 2 1 Y 0 A GLU 30 ? CD ? A GLU 29 CD 3 1 Y 0 A LYS 63 ? CD ? A LYS 62 CD 4 1 Y 0 A GLU 112 ? CD ? A GLU 111 CD 5 1 Y 0 A GLU 112 ? OE1 ? A GLU 111 OE1 6 1 Y 0 A GLU 112 ? OE2 ? A GLU 111 OE2 7 1 Y 0 A GLU 113 ? CD ? A GLU 112 CD 8 1 Y 0 A GLN 116 ? CD ? A GLN 115 CD 9 1 Y 0 A GLN 116 ? OE1 ? A GLN 115 OE1 10 1 Y 0 A GLN 116 ? NE2 ? A GLN 115 NE2 11 1 Y 0 A LEU 129 ? CA A A LEU 128 CA 12 1 Y 0 A LEU 129 ? CB A A LEU 128 CB 13 1 Y 0 A LEU 129 ? CG A A LEU 128 CG 14 1 Y 0 A LEU 129 ? CD1 A A LEU 128 CD1 15 1 Y 0 A LEU 129 ? CD2 A A LEU 128 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 2 ? A HIS 1 2 1 Y 1 A HIS 3 ? A HIS 2 3 1 Y 1 A HIS 4 ? A HIS 3 4 1 Y 1 A HIS 5 ? A HIS 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 GOL C1 C N N 124 GOL O1 O N N 125 GOL C2 C N N 126 GOL O2 O N N 127 GOL C3 C N N 128 GOL O3 O N N 129 GOL H11 H N N 130 GOL H12 H N N 131 GOL HO1 H N N 132 GOL H2 H N N 133 GOL HO2 H N N 134 GOL H31 H N N 135 GOL H32 H N N 136 GOL HO3 H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 PHE N N N N 231 PHE CA C N S 232 PHE C C N N 233 PHE O O N N 234 PHE CB C N N 235 PHE CG C Y N 236 PHE CD1 C Y N 237 PHE CD2 C Y N 238 PHE CE1 C Y N 239 PHE CE2 C Y N 240 PHE CZ C Y N 241 PHE OXT O N N 242 PHE H H N N 243 PHE H2 H N N 244 PHE HA H N N 245 PHE HB2 H N N 246 PHE HB3 H N N 247 PHE HD1 H N N 248 PHE HD2 H N N 249 PHE HE1 H N N 250 PHE HE2 H N N 251 PHE HZ H N N 252 PHE HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 SMU C1 C Y N 268 SMU C10 C N N 269 SMU C11 C N N 270 SMU C12 C N N 271 SMU C13 C N N 272 SMU C14 C N N 273 SMU C15 C N N 274 SMU C16 C N N 275 SMU C17 C N N 276 SMU C18 C N N 277 SMU C19 C N N 278 SMU C2 C Y N 279 SMU C20 C N N 280 SMU C21 C Y N 281 SMU C22 C Y N 282 SMU C23 C Y N 283 SMU C24 C Y N 284 SMU C25 C Y N 285 SMU C26 C Y N 286 SMU C27 C Y N 287 SMU C28 C Y N 288 SMU C29 C Y N 289 SMU C3 C Y N 290 SMU C30 C Y N 291 SMU C31 C Y N 292 SMU C32 C Y N 293 SMU C4 C Y N 294 SMU C5 C N N 295 SMU C6 C N N 296 SMU C7 C N N 297 SMU C8 C N N 298 SMU C9 C N N 299 SMU N1 N Y N 300 SMU N2 N N R 301 SMU N3 N N R 302 SMU N4 N N S 303 SMU MN1 MN N S 304 SMU H1 H N N 305 SMU H2 H N N 306 SMU H3 H N N 307 SMU H4 H N N 308 SMU H5 H N N 309 SMU H6 H N N 310 SMU H7 H N N 311 SMU H8 H N N 312 SMU H9 H N N 313 SMU H10 H N N 314 SMU H11 H N N 315 SMU H12 H N N 316 SMU H13 H N N 317 SMU H14 H N N 318 SMU H15 H N N 319 SMU H16 H N N 320 SMU H17 H N N 321 SMU H18 H N N 322 SMU H19 H N N 323 SMU H20 H N N 324 THR N N N N 325 THR CA C N S 326 THR C C N N 327 THR O O N N 328 THR CB C N R 329 THR OG1 O N N 330 THR CG2 C N N 331 THR OXT O N N 332 THR H H N N 333 