data_7JTA # _entry.id 7JTA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7JTA pdb_00007jta 10.2210/pdb7jta/pdb WWPDB D_1000251301 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-22 2 'Structure model' 1 1 2022-04-06 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 13 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 14 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 15 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 16 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 17 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 18 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 19 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7JTA _pdbx_database_status.recvd_initial_deposition_date 2020-08-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Werther, R.' 1 0000-0002-3058-1550 'Forsberg, K.J.' 2 0000-0002-1545-8925 'Stoddard, B.L.' 3 0000-0001-6005-0016 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-7885 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first e3001428 _citation.page_last e3001428 _citation.title 'The novel anti-CRISPR AcrIIA22 relieves DNA torsion in target plasmids and impairs SpyCas9 activity.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pbio.3001428 _citation.pdbx_database_id_PubMed 34644300 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Forsberg, K.J.' 1 0000-0002-1545-8925 primary 'Schmidtke, D.T.' 2 0000-0001-9509-6188 primary 'Werther, R.' 3 0000-0002-3058-1550 primary 'Uribe, R.V.' 4 0000-0002-9800-0409 primary 'Hausman, D.' 5 0000-0003-0914-5022 primary 'Sommer, M.O.A.' 6 0000-0003-4005-5674 primary 'Stoddard, B.L.' 7 ? primary 'Kaiser, B.K.' 8 ? primary 'Malik, H.S.' 9 0000-0001-6005-0016 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NTF2-like nuclease/anti-CRISPR' 6394.332 2 ? ? ? ? 2 non-polymer syn 'NITRATE ION' 62.005 7 ? ? ? ? 3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 1 ? ? ? ? 4 water nat water 18.015 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSMGMVVEETRDLAETADCVVIEAILVDDGLRYRQLSVGIKDENGDIIRIVPISTVLI _entity_poly.pdbx_seq_one_letter_code_can GSSMGMVVEETRDLAETADCVVIEAILVDDGLRYRQLSVGIKDENGDIIRIVPISTVLI _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NITRATE ION' NO3 3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 MET n 1 5 GLY n 1 6 MET n 1 7 VAL n 1 8 VAL n 1 9 GLU n 1 10 GLU n 1 11 THR n 1 12 ARG n 1 13 ASP n 1 14 LEU n 1 15 ALA n 1 16 GLU n 1 17 THR n 1 18 ALA n 1 19 ASP n 1 20 CYS n 1 21 VAL n 1 22 VAL n 1 23 ILE n 1 24 GLU n 1 25 ALA n 1 26 ILE n 1 27 LEU n 1 28 VAL n 1 29 ASP n 1 30 ASP n 1 31 GLY n 1 32 LEU n 1 33 ARG n 1 34 TYR n 1 35 ARG n 1 36 GLN n 1 37 LEU n 1 38 SER n 1 39 VAL n 1 40 GLY n 1 41 ILE n 1 42 LYS n 1 43 ASP n 1 44 GLU n 1 45 ASN n 1 46 GLY n 1 47 ASP n 1 48 ILE n 1 49 ILE n 1 50 ARG n 1 51 ILE n 1 52 VAL n 1 53 PRO n 1 54 ILE n 1 55 SER n 1 56 THR n 1 57 VAL n 1 58 LEU n 1 59 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 59 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridia bacterium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2044939 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 NO3 non-polymer . 'NITRATE ION' ? 