data_7K0W # _entry.id 7K0W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7K0W pdb_00007k0w 10.2210/pdb7k0w/pdb WWPDB D_1000251712 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7K0W _pdbx_database_status.recvd_initial_deposition_date 2020-09-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumar, G.' 1 0000-0001-7593-0737 'White, S.W.' 2 0000-0001-8188-5944 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the influenza virus PA endonuclease in complex with Baloxavir Acid' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, G.' 1 0000-0001-7593-0737 primary 'White, S.W.' 2 0000-0001-8188-5944 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7K0W _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.718 _cell.length_a_esd ? _cell.length_b 89.718 _cell.length_b_esd ? _cell.length_c 133.763 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7K0W _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 23148.344 1 3.1.-.- ? ? 'Loop 51-72 is replaced with a GGS linker' 2 non-polymer syn 'Baloxavir acid' 483.487 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 5 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEII EGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKA DYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEII EGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKA DYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLU n 1 23 ASP n 1 24 PHE n 1 25 VAL n 1 26 ARG n 1 27 GLN n 1 28 CYS n 1 29 PHE n 1 30 ASN n 1 31 PRO n 1 32 MET n 1 33 ILE n 1 34 VAL n 1 35 GLU n 1 36 LEU n 1 37 ALA n 1 38 GLU n 1 39 LYS n 1 40 ALA n 1 41 MET n 1 42 LYS n 1 43 GLU n 1 44 TYR n 1 45 GLY n 1 46 GLU n 1 47 ASP n 1 48 PRO n 1 49 LYS n 1 50 ILE n 1 51 GLU n 1 52 THR n 1 53 ASN n 1 54 LYS n 1 55 PHE n 1 56 ALA n 1 57 ALA n 1 58 ILE n 1 59 CYS n 1 60 THR n 1 61 HIS n 1 62 LEU n 1 63 GLU n 1 64 VAL n 1 65 CYS n 1 66 PHE n 1 67 MET n 1 68 TYR n 1 69 SER n 1 70 ASP n 1 71 GLY n 1 72 GLY n 1 73 SER n 1 74 LYS n 1 75 HIS n 1 76 ARG n 1 77 PHE n 1 78 GLU n 1 79 ILE n 1 80 ILE n 1 81 GLU n 1 82 GLY n 1 83 ARG n 1 84 ASP n 1 85 ARG n 1 86 ILE n 1 87 MET n 1 88 ALA n 1 89 TRP n 1 90 THR n 1 91 VAL n 1 92 VAL n 1 93 ASN n 1 94 SER n 1 95 ILE n 1 96 CYS n 1 97 ASN n 1 98 THR n 1 99 THR n 1 100 GLY n 1 101 VAL n 1 102 GLU n 1 103 LYS n 1 104 PRO n 1 105 LYS n 1 106 PHE n 1 107 LEU n 1 108 PRO n 1 109 ASP n 1 110 LEU n 1 111 TYR n 1 112 ASP n 1 113 TYR n 1 114 LYS n 1 115 GLU n 1 116 ASN n 1 117 ARG n 1 118 PHE n 1 119 ILE n 1 120 GLU n 1 121 ILE n 1 122 GLY n 1 123 VAL n 1 124 THR n 1 125 ARG n 1 126 ARG n 1 127 GLU n 1 128 VAL n 1 129 HIS n 1 130 ILE n 1 131 TYR n 1 132 TYR n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 ALA n 1 137 ASN n 1 138 LYS n 1 139 ILE n 1 140 LYS n 1 141 SER n 1 142 GLU n 1 143 LYS n 1 144 THR n 1 145 HIS n 1 146 ILE n 1 147 HIS n 1 148 ILE n 1 149 PHE n 1 150 SER n 1 151 PHE n 1 152 THR n 1 153 GLY n 1 154 GLU n 1 155 GLU n 1 156 MET n 1 157 ALA n 1 158 THR n 1 159 LYS n 1 160 ALA n 1 161 ASP n 1 162 TYR n 1 163 THR n 1 164 LEU n 1 165 ASP n 1 166 GLU n 1 167 GLU n 1 168 SER n 1 169 ARG n 1 170 ALA n 1 171 ARG n 1 172 ILE n 1 173 LYS n 1 174 THR n 1 175 ARG n 1 176 LEU n 1 177 PHE n 1 178 THR n 1 179 ILE n 1 180 ARG n 1 181 GLN n 1 182 GLU n 1 183 MET n 1 184 ALA n 1 185 SER n 1 186 ARG n 1 187 SER n 1 188 LEU n 1 189 TRP n 1 190 ASP n 1 191 SER n 1 192 PHE n 1 193 ARG n 1 194 GLN n 1 195 SER n 1 196 GLU n 1 197 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 197 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'swl A/California/04/2009 H1N1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Influenza A virus (strain swl A/California/04/2009 H1N1)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 641501 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET52b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3W5S0_I09A0 _struct_ref.pdbx_db_accession C3W5S0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIE GRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKAD YTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7K0W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 197 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3W5S0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7K0W MET A 1 ? UNP C3W5S0 ? ? 'initiating methionine' -19 1 1 7K0W GLY A 2 ? UNP C3W5S0 ? ? 'expression tag' -18 2 1 7K0W SER A 3 ? UNP C3W5S0 ? ? 'expression tag' -17 3 1 7K0W SER A 4 ? UNP C3W5S0 ? ? 'expression tag' -16 4 1 7K0W HIS A 5 ? UNP C3W5S0 ? ? 'expression tag' -15 5 1 7K0W HIS A 6 ? UNP C3W5S0 ? ? 'expression tag' -14 6 1 7K0W HIS A 7 ? UNP C3W5S0 ? ? 'expression tag' -13 7 1 7K0W HIS A 8 ? UNP C3W5S0 ? ? 'expression tag' -12 8 1 7K0W HIS A 9 ? UNP C3W5S0 ? ? 'expression tag' -11 9 1 7K0W HIS A 10 ? UNP C3W5S0 ? ? 'expression tag' -10 10 1 7K0W SER A 11 ? UNP C3W5S0 ? ? 