THR H2 H N N 334 THR HA H N N 335 THR HB H N N 336 THR HG1 H N N 337 THR HG21 H N N 338 THR HG22 H N N 339 THR HG23 H N N 340 THR HXT H N N 341 TRP N N N N 342 TRP CA C N S 343 TRP C C N N 344 TRP O O N N 345 TRP CB C N N 346 TRP CG C Y N 347 TRP CD1 C Y N 348 TRP CD2 C Y N 349 TRP NE1 N Y N 350 TRP CE2 C Y N 351 TRP CE3 C Y N 352 TRP CZ2 C Y N 353 TRP CZ3 C Y N 354 TRP CH2 C Y N 355 TRP OXT O N N 356 TRP H H N N 357 TRP H2 H N N 358 TRP HA H N N 359 TRP HB2 H N N 360 TRP HB3 H N N 361 TRP HD1 H N N 362 TRP HE1 H N N 363 TRP HE3 H N N 364 TRP HZ2 H N N 365 TRP HZ3 H N N 366 TRP HH2 H N N 367 TRP HXT H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 SMU C30 C29 doub Y N 254 SMU C30 C31 sing Y N 255 SMU C29 C28 sing Y N 256 SMU C31 C32 doub Y N 257 SMU C28 C27 doub Y N 258 SMU C32 C27 sing Y N 259 SMU C27 C15 sing N N 260 SMU C13 C12 doub N N 261 SMU C13 C14 sing N N 262 SMU C15 C14 doub N N 263 SMU C15 C16 sing N N 264 SMU C12 C11 sing N N 265 SMU C14 N3 sing N N 266 SMU C17 C16 sing N N 267 SMU C17 C18 doub N N 268 SMU C16 N4 doub N N 269 SMU C11 N3 sing N N 270 SMU C11 C10 doub N N 271 SMU N3 MN1 sing N N 272 SMU C18 C19 sing N N 273 SMU N4 C19 sing N N 274 SMU N4 MN1 sing N N 275 SMU C10 C9 sing N N 276 SMU C19 C20 doub N N 277 SMU MN1 N2 sing N N 278 SMU MN1 N1 sing N N 279 SMU C9 N2 doub N N 280 SMU C9 C8 sing N N 281 SMU C20 C1 sing N N 282 SMU N2 C6 sing N N 283 SMU C8 C7 doub N N 284 SMU N1 C1 sing Y N 285 SMU N1 C4 sing Y N 286 SMU C1 C2 doub Y N 287 SMU C6 C7 sing N N 288 SMU C6 C5 doub N N 289 SMU C4 C5 sing N N 290 SMU C4 C3 doub Y N 291 SMU C2 C3 sing Y N 292 SMU C5 C21 sing N N 293 SMU C21 C22 doub Y N 294 SMU C21 C26 sing Y N 295 SMU C22 C23 sing Y N 296 SMU C26 C25 doub Y N 297 SMU C23 C24 doub Y N 298 SMU C25 C24 sing Y N 299 SMU C10 H1 sing N N 300 SMU C12 H2 sing N N 301 SMU C13 H3 sing N N 302 SMU C17 H4 sing N N 303 SMU C18 H5 sing N N 304 SMU C2 H6 sing N N 305 SMU C20 H7 sing N N 306 SMU C22 H8 sing N N 307 SMU C23 H9 sing N N 308 SMU C24 H10 sing N N 309 SMU C25 H11 sing N N 310 SMU C26 H12 sing N N 311 SMU C28 H13 sing N N 312 SMU C29 H14 sing N N 313 SMU C3 H15 sing N N 314 SMU C30 H16 sing N N 315 SMU C31 H17 sing N N 316 SMU C32 H18 sing N N 317 SMU C7 H19 sing N N 318 SMU C8 H20 sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SMU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SMU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 '[5,15-diphenylporphyrinato(2-)-kappa~4~N~21~,N~22~,N~23~,N~24~]manganese' SMU 4 'CHLORIDE ION' CL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5TGY _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 #