'N O3 -1' 62.005 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 SER 2 -3 ? ? ? A . n A 1 3 SER 3 -2 ? ? ? A . n A 1 4 MET 4 -1 -1 MET MET A . n A 1 5 GLY 5 0 0 GLY GLY A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 VAL 7 2 2 VAL VAL A . n A 1 8 VAL 8 3 3 VAL VAL A . n A 1 9 GLU 9 4 4 GLU GLU A . n A 1 10 GLU 10 5 5 GLU GLU A . n A 1 11 THR 11 6 6 THR THR A . n A 1 12 ARG 12 7 7 ARG ARG A . n A 1 13 ASP 13 8 8 ASP ASP A . n A 1 14 LEU 14 9 9 LEU LEU A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 GLU 16 11 11 GLU GLU A . n A 1 17 THR 17 12 12 THR THR A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 ASP 19 14 14 ASP ASP A . n A 1 20 CYS 20 15 15 CYS CYS A . n A 1 21 VAL 21 16 16 VAL VAL A . n A 1 22 VAL 22 17 17 VAL VAL A . n A 1 23 ILE 23 18 18 ILE ILE A . n A 1 24 GLU 24 19 19 GLU GLU A . n A 1 25 ALA 25 20 20 ALA ALA A . n A 1 26 ILE 26 21 21 ILE ILE A . n A 1 27 LEU 27 22 22 LEU LEU A . n A 1 28 VAL 28 23 23 VAL VAL A . n A 1 29 ASP 29 24 24 ASP ASP A . n A 1 30 ASP 30 25 25 ASP ASP A . n A 1 31 GLY 31 26 26 GLY GLY A . n A 1 32 LEU 32 27 27 LEU LEU A . n A 1 33 ARG 33 28 28 ARG ARG A . n A 1 34 TYR 34 29 29 TYR TYR A . n A 1 35 ARG 35 30 30 ARG ARG A . n A 1 36 GLN 36 31 31 GLN GLN A . n A 1 37 LEU 37 32 32 LEU LEU A . n A 1 38 SER 38 33 33 SER SER A . n A 1 39 VAL 39 34 34 VAL VAL A . n A 1 40 GLY 40 35 35 GLY GLY A . n A 1 41 ILE 41 36 36 ILE ILE A . n A 1 42 LYS 42 37 37 LYS LYS A . n A 1 43 ASP 43 38 38 ASP ASP A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 ASN 45 40 40 ASN ASN A . n A 1 46 GLY 46 41 41 GLY GLY A . n A 1 47 ASP 47 42 42 ASP ASP A . n A 1 48 ILE 48 43 43 ILE ILE A . n A 1 49 ILE 49 44 44 ILE ILE A . n A 1 50 ARG 50 45 45 ARG ARG A . n A 1 51 ILE 51 46 46 ILE ILE A . n A 1 52 VAL 52 47 47 VAL VAL A . n A 1 53 PRO 53 48 48 PRO PRO A . n A 1 54 ILE 54 49 49 ILE ILE A . n A 1 55 SER 55 50 50 SER SER A . n A 1 56 THR 56 51 51 THR THR A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 LEU 58 53 53 LEU LEU A . n A 1 59 ILE 59 54 54 ILE ILE A . n B 1 1 GLY 1 -4 ? ? ? B . n B 1 2 SER 2 -3 ? ? ? B . n B 1 3 SER 3 -2 ? ? ? B . n B 1 4 MET 4 -1 -1 MET MET B . n B 1 5 GLY 5 0 0 GLY GLY B . n B 1 6 MET 6 1 1 MET MET B . n B 1 7 VAL 7 2 2 VAL VAL B . n B 1 8 VAL 8 3 3 VAL VAL B . n B 1 9 GLU 9 4 4 GLU GLU B . n B 1 10 GLU 10 5 5 GLU GLU B . n B 1 11 THR 11 6 6 THR THR B . n B 1 12 ARG 12 7 7 ARG ARG B . n B 1 13 ASP 13 8 8 ASP ASP B . n B 1 14 LEU 14 9 9 LEU LEU B . n B 1 15 ALA 15 10 10 ALA ALA B . n B 1 16 GLU 16 11 11 GLU GLU B . n B 1 17 THR 17 12 12 THR THR B . n B 1 18 ALA 18 13 13 ALA ALA B . n B 1 19 ASP 19 14 14 ASP ASP B . n B 1 20 CYS 20 15 15 CYS CYS B . n B 1 21 VAL 21 16 16 VAL VAL B . n B 1 22 VAL 22 17 17 VAL VAL B . n B 1 23 ILE 23 18 18 ILE ILE B . n B 1 24 GLU 24 19 19 GLU GLU B . n B 1 25 ALA 25 20 20 ALA ALA B . n B 1 26 ILE 26 21 21 ILE ILE B . n B 1 27 LEU 27 22 22 LEU LEU B . n B 1 28 VAL 28 23 23 VAL VAL B . n B 1 29 ASP 29 24 24 ASP ASP B . n B 1 30 ASP 30 25 25 ASP ASP B . n B 1 31 GLY 31 26 26 GLY GLY B . n B 1 32 LEU 32 27 27 LEU LEU B . n B 1 33 ARG 33 28 28 ARG ARG B . n B 1 34 TYR 34 29 29 TYR TYR B . n B 1 35 ARG 35 30 30 ARG ARG B . n B 1 36 