'expression tag' -9 11 1 7K0W SER A 12 ? UNP C3W5S0 ? ? 'expression tag' -8 12 1 7K0W GLY A 13 ? UNP C3W5S0 ? ? 'expression tag' -7 13 1 7K0W LEU A 14 ? UNP C3W5S0 ? ? 'expression tag' -6 14 1 7K0W VAL A 15 ? UNP C3W5S0 ? ? 'expression tag' -5 15 1 7K0W PRO A 16 ? UNP C3W5S0 ? ? 'expression tag' -4 16 1 7K0W ARG A 17 ? UNP C3W5S0 ? ? 'expression tag' -3 17 1 7K0W GLY A 18 ? UNP C3W5S0 ? ? 'expression tag' -2 18 1 7K0W SER A 19 ? UNP C3W5S0 ? ? 'expression tag' -1 19 1 7K0W HIS A 20 ? UNP C3W5S0 ? ? 'expression tag' 0 20 1 7K0W ? A ? ? UNP C3W5S0 PHE 51 deletion ? 21 1 7K0W ? A ? ? UNP C3W5S0 HIS 52 deletion ? 22 1 7K0W ? A ? ? UNP C3W5S0 PHE 53 deletion ? 23 1 7K0W ? A ? ? UNP C3W5S0 ILE 54 deletion ? 24 1 7K0W ? A ? ? UNP C3W5S0 ASP 55 deletion ? 25 1 7K0W ? A ? ? UNP C3W5S0 GLU 56 deletion ? 26 1 7K0W ? A ? ? UNP C3W5S0 ARG 57 deletion ? 27 1 7K0W ? A ? ? UNP C3W5S0 GLY 58 deletion ? 28 1 7K0W ? A ? ? UNP C3W5S0 GLU 59 deletion ? 29 1 7K0W ? A ? ? UNP C3W5S0 SER 60 deletion ? 30 1 7K0W ? A ? ? UNP C3W5S0 ILE 61 deletion ? 31 1 7K0W ? A ? ? UNP C3W5S0 ILE 62 deletion ? 32 1 7K0W ? A ? ? UNP C3W5S0 VAL 63 deletion ? 33 1 7K0W ? A ? ? UNP C3W5S0 GLU 64 deletion ? 34 1 7K0W ? A ? ? UNP C3W5S0 SER 65 deletion ? 35 1 7K0W ? A ? ? UNP C3W5S0 GLY 66 deletion ? 36 1 7K0W ? A ? ? UNP C3W5S0 ASP 67 deletion ? 37 1 7K0W ? A ? ? UNP C3W5S0 PRO 68 deletion ? 38 1 7K0W ? A ? ? UNP C3W5S0 ASN 69 deletion ? 39 1 7K0W GLY A 71 ? UNP C3W5S0 ALA 70 linker 51 40 1 7K0W GLY A 72 ? UNP C3W5S0 LEU 71 linker 52 41 1 7K0W SER A 73 ? UNP C3W5S0 LEU 72 linker 53 42 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 E4Z non-polymer . 'Baloxavir acid' ? 'C24 H19 F2 N3 O4 S' 483.487 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7K0W _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES pH 7.8, 1.0M Ammonium Sulfate, 10mM MnCl2, 10mM MgCl2, 0.5% PVP K15' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-06-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7K0W _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.090 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15263 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.700 _reflns.pdbx_Rmerge_I_obs 0.090 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.903 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.096 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 132352 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.090 2.160 ? ? ? ? ? ? 920 57.700 ? ? ? ? 0.562 ? ? ? ? ? ? ? ? 4.600 ? 0.650 ? ? 0.619 0.251 ? 1 1 0.835 ? ? 2.160 2.250 ? ? ? ? ? ? 1232 75.500 ? ? ? ? 0.566 ? ? ? ? ? ? ? ? 5.500 ? 0.671 ? ? 0.616 0.234 ? 2 1 0.871 ? ? 2.250 2.350 ? ? ? ? ? ? 1471 91.100 ? ? ? ? 0.593 ? ? ? ? ? ? ? ? 6.800 ? 0.701 ? ? 0.638 0.229 ? 3 1 0.865 ? ? 2.350 2.480 ? ? ? ? ? ? 1609 98.900 ? ? ? ? 0.498 ? ? ? ? ? ? ? ? 8.700 ? 0.703 ? ? 0.530 0.176 ? 4 1 0.946 ? ? 2.480 2.630 ? ? ? ? ? ? 1640 99.900 ? ? ? ? 0.388 ? ? ? ? ? ? ? ? 9.800 ? 0.760 ? ? 0.409 0.129 ? 5 1 0.968 ? ? 2.630 2.840 ? ? ? ? ? ? 1625 99.900 ? ? ? ? 0.285 ? ? ? ? ? ? ? ? 10.000 ? 0.836 ? ? 0.301 0.094 ? 6 1 0.980 ? ? 2.840 3.120 ? ? ? ? ? ? 1633 99.900 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? 9.900 ? 0.932 ? ? 0.167 0.053 ? 7 1 0.993 ? ? 3.120 3.570 ? ? ? ? ? ? 1669 100.000 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 9.900 ? 1.033 ? ? 0.090 0.028 ? 8 1 0.997 ? ? 3.570 4.500 ? ? ? ? ? ? 1677 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 9.700 ? 1.077 ? ? 0.062 0.020 ? 9 1 0.998 ? ? 4.500 50.000 ? ? ? ? ? ? 1787 99.900 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 8.900 ? 1.219 ? ? 0.059 0.020 ? 10 1 0.998 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 120.160 _refine.B_iso_mean 50.5359 _refine.B_iso_min 26.600 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7K0W _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0900 _refine.ls_d_res_low 44.8600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15255 _refine.ls_number_reflns_R_free 806 _refine.ls_number_reflns_R_work 14449 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.4500 _refine.ls_percent_reflns_R_free 5.2800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2180 _refine.ls_R_factor_R_free 0.2485 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2163 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5DES _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.6200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0900 _refine_hist.d_res_low 44.8600 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 1530 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 179 _refine_hist.pdbx_B_iso_mean_ligand 51.37 _refine_hist.pdbx_B_iso_mean_solvent 45.04 _refine_hist.pdbx_number_atoms_protein 1462 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0900 2.2200 1709 . 89 1620 64.0000 . . . 