GLN 36 31 31 GLN GLN B . n B 1 37 LEU 37 32 32 LEU LEU B . n B 1 38 SER 38 33 33 SER SER B . n B 1 39 VAL 39 34 34 VAL VAL B . n B 1 40 GLY 40 35 35 GLY GLY B . n B 1 41 ILE 41 36 36 ILE ILE B . n B 1 42 LYS 42 37 37 LYS LYS B . n B 1 43 ASP 43 38 38 ASP ASP B . n B 1 44 GLU 44 39 39 GLU GLU B . n B 1 45 ASN 45 40 40 ASN ASN B . n B 1 46 GLY 46 41 41 GLY GLY B . n B 1 47 ASP 47 42 42 ASP ASP B . n B 1 48 ILE 48 43 43 ILE ILE B . n B 1 49 ILE 49 44 44 ILE ILE B . n B 1 50 ARG 50 45 45 ARG ARG B . n B 1 51 ILE 51 46 46 ILE ILE B . n B 1 52 VAL 52 47 47 VAL VAL B . n B 1 53 PRO 53 48 48 PRO PRO B . n B 1 54 ILE 54 49 49 ILE ILE B . n B 1 55 SER 55 50 50 SER SER B . n B 1 56 THR 56 51 51 THR THR B . n B 1 57 VAL 57 52 52 VAL VAL B . n B 1 58 LEU 58 53 53 LEU LEU B . n B 1 59 ILE 59 54 54 ILE ILE B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 NO3 1 101 1 NO3 NO3 A . D 2 NO3 1 102 2 NO3 NO3 A . E 2 NO3 1 103 4 NO3 NO3 A . F 2 NO3 1 104 5 NO3 NO3 A . G 2 NO3 1 105 6 NO3 NO3 A . H 2 NO3 1 101 3 NO3 NO3 B . I 2 NO3 1 102 7 NO3 NO3 B . J 3 MPD 1 103 1 MPD MPD B . K 4 HOH 1 201 2 HOH HOH A . K 4 HOH 2 202 3 HOH HOH A . L 4 HOH 1 201 1 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET -1 ? CG ? A MET 4 CG 2 1 Y 1 A MET -1 ? SD ? A MET 4 SD 3 1 Y 1 A MET -1 ? CE ? A MET 4 CE 4 1 Y 1 A ASP 25 ? CG ? A ASP 30 CG 5 1 Y 1 A ASP 25 ? OD1 ? A ASP 30 OD1 6 1 Y 1 A ASP 25 ? OD2 ? A ASP 30 OD2 7 1 Y 1 A GLU 39 ? CG ? A GLU 44 CG 8 1 Y 1 A GLU 39 ? CD ? A GLU 44 CD 9 1 Y 1 A GLU 39 ? OE1 ? A GLU 44 OE1 10 1 Y 1 A GLU 39 ? OE2 ? A GLU 44 OE2 11 1 Y 1 B MET -1 ? CG ? B MET 4 CG 12 1 Y 1 B MET -1 ? SD ? B MET 4 SD 13 1 Y 1 B MET -1 ? CE ? B MET 4 CE 14 1 Y 1 B ASP 14 ? CG ? B ASP 19 CG 15 1 Y 1 B ASP 14 ? OD1 ? B ASP 19 OD1 16 1 Y 1 B ASP 14 ? OD2 ? B ASP 19 OD2 17 1 Y 1 B ASP 25 ? CG ? B ASP 30 CG 18 1 Y 1 B ASP 25 ? OD1 ? B ASP 30 OD1 19 1 Y 1 B ASP 25 ? OD2 ? B ASP 30 OD2 20 1 Y 1 B LYS 37 ? CG ? B LYS 42 CG 21 1 Y 1 B LYS 37 ? CD ? B LYS 42 CD 22 1 Y 1 B LYS 37 ? CE ? B LYS 42 CE 23 1 Y 1 B LYS 37 ? NZ ? B LYS 42 NZ 24 1 Y 1 B GLU 39 ? CG ? B GLU 44 CG 25 1 Y 1 B GLU 39 ? CD ? B GLU 44 CD 26 1 Y 1 B GLU 39 ? OE1 ? B GLU 44 OE1 27 1 Y 1 B GLU 39 ? OE2 ? B GLU 44 OE2 28 1 Y 1 B ASN 40 ? CG ? B ASN 45 CG 29 1 Y 1 B ASN 40 ? OD1 ? B ASN 45 OD1 30 1 Y 1 B ASN 40 ? ND2 ? B ASN 45 ND2 31 1 Y 1 B ASP 42 ? CG ? B ASP 47 CG 32 1 Y 1 B ASP 42 ? OD1 ? B ASP 47 OD1 33 1 Y 1 B ASP 42 ? OD2 ? B ASP 47 OD2 34 1 Y 1 B ILE 43 ? CG1 ? B ILE 48 CG1 35 1 Y 1 B ILE 43 ? CG2 ? B ILE 48 CG2 36 1 Y 1 B ILE 43 ? CD1 ? B ILE 48 CD1 37 1 Y 1 B ILE 44 ? CG1 ? B ILE 49 CG1 38 1 Y 1 B ILE 44 ? CG2 ? B ILE 49 CG2 39 1 Y 1 B ILE 44 ? CD1 ? B ILE 49 CD1 40 1 Y 1 B ARG 45 ? CG ? B ARG 50 CG 41 1 Y 1 B ARG 45 ? CD ? B ARG 50 CD 42 1 Y 1 B ARG 45 ? NE ? B ARG 50 NE 43 1 Y 1 B ARG 45 ? CZ ? B ARG 50 CZ 44 1 Y 1 B ARG 45 ? NH1 ? B ARG 50 NH1 45 1 Y 1 B ARG 45 ? NH2 ? B ARG 50 NH2 46 1 Y 1 B ILE 46 ? CG1 ? B ILE 51 CG1 47 1 Y 1 B ILE 46 ? CG2 ? B ILE 51 CG2 48 1 Y 1 B ILE 46 ? CD1 ? B ILE 51 CD1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.1 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7JTA _cell.details ? _cell.formula_units_Z ? _cell.length_a 128.561 _cell.length_a_esd ? _cell.length_b 128.561 _cell.length_b_esd ? _cell.length_c 128.561 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 48 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7JTA _symmetry.cell_setting ? _symmetry.Int_Tables_number 212 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7JTA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '40% MPD, 0.2M ammonium nitrate, 10mM MgCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 108 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-08-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.02111 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.02111 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 82.820 _reflns.entry_id 7JTA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.800 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9344 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.400 _reflns.pdbx_Rmerge_I_obs 0.106 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.967 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.112 _reflns.pdbx_Rpim_I_all 0.034 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 96848 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.800 2.900 ? ? ? ? ? ? 920 100.000 ? ? ? ? 0.906 ? ? ? ? ? ? ? ? 10.700 ? 0.828 ? ? 0.953 0.289 ? 1 1 0.837 ? ? 2.900 3.020 ? ? ? ? ? ? 909 100.000 ? ? ? ? 0.651 ? ? ? ? ? ? ? ? 10.600 ? 0.861 ? ? 0.684 0.207 ? 2 1 0.921 ? ? 3.020 3.150 ? ? ? ? ? ? 930 100.000 ? ? ? ? 0.347 ? ? ? ? ? ? ? ? 10.600 ? 0.943 ? ? 0.364 0.111 ? 3 1 0.969 ? ? 3.150 3.320 ? ? ? ? ? ? 909 99.800 ? ? ? ? 0.226 ? ? ? ? ? ? ? ? 10.600 ? 0.945 ? ? 0.237 0.072 ? 4 1 0.984 ? ? 3.320 3.530 ? ? ? ? ? ? 922 99.800 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? 10.500 ? 1.037 ? ? 0.167 0.051 ? 5 1 0.990 ? ? 3.530 3.800 ? ? ? ? ? ? 938 99.600 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? 10.500 ? 0.988 ? ? 0.132 0.040 ? 6 1 0.994 ? ? 3.800 4.180 ? ? ? ? ? ? 933 99.400 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 10.400 ? 1.016 ? ? 0.116 0.035 ? 7 1 0.995 ? ? 4.180 4.790 ? ? ? ? ? ? 951 99.200 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 10.300 ? 0.982 ? ? 0.089 0.026 ? 8 1 0.996 ? ? 4.790 6.030 ? ? ? ? ? ? 945 98.100 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 10.200 ? 1.034 ? ? 0.091 0.027 ? 9 1 0.996 ? ? 6.030 50.000 ? ? ? ? ? ? 987 92.100 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 9.400 ? 1.045 ? ? 0.090 0.029 ? 10 1 0.995 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 179.440 _refine.B_iso_mean 83.5074 _refine.B_iso_min 41.870 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7JTA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8010 _refine.ls_d_res_low 42.8540 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9334 _refine.ls_number_reflns_R_free 933 _refine.ls_number_reflns_R_work 8401 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.9200 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2247 _refine.ls_R_factor_R_free 0.2463 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2222 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Robetta model' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.4800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8010 _refine_hist.d_res_low 42.8540 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 863 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 112 _refine_hist.pdbx_B_iso_mean_ligand 101.08 _refine_hist.pdbx_B_iso_mean_solvent 61.74 _refine_hist.pdbx_number_atoms_protein 810 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 50 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.003 ? ? 