0.3780 0.0000 0.2976 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.2200 2.3900 2439 . 124 2315 90.0000 . . . 0.3618 0.0000 0.2862 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.4000 2.6400 2723 . 126 2597 100.0000 . . . 0.3463 0.0000 0.2753 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.6400 3.0200 2713 . 148 2565 100.0000 . . . 0.3406 0.0000 0.2596 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.0200 3.8000 2759 . 146 2613 100.0000 . . . 0.2310 0.0000 0.2100 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.8000 44.8600 2912 . 173 2739 100.0000 . . . 0.1980 0.0000 0.1806 . . . . . . . 6 . . . # _struct.entry_id 7K0W _struct.title ;The crystal structure of the 2009/H1N1/California PA endonuclease (construct with truncated loop 51-72) in complex with Baloxavir acid ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7K0W _struct_keywords.text 'hydrolase, virus, nuclease, cap-snatching, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 19 ? PHE A 29 ? SER A -1 PHE A 9 1 ? 11 HELX_P HELX_P2 AA2 ASN A 30 ? TYR A 44 ? ASN A 10 TYR A 24 1 ? 15 HELX_P HELX_P3 AA3 GLU A 51 ? ASP A 70 ? GLU A 31 ASP A 50 1 ? 20 HELX_P HELX_P4 AA4 ASP A 84 ? GLY A 100 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 127 ? LYS A 140 ? GLU A 126 LYS A 139 1 ? 14 HELX_P HELX_P6 AA6 LYS A 159 ? ASP A 161 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 165 ? ARG A 186 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 188 ? GLN A 194 ? LEU A 187 GLN A 193 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 61 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 41 A MN 202 1_555 ? ? ? ? ? ? ? 2.195 ? ? metalc2 metalc ? ? A GLU 81 OE1 ? ? ? 1_555 D MN . MN ? ? A GLU 80 A MN 203 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc3 metalc ? ? A ASP 109 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 202 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc4 metalc ? ? A ASP 109 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 108 A MN 203 1_555 ? ? ? ? ? ? ? 2.181 ? ? metalc5 metalc ? ? A GLU 120 OE1 ? ? ? 1_555 C MN . MN ? ? A GLU 119 A MN 202 1_555 ? ? ? ? ? ? ? 2.125 ? ? metalc6 metalc ? ? A ILE 121 O ? ? ? 1_555 C MN . MN ? ? A ILE 120 A MN 202 1_555 ? ? ? ? ? ? ? 2.192 ? ? metalc7 metalc ? ? B E4Z . O1 ? ? ? 1_555 C MN . MN ? ? A E4Z 201 A MN 202 1_555 ? ? ? ? ? ? ? 2.022 ? ? metalc8 metalc ? ? B E4Z . O2 ? ? ? 1_555 C MN . MN ? ? A E4Z 201 A MN 202 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc9 metalc ? ? B E4Z . O2 ? ? ? 1_555 D MN . MN ? ? A E4Z 201 A MN 203 1_555 ? ? ? ? ? ? ? 2.081 ? ? metalc10 metalc ? ? B E4Z . O3 ? ? ? 1_555 D MN . MN ? ? A E4Z 201 A MN 203 1_555 ? ? ? ? ? ? ? 1.910 ? ? metalc11 metalc ? ? D MN . MN ? ? ? 1_555 G HOH . O ? ? A MN 203 A HOH 301 1_555 ? ? ? ? ? ? ? 2.412 ? ? metalc12 metalc ? ? D MN . MN ? ? ? 1_555 G HOH . O ? ? A MN 203 A HOH 302 1_555 ? ? ? ? ? ? ? 2.264 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 77 ? ILE A 79 ? PHE A 76 ILE A 78 AA1 2 LEU A 110 ? ASP A 112 ? LEU A 109 ASP A 111 AA1 3 ARG A 117 ? THR A 124 ? ARG A 116 THR A 123 AA1 4 HIS A 145 ? SER A 150 ? HIS A 144 SER A 149 AA1 5 GLU A 155 ? ALA A 157 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 78 ? N GLU A 77 O TYR A 111 ? O TYR A 110 AA1 2 3 N ASP A 112 ? N ASP A 111 O ARG A 117 ? O ARG A 116 AA1 3 4 N GLY A 122 ? N GLY A 121 O PHE A 149 ? O PHE A 148 AA1 4 5 N ILE A 148 ? N ILE A 147 O MET A 156 ? O MET A 155 # _atom_sites.entry_id 7K0W _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011146 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011146 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007476 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 -2 GLY GLY A . n A 1 19 SER 19 -1 -1 SER SER A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 GLU 22 2 2 GLU GLU A . n A 1 23 ASP 23 3 3 ASP ASP A . n A 1 24 PHE 24 4 4 PHE PHE A . n A 1 25 VAL 25 5 5 VAL VAL A . n A 1 26 ARG 26 6 6 ARG ARG A . n A 1 27 GLN 27 7 7 GLN GLN A . n A 1 28 CYS 28 8 8 CYS CYS A . n A 1 29 PHE 29 9 9 PHE PHE A . n A 1 30 ASN 30 10 10 ASN ASN A . n A 1 31 PRO 31 11 11 PRO PRO A . n A 1 32 MET 32 12 12 MET MET A . n A 1 33 ILE 33 13 13 ILE ILE A . n A 1 34 VAL 34 14 14 VAL VAL A . n A 1 35 GLU 35 15 15 GLU GLU A . n A 1 36 LEU 36 16 16 LEU LEU A . n A 1 37 ALA 37 17 17 ALA ALA A . n A 1 38 GLU 38 18 18 GLU GLU A . n A 1 39 LYS 39 19 19 LYS LYS A . n A 1 40 ALA 40 20 20 ALA ALA A . n A 1 41 MET 41 21 21 MET MET A . n A 1 42 LYS 42 22 22 LYS LYS A . n A 1 43 GLU 43 23 23 GLU GLU A . n A 1 44 TYR 44 24 24 TYR TYR A . n A 1 45 GLY 45 25 25 GLY GLY A . n A 1 46 GLU 46 26 26 GLU GLU A . n A 1 47 ASP 47 27 27 ASP ASP A . n A 1 48 PRO 48 28 28 PRO PRO A . n A 1 49 LYS 49 29 29 LYS LYS A . n A 1 50 ILE 50 30 30 ILE ILE A . n A 1 51 GLU 51 31 31 GLU GLU A . n A 1 52 THR 52 32 32 THR THR A . n A 1 53 ASN 