840 'X-RAY DIFFRACTION' ? f_angle_d 0.610 ? ? 1138 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 16.563 ? ? 501 'X-RAY DIFFRACTION' ? f_chiral_restr 0.052 ? ? 150 'X-RAY DIFFRACTION' ? f_plane_restr 0.002 ? ? 149 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 476 9.320 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 476 9.320 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8014 2.9491 . . 131 1178 100.0000 . . . 0.3031 0.0000 0.3065 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9491 3.1338 . . 132 1191 100.0000 . . . 0.3559 0.0000 0.2699 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1338 3.3757 . . 131 1172 100.0000 . . . 0.2710 0.0000 0.2446 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3757 3.7152 . . 131 1186 100.0000 . . . 0.2505 0.0000 0.2158 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7152 4.2524 . . 132 1197 99.0000 . . . 0.2664 0.0000 0.2108 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2524 5.3560 . . 137 1224 99.0000 . . . 0.2006 0.0000 0.1786 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.3560 42.8 . . 139 1253 95.0000 . . . 0.2451 0.0000 0.2477 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid -1 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 or (resid 42 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 54)) ; 1 2 'chain B' # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A MET 4 . A ALA 18 . A MET -1 A ALA 13 ? ;(chain A and (resid -1 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 or (resid 42 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 54)) ; 1 1 2 A ASP 19 . A ASP 19 . A ASP 14 A ASP 14 ? ;(chain A and (resid -1 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 or (resid 42 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 54)) ; 1 1 3 A MET 4 . A ILE 59 . A MET -1 A ILE 54 ? ;(chain A and (resid -1 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 or (resid 42 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 54)) ; 1 1 4 A MET 4 . A ILE 59 . A MET -1 A ILE 54 ? ;(chain A and (resid -1 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 or (resid 42 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 54)) ; 1 1 5 A MET 4 . A ILE 59 . A MET -1 A ILE 54 ? ;(chain A and (resid -1 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 or (resid 42 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 54)) ; 1 1 6 A MET 4 . A ILE 59 . A MET -1 A ILE 54 ? ;(chain A and (resid -1 through 13 or (resid 14 and (name N or name CA or name C or name O or name CB )) or resid 15 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 or (resid 42 through 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 54)) ; 1 2 1 B MET 4 . B ILE 59 . B MET -1 B ILE 54 ? 'chain B' # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7JTA _struct.title 'Crystal structure of a putative nuclease with anti-Cas9 activity from an uncultured Clostridia bacterium' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7JTA _struct_keywords.text 'Anti-CRISPR, nuclease, phage protein, Cas9, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 3 ? K N N 4 ? L N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5B9TEE9_9BACT _struct_ref.pdbx_db_accession A0A5B9TEE9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MVVEETRDLAETADCVVIEAILVDDGLRYRQLSVGIKDENGDIIRIVPISTVLI _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7JTA A 6 ? 59 ? A0A5B9TEE9 1 ? 54 ? 1 54 2 1 7JTA B 6 ? 59 ? A0A5B9TEE9 1 ? 54 ? 1 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7JTA GLY A 1 ? UNP A0A5B9TEE9 ? ? 'expression tag' -4 1 1 7JTA SER A 2 ? UNP A0A5B9TEE9 ? ? 'expression tag' -3 2 1 7JTA SER A 3 ? UNP A0A5B9TEE9 ? ? 'expression tag' -2 3 1 7JTA MET A 4 ? UNP A0A5B9TEE9 ? ? 'expression tag' -1 4 1 7JTA GLY A 5 ? UNP A0A5B9TEE9 ? ? 'expression tag' 0 5 2 7JTA GLY B 1 ? UNP A0A5B9TEE9 ? ? 'expression tag' -4 6 2 7JTA SER B 2 ? UNP A0A5B9TEE9 ? ? 'expression tag' -3 7 2 7JTA SER B 3 ? UNP A0A5B9TEE9 ? ? 'expression tag' -2 8 2 7JTA MET B 4 ? UNP A0A5B9TEE9 ? ? 'expression tag' -1 9 2 7JTA GLY B 5 ? UNP A0A5B9TEE9 ? ? 'expression tag' 0 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6170 ? 1 MORE -42 ? 1 'SSA (A^2)' 12030 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,4 A,C,D,E,F,G,K 1 2,3 B,H,I,J,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'elutes from gel filtration as hexamer, dimer shown in asu' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 15_445 y-1/4,-x-1/4,z+1/4 0.0000000000 1.0000000000 0.0000000000 -32.1402500000 -1.0000000000 0.0000000000 0.0000000000 -32.1402500000 0.0000000000 0.0000000000 1.0000000000 32.1402500000 4 'crystal symmetry operation' 22_445 z-1/4,-y-1/4,x+1/4 0.0000000000 0.0000000000 1.0000000000 -32.1402500000 0.0000000000 -1.0000000000 0.0000000000 -32.1402500000 1.0000000000 0.0000000000 0.0000000000 32.1402500000 # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 20 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 20 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 15 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 15 _struct_conn.ptnr2_symmetry 22_445 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.022 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 48 ? LEU A 58 ? ILE A 43 LEU A 53 AA1 2 LEU A 32 ? LYS A 42 ? LEU A 27 LYS A 37 AA1 3 CYS A 20 ? ASP A 29 ? CYS A 15 ASP A 24 AA1 4 VAL A 7 ? GLU A 16 ? VAL A 2 GLU A 11 AA1 5 MET B 6 ? GLU B 16 ? MET B 1 GLU B 11 AA1 6 CYS B 20 ? ASP B 29 ? CYS B 15 ASP B 24 AA1 7 LEU B 32 ? LYS B 42 ? LEU B 27 LYS B 37 AA1 8 ILE B 48 ? LEU B 58 ? ILE B 43 LEU B 53 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 49 ? O ILE A 44 N ILE A 41 ? N ILE A 36 AA1 2 3 O TYR A 34 ? O TYR A 29 N LEU A 27 ? N LEU A 22 AA1 3 4 O ILE A 26 ? O ILE A 21 N GLU A 9 ? N GLU A 4 AA1 4 5 N ASP A 13 ? N ASP A 8 O GLU B 9 ? O GLU B 4 AA1 5 6 N GLU B 9 ? N GLU B 4 O ILE B 26 ? O ILE