53 33 33 ASN ASN A . n A 1 54 LYS 54 34 34 LYS LYS A . n A 1 55 PHE 55 35 35 PHE PHE A . n A 1 56 ALA 56 36 36 ALA ALA A . n A 1 57 ALA 57 37 37 ALA ALA A . n A 1 58 ILE 58 38 38 ILE ILE A . n A 1 59 CYS 59 39 39 CYS CYS A . n A 1 60 THR 60 40 40 THR THR A . n A 1 61 HIS 61 41 41 HIS HIS A . n A 1 62 LEU 62 42 42 LEU LEU A . n A 1 63 GLU 63 43 43 GLU GLU A . n A 1 64 VAL 64 44 44 VAL VAL A . n A 1 65 CYS 65 45 45 CYS CYS A . n A 1 66 PHE 66 46 46 PHE PHE A . n A 1 67 MET 67 47 47 MET MET A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 SER 69 49 49 SER SER A . n A 1 70 ASP 70 50 50 ASP ASP A . n A 1 71 GLY 71 51 51 GLY GLY A . n A 1 72 GLY 72 52 52 GLY GLY A . n A 1 73 SER 73 53 53 SER SER A . n A 1 74 LYS 74 73 73 LYS LYS A . n A 1 75 HIS 75 74 74 HIS HIS A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 PHE 77 76 76 PHE PHE A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 ILE 79 78 78 ILE ILE A . n A 1 80 ILE 80 79 79 ILE ILE A . n A 1 81 GLU 81 80 80 GLU GLU A . n A 1 82 GLY 82 81 81 GLY GLY A . n A 1 83 ARG 83 82 82 ARG ARG A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 ARG 85 84 84 ARG ARG A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 MET 87 86 86 MET MET A . n A 1 88 ALA 88 87 87 ALA ALA A . n A 1 89 TRP 89 88 88 TRP TRP A . n A 1 90 THR 90 89 89 THR THR A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 ASN 93 92 92 ASN ASN A . n A 1 94 SER 94 93 93 SER SER A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 CYS 96 95 95 CYS CYS A . n A 1 97 ASN 97 96 96 ASN ASN A . n A 1 98 THR 98 97 97 THR THR A . n A 1 99 THR 99 98 98 THR THR A . n A 1 100 GLY 100 99 99 GLY GLY A . n A 1 101 VAL 101 100 100 VAL VAL A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 PRO 104 103 103 PRO PRO A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 PHE 106 105 105 PHE PHE A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 PRO 108 107 107 PRO PRO A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 LEU 110 109 109 LEU LEU A . n A 1 111 TYR 111 110 110 TYR TYR A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 TYR 113 112 112 TYR TYR A . n A 1 114 LYS 114 113 113 LYS LYS A . n A 1 115 GLU 115 114 114 GLU GLU A . n A 1 116 ASN 116 115 115 ASN ASN A . n A 1 117 ARG 117 116 116 ARG ARG A . n A 1 118 PHE 118 117 117 PHE PHE A . n A 1 119 ILE 119 118 118 ILE ILE A . n A 1 120 GLU 120 119 119 GLU GLU A . n A 1 121 ILE 121 120 120 ILE ILE A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 THR 124 123 123 THR THR A . n A 1 125 ARG 125 124 124 ARG ARG A . n A 1 126 ARG 126 125 125 ARG ARG A . n A 1 127 GLU 127 126 126 GLU GLU A . n A 1 128 VAL 128 127 127 VAL VAL A . n A 1 129 HIS 129 128 128 HIS HIS A . n A 1 130 ILE 130 129 129 ILE ILE A . n A 1 131 TYR 131 130 130 TYR TYR A . n A 1 132 TYR 132 131 131 TYR TYR A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 GLU 134 133 133 GLU GLU A . n A 1 135 LYS 135 134 134 LYS LYS A . n A 1 136 ALA 136 135 135 ALA ALA A . n A 1 137 ASN 137 136 136 ASN ASN A . n A 1 138 LYS 138 137 137 LYS LYS A . n A 1 139 ILE 139 138 138 ILE ILE A . n A 1 140 LYS 140 139 139 LYS LYS A . n A 1 141 SER 141 140 140 SER SER A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 LYS 143 142 142 LYS LYS A . n A 1 144 THR 144 143 143 THR THR A . n A 1 145 HIS 145 144 144 HIS HIS A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 HIS 147 146 146 HIS HIS A . n A 1 148 ILE 148 147 147 ILE ILE A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 SER 150 149 149 SER SER A . n A 1 151 PHE 151 150 150 PHE PHE A . n A 1 152 THR 152 151 151 THR THR A . n A 1 153 GLY 153 152 152 GLY GLY A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 GLU 155 154 154 GLU GLU A . n A 1 156 MET 156 155 155 MET MET A . n A 1 157 ALA 157 156 156 ALA ALA A . n A 1 158 THR 158 157 157 THR THR A . n A 1 159 LYS 159 158 158 LYS LYS A . n A 1 160 ALA 160 159 159 ALA ALA A . n A 1 161 ASP 161 160 160 ASP ASP A . n A 1 162 TYR 162 161 161 TYR TYR A . n A 1 163 THR 163 162 162 THR THR A . n A 1 164 LEU 164 163 163 LEU LEU A . n A 1 165 ASP 165 164 164 ASP ASP A . n A 1 166 GLU 166 165 165 GLU GLU A . n A 1 167 GLU 167 166 166 GLU GLU A . n A 1 168 SER 168 167 167 SER SER A . n A 1 169 ARG 169 168 168 ARG ARG A . n A 1 170 ALA 170 169 169 ALA ALA A . n A 1 171 ARG 171 170 170 ARG ARG A . n A 1 172 ILE 172 171 171 ILE ILE A . n A 1 173 LYS 173 172 172 LYS LYS A . n A 1 174 THR 174 173 173 THR THR A . n A 1 175 ARG 175 174 174 ARG ARG A . n A 1 176 LEU 176 175 175 LEU LEU A . n A 1 177 PHE 177 176 176 PHE PHE A . n A 1 178 THR 178 177 177 THR THR A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 GLN 181 180 180 GLN GLN A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 MET 183 182 182 MET MET A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 SER 185 184 184 SER SER A . n A 1 186 ARG 186 185 185 