B 21 AA1 6 7 N LEU B 27 ? N LEU B 22 O TYR B 34 ? O TYR B 29 AA1 7 8 N ILE B 41 ? N ILE B 36 O ILE B 49 ? O ILE B 44 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O3 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 NO3 _pdbx_validate_close_contact.auth_seq_id_1 104 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.91 # _pdbx_phasing_MR.entry_id 7JTA _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.320 _pdbx_phasing_MR.d_res_low_rotation 42.850 _pdbx_phasing_MR.d_res_high_translation 3.320 _pdbx_phasing_MR.d_res_low_translation 42.850 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 7JTA _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A SER -3 ? A SER 2 3 1 Y 1 A SER -2 ? A SER 3 4 1 Y 1 B GLY -4 ? B GLY 1 5 1 Y 1 B SER -3 ? B SER 2 6 1 Y 1 B SER -2 ? B SER 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MET N N N N 209 MET CA C N S 210 MET C C N N 211 MET O O N N 212 MET CB C N N 213 MET CG C N N 214 MET SD S N N 215 MET CE C N N 216 MET OXT O N N 217 MET H H N N 218 MET H2 H N N 219 MET HA H N N 220 MET HB2 H N N 221 MET HB3 H N N 222 MET HG2 H N N 223 MET HG3 H N N 224 MET HE1 H N N 225 MET HE2 H N N 226 MET HE3 H N N 227 MET HXT H N N 228 MPD C1 C N N 229 MPD C2 C N N 230 MPD O2 O N N 231 MPD CM C N N 232 MPD C3 C N N 233 MPD C4 C N S 234 MPD O4 O N N 235 MPD C5 C N N 236 MPD H11 H N N 237 MPD H12 H N N 238 MPD H13 H N N 239 MPD HO2 H N N 240 MPD HM1 H N N 241 MPD HM2 H N N 242 MPD HM3 H N N 243 MPD H31 H N N 244 MPD H32 H N N 245 MPD H4 H N N 246 MPD HO4 H N N 247 MPD H51 H N N 248 MPD H52 H N N 249 MPD H53 H N N 250 NO3 N N N N 251 NO3 O1 O N N 252 NO3 O2 O N N 253 NO3 O3 O N N 254 PRO N N N N 255 PRO CA C N S 256 PRO C C N N 257 PRO O O N N 258 PRO CB C N N 259 PRO CG C N N 260 PRO CD C N N 261 PRO OXT O N N 262 PRO H H N N 263 PRO HA H N N 264 PRO HB2 H N N 265 PRO HB3 H N N 266 PRO HG2 H N N 267 PRO HG3 H N N 268 PRO HD2 H N N 269 PRO HD3 H N N 270 PRO HXT H N N 271 SER N N N N 272 SER CA C N S 273 SER C C N N 274 SER O O N N 275 SER CB C N N 276 SER OG O N N 277 SER OXT O N N 278 SER H H N N 279 SER H2 H N N 280 SER HA H N N 281 SER HB2 H N N 282 SER HB3 H N N 283 SER HG H N N 284 SER HXT H N N 285 THR N N N N 286 THR CA C N S 287 THR C C N N 288 THR O O N N 289 THR CB C N R 290 THR OG1 O N N 291 THR CG2 C N N 292 THR OXT O N N 293 THR H H N N 294 THR H2 H N N 295 THR HA H N N 296 THR HB H N N 297 THR HG1 H N N 298 THR HG21 H N N 299 THR HG22 H N N 300 THR HG23 H N N 301 THR HXT H N N 302 TYR N N N N 303 TYR CA C N S 304 TYR C C N N 305 TYR O O N N 306 TYR CB C N N 307 TYR CG C Y N 308 TYR CD1 C Y N 309 TYR CD2 C Y N 310 TYR CE1 C Y N 311 TYR CE2 C Y N 312 TYR CZ C Y N 313 TYR OH O N N 314 TYR OXT O N N 315 TYR H H N N 316 TYR H2 H N N 317 TYR HA H N N 318 TYR HB2 H N N 319 TYR HB3 H N N 320 TYR HD1 H N N 321 TYR HD2 H N N 322 TYR HE1 H N N 323 TYR HE2 H N N 324 TYR HH H N N 325 TYR HXT H N N 326 VAL N N N N 327 VAL CA C N S 328 VAL C C N N 329 VAL O O N N 330 VAL CB C N N 331 VAL CG1 C N N 332 VAL CG2 C N N 333 VAL OXT O N N 334 VAL H H N N 335 VAL H2 H N N 336 VAL HA H N N 337 VAL HB H N N 338 VAL HG11 H N N 339 VAL HG12 H N N 340 VAL HG13 H N N 341 VAL HG21 H N N 