ARG ARG A . n A 1 187 SER 187 186 186 SER SER A . n A 1 188 LEU 188 187 187 LEU LEU A . n A 1 189 TRP 189 188 188 TRP TRP A . n A 1 190 ASP 190 189 189 ASP ASP A . n A 1 191 SER 191 190 190 SER SER A . n A 1 192 PHE 192 191 191 PHE PHE A . n A 1 193 ARG 193 192 192 ARG ARG A . n A 1 194 GLN 194 193 193 GLN GLN A . n A 1 195 SER 195 194 194 SER SER A . n A 1 196 GLU 196 195 195 GLU GLU A . n A 1 197 ARG 197 196 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 E4Z 1 201 201 E4Z E4Z A . C 3 MN 1 202 301 MN MN A . D 3 MN 1 203 302 MN MN A . E 4 SO4 1 204 1 SO4 SO4 A . F 4 SO4 1 205 2 SO4 SO4 A . G 5 HOH 1 301 2 HOH HOH A . G 5 HOH 2 302 1 HOH HOH A . G 5 HOH 3 303 12 HOH HOH A . G 5 HOH 4 304 5 HOH HOH A . G 5 HOH 5 305 22 HOH HOH A . G 5 HOH 6 306 6 HOH HOH A . G 5 HOH 7 307 11 HOH HOH A . G 5 HOH 8 308 7 HOH HOH A . G 5 HOH 9 309 19 HOH HOH A . G 5 HOH 10 310 20 HOH HOH A . G 5 HOH 11 311 16 HOH HOH A . G 5 HOH 12 312 21 HOH HOH A . G 5 HOH 13 313 18 HOH HOH A . G 5 HOH 14 314 24 HOH HOH A . G 5 HOH 15 315 9 HOH HOH A . G 5 HOH 16 316 8 HOH HOH A . G 5 HOH 17 317 3 HOH HOH A . G 5 HOH 18 318 4 HOH HOH A . G 5 HOH 19 319 15 HOH HOH A . G 5 HOH 20 320 25 HOH HOH A . G 5 HOH 21 321 10 HOH HOH A . G 5 HOH 22 322 23 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 97.4 ? 2 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OE1 ? A GLU 120 ? A GLU 119 ? 1_555 171.5 ? 3 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OE1 ? A GLU 120 ? A GLU 119 ? 1_555 84.9 ? 4 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 77.9 ? 5 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 92.0 ? 6 OE1 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 93.9 ? 7 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O1 ? B E4Z . ? A E4Z 201 ? 1_555 96.7 ? 8 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O1 ? B E4Z . ? A E4Z 201 ? 1_555 165.7 ? 9 OE1 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O1 ? B E4Z . ? A E4Z 201 ? 1_555 81.5 ? 10 O ? A ILE 121 ? A ILE 120 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O1 ? B E4Z . ? A E4Z 201 ? 1_555 93.0 ? 11 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O2 ? B E4Z . ? A E4Z 201 ? 1_555 106.7 ? 12 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O2 ? B E4Z . ? A E4Z 201 ? 1_555 96.0 ? 13 OE1 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O2 ? B E4Z . ? A E4Z 201 ? 1_555 81.0 ? 14 O ? A ILE 121 ? A ILE 120 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O2 ? B E4Z . ? A E4Z 201 ? 1_555 170.0 ? 15 O1 ? B E4Z . ? A E4Z 201 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O2 ? B E4Z . ? A E4Z 201 ? 1_555 77.8 ? 16 OE1 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 83.2 ? 17 OE1 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O2 ? B E4Z . ? A E4Z 201 ? 1_555 125.0 ? 18 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O2 ? B E4Z . ? A E4Z 201 ? 1_555 92.4 ? 19 OE1 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O3 ? B E4Z . ? A E4Z 201 ? 1_555 97.5 ? 20 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O3 ? B E4Z . ? A E4Z 201 ? 1_555 171.5 ? 21 O2 ? B E4Z . ? A E4Z 201 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O3 ? B E4Z . ? A E4Z 201 ? 1_555 80.3 ? 22 OE1 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 301 ? 1_555 159.5 ? 23 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 301 ? 1_555 88.0 ? 24 O2 ? B E4Z . ? A E4Z 201 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 301 ? 1_555 73.7 ? 25 O3 ? B E4Z . ? A E4Z 201 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 301 ? 1_555 94.0 ? 26 OE1 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 84.8 ? 27 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 90.8 ? 28 O2 ? B E4Z . ? A E4Z 201 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 150.2 ? 29 O3 ? B E4Z . ? A E4Z 201 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 97.7 ? 30 O ? G HOH . ? A HOH 301 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? G HOH . ? A HOH 302 ? 1_555 76.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-16 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7K0W _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 125 ? ? -95.05 -155.93 2 1 LYS A 139 ? ? 50.55 18.87 3 1 THR A 162 ? ? 61.05 -59.60 4 1 GLN A 193 ? ? -75.95 39.30 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 101 ? CG ? A GLU 102 CG 2 1 Y 1 A GLU 101 ? CD ? A GLU 102 CD 3 1 Y 1 A GLU 101 ? OE1 ? A GLU 102 OE1 4 1 Y 1 A GLU 101 ? OE2 ? A GLU 102 OE2 5 1 Y 1 A LYS 139 ? CG ? A LYS 140 CG 6 1 Y 1 A LYS 139 ? CD ? A LYS 140 CD 7 1 Y 1 A LYS 139 ? CE ? A LYS 140 CE 8 1 Y 1 A LYS 139 ? NZ ? A LYS 140 NZ 9 1 Y 1 A GLU 141 ? CG ? A GLU 142 CG 10 1 Y 1 A GLU 141 ? CD ? A GLU 142 CD 11 1 Y 1 A GLU 141 ? OE1 ? A GLU 142 OE1 12 1 Y 1 A GLU 141 ? OE2 ? A GLU 142 OE2 13 1 Y 1 A LYS 142 ? CG ? A LYS 143 CG 14 1 Y 1 A LYS 142 ? CD ? A LYS 143 CD 15 1 Y 1 A LYS 142 ? CE ? A LYS 143 CE 16 1 Y 1 A LYS 142 ? NZ ? A LYS 143 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A ARG 196 ? A ARG 197 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 E4Z C1 C N N 88 E4Z N1 N N N 89 E4Z O1 O N N 90 E4Z C2 C N N 91 E4Z O2 O N N 92 E4Z O3 O N N 93 E4Z C4 C N N 94 E4Z O4 O N N 95 E4Z C5 C N N 96 E4Z C6 C N N 97 E4Z C7 C N R 98 E4Z C13 C Y N 99 E4Z C14 C N N 100 E4Z C15 C Y N 101 E4Z C16 C Y N 102 E4Z C17 C Y N 103 E4Z C18 C Y N 104 E4Z C19 C Y N 105 E4Z C20 C Y N 106 E4Z C21 C Y N 107 E4Z C22 C Y N 108 E4Z C23 C Y N 109 E4Z C24 C Y N 110 E4Z F2 F N N 111 E4Z C12 C Y N 112 E4Z F1 F N N 113 E4Z S3 S N N 114 E4Z C11 C N S 115 E4Z N2 N N N 116 E4Z C8 C N N 117 E4Z C9 C N N 118 E4Z C10 C N N 119 E4Z N3 N N N 120 E4Z C3 C N N 121 E4Z H1 H N N 122 E4Z H3 H N N 123 E4Z H4 H N N 124 E4Z H5 H N N 125 E4Z H6 H N N 126 E4Z H7 H N N 127 E4Z H8 H N N 128 E4Z H9 H N N 129 E4Z H10 H N N 130 E4Z H11 H N N 131 E4Z H12 H N N 132 E4Z H13 H N N 133 E4Z H14 H N N 134 E4Z H15 H N N 135 E4Z H16 H N N 136 E4Z H17 H N N 137 E4Z H18 H N N 138 E4Z H19 H N N 139 E4Z H20 H N N 140 GLN N N N N 141 GLN CA C N S 142 GLN C C N N 143 GLN O O N N 144 GLN CB C N N 145 GLN CG C N N 146 GLN CD C N N 147 GLN OE1 O N N 148 GLN NE2 N N N 149 GLN OXT O N N 150 GLN H H N N 151 GLN H2 H N N 152 GLN HA H N N 153 GLN HB2 H N N 154 GLN HB3 H N N 155 GLN HG2 H N N 156 GLN HG3 H N N 157 GLN HE21 H N N 158 GLN HE22 H N N 159 GLN HXT H N N 160 GLU N N N N 161 GLU CA C N S 162 GLU C C N N 163 GLU O O N N 164 GLU CB C N N 165 GLU CG C N N 166 GLU CD C N N 167 GLU OE1 O N N 168 GLU OE2 O N N 169 GLU OXT O N N 170 GLU H H N N 171 GLU H2 H N N 172 GLU HA H N N 173 GLU HB2 H N N 174 GLU HB3 H N N 175 GLU HG2 H N N 176 GLU HG3 H N N 177 GLU HE2 H N N 178 GLU HXT H N N 179 GLY N N N N 180 GLY CA C N N 181 GLY C C N N 182 GLY O O N N 183 GLY OXT O N N 184 GLY H H N N 185 GLY H2 H N N 186 GLY HA2 H N N 187 GLY HA3 H N N 188 GLY HXT H N N 189 HIS N N N N 190 HIS CA C N S 191 HIS C C N N 192 HIS O O N N 193 HIS CB C N N 194 HIS CG C Y N 195 HIS ND1 N Y N 196 HIS CD2 C Y N 197 HIS CE1 C Y N 198 HIS NE2 N Y N 199 HIS OXT O N N 200 HIS H H N N 201 HIS H2 H N N 202 HIS HA H N N 203 HIS HB2 H N N 204 HIS HB3 H N N 205 HIS HD1 H N N 206 HIS HD2 H N N 207 HIS HE1 H N N 208 HIS HE2 H N N 209 HIS HXT H N N 210 HOH O O N N 211 HOH H1 H N N 212 HOH H2 H N N 213 ILE N N N N 214 ILE CA C N S 215 ILE C C N N 216 ILE O O N N 217 ILE CB C N S 218 ILE CG1 C N N 219 ILE CG2 C N N 220 ILE CD1 C N N 221 ILE OXT O N N 222 ILE H H N N 223 ILE H2 H N N 224 ILE HA H N N 225 ILE HB H N N 226 ILE HG12 H N N 227 ILE HG13 H N N 228 ILE HG21 H N N 229 ILE HG22 H N N 230 ILE HG23 H N N 231 ILE HD11 H N N 232 ILE HD12 H N N 233 ILE HD13 H N N 234 ILE HXT H N N 235 LEU N N N N 236 LEU CA C N S 237 LEU C C N N 238 LEU O O N N 239 LEU CB C N N 240 LEU CG C N N 241 LEU CD1 C N N 242 LEU CD2 C N N 243 LEU OXT O N N 244 LEU H H N N 245 LEU H2 H N N 246 LEU HA H N N 247 LEU HB2 H N N 248 LEU HB3 H N N 249 LEU HG H N N 250 LEU HD11 H N N 251 LEU HD12 H N N 252 LEU HD13 H N N 253 LEU HD21 H N N 254 LEU HD22 H N N 255 LEU HD23 H N N 256 LEU HXT H N N 257 LYS N N N N 258 LYS CA C N S 259 LYS C C N N 260 LYS O O N N 261 LYS CB C N N 262 LYS CG C N N 263 LYS CD C N N 264 LYS CE C N N 265 LYS NZ N N N 266 LYS OXT O N N 267 LYS H H N N 268 LYS H2 H N N 269 LYS HA H N N 270 LYS HB2 H N N 271 LYS HB3 H N N 272 LYS HG2 H N N 273 LYS HG3 H N N 274 LYS HD2 H N N 275 LYS HD3 H N N 276 LYS HE2 H N N 277 LYS HE3 H N N 278 LYS HZ1 H N N 279 LYS HZ2 H N N 280 LYS HZ3 H N N 281 LYS HXT H N N 282 MET N N N N 283 MET CA C N S 284 MET C C N N 285 MET O O N N 286 MET CB C N N 287 MET CG C N N 288 MET SD S N N 289 MET CE C N N 290 MET OXT O N N 291 MET H H N N 292 MET H2 H N N 293 MET HA H N N 294 MET HB2 H N N 295 MET HB3 H N N 296 MET HG2 H N N 297 MET HG3 H N N 298 MET HE1 H N N 299 MET HE2 H N N 300 MET HE3 H N N 301 MET HXT H N N 302 MN MN MN N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 SO4 S S N N 358 SO4 O1 O N N 359 SO4 O2 O N N 360 SO4 O3 O N N 361 SO4 O4 O N N 362 THR N N N N 363 THR CA C N S 364 THR C C N N 365 THR O O N N 366 THR CB C N R 367 THR OG1 O N N 368 THR CG2 C N N 369 THR OXT O N N 370 THR H H N N 371 THR H2 H N N 372 THR HA H N N 373 THR HB H N N 374 THR HG1 H N N 375 THR HG21 H N N 376 THR HG22 H N N 377 THR HG23 H N N 378 THR HXT H N N 379 TRP N N N N 380 TRP CA C N S 381 TRP C C N N 382 TRP O O N N 383 TRP CB C N N 384 TRP CG C Y N 385 TRP CD1 C Y N 386 TRP CD2 C Y N 387 TRP NE1 N Y N 388 TRP CE2 C Y N 389 TRP CE3 C Y N 390 TRP CZ2 C Y N 391 TRP CZ3 C Y N 392 TRP CH2 C Y N 393 TRP OXT O N N 394 TRP H H N N 395 TRP H2 H N N 396 TRP HA H N N 397 TRP HB2 H N N 398 TRP HB3 H N N 399 TRP HD1 H N N 400 TRP HE1 H N N 401 TRP HE3 H N N 402 TRP