342 VAL HG22 H N N 343 VAL HG23 H N N 344 VAL HXT H N N 345 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 MPD C1 C2 sing N N 216 MPD C1 H11 sing N N 217 MPD C1 H12 sing N N 218 MPD C1 H13 sing N N 219 MPD C2 O2 sing N N 220 MPD C2 CM sing N N 221 MPD C2 C3 sing N N 222 MPD O2 HO2 sing N N 223 MPD CM HM1 sing N N 224 MPD CM HM2 sing N N 225 MPD CM HM3 sing N N 226 MPD C3 C4 sing N N 227 MPD C3 H31 sing N N 228 MPD C3 H32 sing N N 229 MPD C4 O4 sing N N 230 MPD C4 C5 sing N N 231 MPD C4 H4 sing N N 232 MPD O4 HO4 sing N N 233 MPD C5 H51 sing N N 234 MPD C5 H52 sing N N 235 MPD C5 H53 sing N N 236 NO3 N O1 doub N N 237 NO3 N O2 sing N N 238 NO3 N O3 sing N N 239 PRO N CA sing N N 240 PRO N CD sing N N 241 PRO N H sing N N 242 PRO CA C sing N N 243 PRO CA CB sing N N 244 PRO CA HA sing N N 245 PRO C O doub N N 246 PRO C OXT sing N N 247 PRO CB CG sing N N 248 PRO CB HB2 sing N N 249 PRO CB HB3 sing N N 250 PRO CG CD sing N N 251 PRO CG HG2 sing N N 252 PRO CG HG3 sing N N 253 PRO CD HD2 sing N N 254 PRO CD HD3 sing N N 255 PRO OXT HXT sing N N 256 SER N CA sing N N 257 SER N H sing N N 258 SER N H2 sing N N 259 SER CA C sing N N 260 SER CA CB sing N N 261 SER CA HA sing N N 262 SER C O doub N N 263 SER C OXT sing N N 264 SER CB OG sing N N 265 SER CB HB2 sing N N 266 SER CB HB3 sing N N 267 SER OG HG sing N N 268 SER OXT HXT sing N N 269 THR N CA sing N N 270 THR N H sing N N 271 THR N H2 sing N N 272 THR CA C sing N N 273 THR CA CB sing N N 274 THR CA HA sing N N 275 THR C O doub N N 276 THR C OXT sing N N 277 THR CB OG1 sing N N 278 THR CB CG2 sing N N 279 THR CB HB sing N N 280 THR OG1 HG1 sing N N 281 THR CG2 HG21 sing N N 282 THR CG2 HG22 sing N N 283 THR CG2 HG23 sing N N 284 THR OXT HXT sing N N 285 TYR N CA sing N N 286 TYR N H sing N N 287 TYR N H2 sing N N 288 TYR CA C sing N N 289 TYR CA CB sing N N 290 TYR CA HA sing N N 291 TYR C O doub N N 292 TYR C OXT sing N N 293 TYR CB CG sing N N 294 TYR CB HB2 sing N N 295 TYR CB HB3 sing N N 296 TYR CG CD1 doub Y N 297 TYR CG CD2 sing Y N 298 TYR CD1 CE1 sing Y N 299 TYR CD1 HD1 sing N N 300 TYR CD2 CE2 doub Y N 301 TYR CD2 HD2 sing N N 302 TYR CE1 CZ doub Y N 303 TYR CE1 HE1 sing N N 304 TYR CE2 CZ sing Y N 305 TYR CE2 HE2 sing N N 306 TYR CZ OH sing N N 307 TYR OH HH sing N N 308 TYR OXT HXT sing N N 309 VAL N CA sing N N 310 VAL N H sing N N 311 VAL N H2 sing N N 312 VAL CA C sing N N 313 VAL CA CB sing N N 314 VAL CA HA sing N N 315 VAL C O doub N N 316 VAL C OXT sing N N 317 VAL CB CG1 sing N N 318 VAL CB CG2 sing N N 319 VAL CB HB sing N N 320 VAL CG1 HG11 sing N N 321 VAL CG1 HG12 sing N N 322 VAL CG1 HG13 sing N N 323 VAL CG2 HG21 sing N N 324 VAL CG2 HG22 sing N N 325 VAL CG2 HG23 sing N N 326 VAL OXT HXT sing N N 327 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01GM105691 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Robetta _pdbx_initial_refinement_model.details 'Robetta model' # _atom_sites.entry_id 7JTA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007778 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007778 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007778 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_