HZ2 H N N 403 TRP HZ3 H N N 404 TRP HH2 H N N 405 TRP HXT H N N 406 TYR N N N N 407 TYR CA C N S 408 TYR C C N N 409 TYR O O N N 410 TYR CB C N N 411 TYR CG C Y N 412 TYR CD1 C Y N 413 TYR CD2 C Y N 414 TYR CE1 C Y N 415 TYR CE2 C Y N 416 TYR CZ C Y N 417 TYR OH O N N 418 TYR OXT O N N 419 TYR H H N N 420 TYR H2 H N N 421 TYR HA H N N 422 TYR HB2 H N N 423 TYR HB3 H N N 424 TYR HD1 H N N 425 TYR HD2 H N N 426 TYR HE1 H N N 427 TYR HE2 H N N 428 TYR HH H N N 429 TYR HXT H N N 430 VAL N N N N 431 VAL CA C N S 432 VAL C C N N 433 VAL O O N N 434 VAL CB C N N 435 VAL CG1 C N N 436 VAL CG2 C N N 437 VAL OXT O N N 438 VAL H H N N 439 VAL H2 H N N 440 VAL HA H N N 441 VAL HB H N N 442 VAL HG11 H N N 443 VAL HG12 H N N 444 VAL HG13 H N N 445 VAL HG21 H N N 446 VAL HG22 H N N 447 VAL HG23 H N N 448 VAL HXT H N N 449 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 E4Z C9 O4 sing N N 83 E4Z C9 C10 sing N N 84 E4Z O4 C8 sing N N 85 E4Z C10 N3 sing N N 86 E4Z C8 C7 sing N N 87 E4Z O3 C6 doub N N 88 E4Z N3 C6 sing N N 89 E4Z N3 C7 sing N N 90 E4Z C6 C4 sing N N 91 E4Z C7 N2 sing N N 92 E4Z O2 C5 sing N N 93 E4Z C4 C5 doub N N 94 E4Z C4 N1 sing N N 95 E4Z C5 C1 sing N N 96 E4Z N2 N1 sing N N 97 E4Z N2 C11 sing N N 98 E4Z N1 C3 sing N N 99 E4Z C1 O1 doub N N 100 E4Z C1 C2 sing N N 101 E4Z C3 C2 doub N N 102 E4Z C11 C12 sing N N 103 E4Z C11 C16 sing N N 104 E4Z C21 C22 doub Y N 105 E4Z C21 C12 sing Y N 106 E4Z C22 C23 sing Y N 107 E4Z C12 C13 doub Y N 108 E4Z C23 F2 sing N N 109 E4Z C23 C24 doub Y N 110 E4Z C13 C24 sing Y N 111 E4Z C13 C14 sing N N 112 E4Z C24 F1 sing N N 113 E4Z C14 S3 sing N N 114 E4Z C16 C20 doub Y N 115 E4Z C16 C15 sing Y N 116 E4Z C20 C19 sing Y N 117 E4Z S3 C15 sing N N 118 E4Z C15 C17 doub Y N 119 E4Z C19 C18 doub Y N 120 E4Z C17 C18 sing Y N 121 E4Z C2 H1 sing N N 122 E4Z C7 H3 sing N N 123 E4Z C14 H4 sing N N 124 E4Z C14 H5 sing N N 125 E4Z C17 H6 sing N N 126 E4Z C18 H7 sing N N 127 E4Z C19 H8 sing N N 128 E4Z C20 H9 sing N N 129 E4Z C21 H10 sing N N 130 E4Z C22 H11 sing N N 131 E4Z C11 H12 sing N N 132 E4Z C8 H13 sing N N 133 E4Z C8 H14 sing N N 134 E4Z C9 H15 sing N N 135 E4Z C9 H16 sing N N 136 E4Z C10 H17 sing N N 137 E4Z C10 H18 sing N N 138 E4Z C3 H19 sing N N 139 E4Z O2 H20 sing N N 140 GLN N CA sing N N 141 GLN N H sing N N 142 GLN N H2 sing N N 143 GLN CA C sing N N 144 GLN CA CB sing N N 145 GLN CA HA sing N N 146 GLN C O doub N N 147 GLN C OXT sing N N 148 GLN CB CG sing N N 149 GLN CB HB2 sing N N 150 GLN CB HB3 sing N N 151 GLN CG CD sing N N 152 GLN CG HG2 sing N N 153 GLN CG HG3 sing N N 154 GLN CD OE1 doub N N 155 GLN CD NE2 sing N N 156 GLN NE2 HE21 sing N N 157 GLN NE2 HE22 sing N N 158 GLN OXT HXT sing N N 159 GLU N CA sing N N 160 GLU N H sing N N 161 GLU N H2 sing N N 162 GLU CA C sing N N 163 GLU CA CB sing N N 164 GLU CA HA sing N N 165 GLU C O doub N N 166 GLU C OXT sing N N 167 GLU CB CG sing N N 168 GLU CB HB2 sing N N 169 GLU CB HB3 sing N N 170 GLU CG CD sing N N 171 GLU CG HG2 sing N N 172 GLU CG HG3 sing N N 173 GLU CD OE1 doub N N 174 GLU CD OE2 sing N N 175 GLU OE2 HE2 sing N N 176 GLU OXT HXT sing N N 177 GLY N CA sing N N 178 GLY N H sing N N 179 GLY N H2 sing N N 180 GLY CA C sing N N 181 GLY CA HA2 sing N N 182 GLY CA HA3 sing N N 183 GLY C O doub N N 184 GLY C OXT sing N N 185 GLY OXT HXT sing N N 186 HIS N CA sing N N 187 HIS N H sing N N 188 HIS N H2 sing N N 189 HIS CA C sing N N 190 HIS CA CB sing N N 191 HIS CA HA sing N N 192 HIS C O doub N N 193 HIS C OXT sing N N 194 HIS CB CG sing N N 195 HIS CB HB2 sing N N 196 HIS CB HB3 sing N N 197 HIS CG ND1 sing Y N 198 HIS CG CD2 doub Y N 199 HIS ND1 CE1 doub Y N 200 HIS ND1 HD1 sing N N 201 HIS CD2 NE2 sing Y N 202 HIS CD2 HD2 sing N N 203 HIS CE1 NE2 sing Y N 204 HIS CE1 HE1 sing N N 205 HIS NE2 HE2 sing N N 206 HIS OXT HXT sing N N 207 HOH O H1 sing N N 208 HOH O H2 sing N N 209 ILE N CA sing N N 210 ILE N H sing N N 211 ILE N H2 sing N N 212 ILE CA C sing N N 213 ILE CA CB sing N N 214 ILE CA HA sing N N 215 ILE C O doub N N 216 ILE C OXT sing N N 217 ILE CB CG1 sing N N 218 ILE CB CG2 sing N N 219 ILE CB HB sing N N 220 ILE CG1 CD1 sing N N 221 ILE CG1 HG12 sing N N 222 ILE CG1 HG13 sing N N 223 ILE CG2 HG21 sing N N 224 ILE CG2 HG22 sing N N 225 ILE CG2 HG23 sing N N 226 ILE CD1 HD11 sing N N 227 ILE CD1 HD12 sing N N 228 ILE CD1 HD13 sing N N 229 ILE OXT HXT sing N N 230 LEU N CA sing N N 231 LEU N H sing N N 232 LEU N H2 sing N N 233 LEU CA C sing N N 234 LEU CA CB sing N N 235 LEU CA HA sing N N 236 LEU C O doub N N 237 LEU C OXT sing N N 238 LEU CB CG sing N N 239 LEU CB HB2 sing N N 240 LEU CB HB3 sing N N 241 LEU CG CD1 sing N N 242 LEU CG CD2 sing N N 243 LEU CG HG sing N N 244 LEU CD1 HD11 sing N N 245 LEU CD1 HD12 sing N N 246 LEU CD1 HD13 sing N N 247 LEU CD2 HD21 sing N N 248 LEU CD2 HD22 sing N N 249 LEU CD2 HD23 sing N N 250 LEU OXT HXT sing N N 251 LYS N CA sing N N 252 LYS N H sing N N 253 LYS N H2 sing N N 254 LYS CA C sing N N 255 LYS CA CB sing N N 256 LYS CA HA sing N N 257 LYS C O doub N N 258 LYS C OXT sing N N 259 LYS CB CG sing N N 260 LYS CB HB2 sing N N 261 LYS CB HB3 sing N N 262 LYS CG CD sing N N 263 LYS CG HG2 sing N N 264 LYS CG HG3 sing N N 265 LYS CD CE sing N N 266 LYS CD HD2 sing N N 267 LYS CD HD3 sing N N 268 LYS CE NZ sing N N 269 LYS CE HE2 sing N N 270 LYS CE HE3 sing N N 271 LYS NZ HZ1 sing N N 272 LYS NZ HZ2 sing N N 273 LYS NZ HZ3 sing N N 274 LYS OXT HXT sing N N 275 MET N CA sing N N 276 MET N H sing N N 277 MET N H2 sing N N 278 MET CA C sing N N 279 MET CA CB sing N N 280 MET CA HA sing N N 281 MET C O doub N N 282 MET C OXT sing N N 283 MET CB CG sing N N 284 MET CB HB2 sing N N 285 MET CB HB3 sing N N 286 MET CG SD sing N N 287 MET CG HG2 sing N N 288 MET CG HG3 sing N N 289 MET SD CE sing N N 290 MET CE HE1 sing N N 291 MET CE HE2 sing N N 292 MET CE HE3 sing N N 293 MET OXT HXT sing N N 294 PHE N CA sing N N 295 PHE N H sing N N 296 PHE N H2 sing N N 297 PHE CA C sing N N 298 PHE CA CB sing N N 299 PHE CA HA sing N N 300 PHE C O doub N N 301 PHE C OXT sing N N 302 PHE CB CG sing N N 303 PHE CB HB2 sing N N 304 PHE CB HB3 sing N N 305 PHE CG CD1 doub Y N 306 PHE CG CD2 sing Y N 307 PHE CD1 CE1 sing Y N 308 PHE CD1 HD1 sing N N 309 PHE CD2 CE2 doub Y N 310 PHE CD2 HD2 sing N N 311 PHE CE1 CZ doub Y N 312 PHE CE1 HE1 sing N N 313 PHE CE2 CZ sing Y N 314 PHE CE2 HE2 sing N N 315 PHE CZ HZ sing N N 316 PHE OXT HXT sing N N 317 PRO N CA sing N N 318 PRO N CD sing N N 319 PRO N H sing N N 320 PRO CA C sing N N 321 PRO CA CB sing N N 322 PRO CA HA sing N N 323 PRO C O doub N N 324 PRO C OXT sing N N 325 PRO CB CG sing N N 326 PRO CB HB2 sing N N 327 PRO CB HB3 sing N N 328 PRO CG CD sing N N 329 PRO CG HG2 sing N N 330 PRO CG HG3 sing N N 331 PRO CD HD2 sing N N 332 PRO CD HD3 sing N N 333 PRO OXT HXT sing N N 334 SER N CA sing N N 335 SER N H sing N N 336 SER N H2 sing N N 337 SER CA C sing N N 338 SER CA CB sing N N 339 SER CA HA sing N N 340 SER C O doub N N 341 SER C OXT sing N N 342 SER CB OG sing N N 343 SER CB HB2 sing N N 344 SER CB HB3 sing N N 345 SER OG HG sing N N 346 SER OXT HXT sing N N 347 SO4 S O1 doub N N 348 SO4 S O2 doub N N 349 SO4 S O3 sing N N 350 SO4 S O4 sing N N 351 THR N CA sing N N 352 THR N H sing N N 353 THR N H2 sing N N 354 THR CA C sing N N 355 THR CA CB sing N N 356 THR CA HA sing N N 357 THR C O doub N N 358 THR C OXT sing N N 359 THR CB OG1 sing N N 360 THR CB CG2 sing N N 361 THR CB HB sing N N 362 THR OG1 HG1 sing N N 363 THR CG2 HG21 sing N N 364 THR CG2 HG22 sing N N 365 THR CG2 HG23 sing N N 366 THR OXT HXT sing N N 367 TRP N CA sing N N 368 TRP N H sing N N 369 TRP N H2 sing N N 370 TRP CA C sing N N 371 TRP CA CB sing N N 372 TRP CA HA sing N N 373 TRP C O doub N N 374 TRP C OXT sing N N 375 TRP CB CG sing N N 376 TRP CB HB2 sing N N 377 TRP CB HB3 sing N N 378 TRP CG CD1 doub Y N 379 TRP CG CD2 sing Y N 380 TRP CD1 NE1 sing Y N 381 TRP CD1 HD1 sing N N 382 TRP CD2 CE2 doub Y N 383 TRP CD2 CE3 sing Y N 384 TRP NE1 CE2 sing Y N 385 TRP NE1 HE1 sing N N 386 TRP CE2 CZ2 sing Y N 387 TRP CE3 CZ3 doub Y N 388 TRP CE3 HE3 sing N N 389 TRP CZ2 CH2 doub Y N 390 TRP CZ2 HZ2 sing N N 391 TRP CZ3 CH2 sing Y N 392 TRP CZ3 HZ3 sing N N 393 TRP CH2 HH2 sing N N 394 TRP OXT HXT sing N N 395 TYR N CA sing N N 396 TYR N H sing N N 397 TYR N H2 sing N N 398 TYR CA C sing N N 399 TYR CA CB sing N N 400 TYR CA HA sing N N 401 TYR C O doub N N 402 TYR C OXT sing N N 403 TYR CB CG sing N N 404 TYR CB HB2 sing N N 405 TYR CB HB3 sing N N 406 TYR CG CD1 doub Y N 407 TYR CG CD2 sing Y N 408 TYR CD1 CE1 sing Y N 409 TYR CD1 HD1 sing N N 410 TYR CD2 CE2 doub Y N 411 TYR CD2 HD2 sing N N 412 TYR CE1 CZ doub Y N 413 TYR CE1 HE1 sing N N 414 TYR CE2 CZ sing Y N 415 TYR CE2 HE2 sing N N 416 TYR CZ OH sing N N 417 TYR OH HH sing N N 418 TYR OXT HXT sing N N 419 VAL N CA sing N N 420 VAL N H sing N N 421 VAL N H2 sing N N 422 VAL CA C sing N N 423 VAL CA CB sing N N 424 VAL CA HA sing N N 425 VAL C O doub N N 426 VAL C OXT sing N N 427 VAL CB CG1 sing N N 428 VAL CB CG2 sing N N 429 VAL CB HB sing N N 430 VAL CG1 HG11 sing N N 431 VAL CG1 HG12 sing N N 432 VAL CG1 HG13 sing N N 433 VAL CG2 HG21 sing N N 434 VAL CG2 HG22 sing N N 435 VAL CG2 HG23 sing N N 436 VAL OXT HXT sing N N 437 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01AI098757 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id E4Z _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id E4Z _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'Baloxavir acid' E4Z 3 'MANGANESE (II) ION' MN 4 'SULFATE ION' SO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5DES _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein elutes as a monomer' #