data_7K87 # _entry.id 7K87 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7K87 pdb_00007k87 10.2210/pdb7k87/pdb WWPDB D_1000252070 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 6vl3 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7K87 _pdbx_database_status.recvd_initial_deposition_date 2020-09-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cuypers, M.G.' 1 ? 'Slavish, P.J.' 2 ? 'Jayaraman, S.' 3 ? 'Rankovic, Z.' 4 ? 'White, S.W.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country FR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Eur.J.Med.Chem. _citation.journal_id_ASTM EJMCA5 _citation.journal_id_CSD 0493 _citation.journal_id_ISSN 0223-5234 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 247 _citation.language ? _citation.page_first 115035 _citation.page_last 115035 _citation.title ;Chemical scaffold recycling: Structure-guided conversion of an HIV integrase inhibitor into a potent influenza virus RNA-dependent RNA polymerase inhibitor designed to minimize resistance potential. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ejmech.2022.115035 _citation.pdbx_database_id_PubMed 36603507 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Slavish, P.J.' 1 ? primary 'Cuypers, M.G.' 2 ? primary 'Rimmer, M.A.' 3 ? primary 'Abdolvahabi, A.' 4 ? primary 'Jeevan, T.' 5 ? primary 'Kumar, G.' 6 ? primary 'Jarusiewicz, J.A.' 7 ? primary 'Vaithiyalingam, S.' 8 ? primary 'Jones, J.C.' 9 ? primary 'Bowling, J.J.' 10 ? primary 'Price, J.E.' 11 ? primary 'DuBois, R.M.' 12 ? primary 'Min, J.' 13 ? primary 'Webby, R.J.' 14 ? primary 'Rankovic, Z.' 15 ? primary 'White, S.W.' 16 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7K87 _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.502 _cell.length_a_esd ? _cell.length_b 89.502 _cell.length_b_esd ? _cell.length_c 132.791 _cell.length_c_esd ? _cell.volume 1063736.647 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7K87 _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall 'I 4 2' _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein PA-X' 23136.289 1 ? ? ? ? 2 non-polymer syn 'Hexa Vinylpyrrolidone K15' 668.866 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 4 non-polymer syn '2-(2,6-difluorophenyl)-5-hydroxy-N-[2-(2-methoxypyridin-4-yl)ethyl]-6-oxo-3,6-dihydropyrimidine-4-carboxamide' 402.352 1 ? ? ? ? 5 water nat water 18.015 43 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAATCTHLEVCFMYSDGGSKHRFEII EGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKA DYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAATCTHLEVCFMYSDGGSKHRFEII EGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKA DYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLU n 1 23 ASP n 1 24 PHE n 1 25 VAL n 1 26 ARG n 1 27 GLN n 1 28 CYS n 1 29 PHE n 1 30 ASN n 1 31 PRO n 1 32 MET n 1 33 ILE n 1 34 VAL n 1 35 GLU n 1 36 LEU n 1 37 ALA n 1 38 GLU n 1 39 LYS n 1 40 ALA n 1 41 MET n 1 42 LYS n 1 43 GLU n 1 44 TYR n 1 45 GLY n 1 46 GLU n 1 47 ASP n 1 48 PRO n 1 49 LYS n 1 50 ILE n 1 51 GLU n 1 52 THR n 1 53 ASN n 1 54 LYS n 1 55 PHE n 1 56 ALA n 1 57 ALA n 1 58 THR n 1 59 CYS n 1 60 THR n 1 61 HIS n 1 62 LEU n 1 63 GLU n 1 64 VAL n 1 65 CYS n 1 66 PHE n 1 67 MET n 1 68 TYR n 1 69 SER n 1 70 ASP n 1 71 GLY n 1 72 GLY n 1 73 SER n 1 74 LYS n 1 75 HIS n 1 76 ARG n 1 77 PHE n 1 78 GLU n 1 79 ILE n 1 80 ILE n 1 81 GLU n 1 82 GLY n 1 83 ARG n 1 84 ASP n 1 85 ARG n 1 86 ILE n 1 87 MET n 1 88 ALA n 1 89 TRP n 1 90 THR n 1 91 VAL n 1 92 VAL n 1 93 ASN n 1 94 SER n 1 95 ILE n 1 96 CYS n 1 97 ASN n 1 98 THR n 1 99 THR n 1 100 GLY n 1 101 VAL n 1 102 GLU n 1 103 LYS n 1 104 PRO n 1 105 LYS n 1 106 PHE n 1 107 LEU n 1 108 PRO n 1 109 ASP n 1 110 LEU n 1 111 TYR n 1 112 ASP n 1 113 TYR n 1 114 LYS n 1 115 GLU n 1 116 ASN n 1 117 ARG n 1 118 PHE n 1 119 ILE n 1 120 GLU n 1 121 ILE n 1 122 GLY n 1 123 VAL n 1 124 THR n 1 125 ARG n 1 126 ARG n 1 127 GLU n 1 128 VAL n 1 129 HIS n 1 130 ILE n 1 131 TYR n 1 132 TYR n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 ALA n 1 137 ASN n 1 138 LYS n 1 139 ILE n 1 140 LYS n 1 141 SER n 1 142 GLU n 1 143 LYS n 1 144 THR n 1 145 HIS n 1 146 ILE n 1 147 HIS n 1 148 ILE n 1 149 PHE n 1 150 SER n 1 151 PHE n 1 152 THR n 1 153 GLY n 1 154 GLU n 1 155 GLU n 1 156 MET n 1 157 ALA n 1 158 THR n 1 159 LYS n 1 160 ALA n 1 161 ASP n 1 162 TYR n 1 163 THR n 1 164 LEU n 1 165 ASP n 1 166 GLU n 1 167 GLU n 1 168 SER n 1 169 ARG n 1 170 ALA n 1 171 ARG n 1 172 ILE n 1 173 LYS n 1 174 THR n 1 175 ARG n 1 176 LEU n 1 177 PHE n 1 178 THR n 1 179 ILE n 1 180 ARG n 1 181 GLN n 1 182 GLU n 1 183 MET n 1 184 ALA n 1 185 SER n 1 186 ARG n 1 187 SER n 1 188 LEU n 1 189 TRP n 1 190 ASP n 1 191 SER n 1 192 PHE n 1 193 ARG n 1 194 GLN n 1 195 SER n 1 196 GLU n 1 197 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 70 ? ? PA-X ? ? ? ? ? ? 'Influenza A virus' 11320 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 71 197 ? ? PA ? 'A/Luxembourg/43/2009(H1N1)' ? ? ? ? 'Influenza A virus (A/Luxembourg/43/2009(H1N1))' 655278 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A4D6EED0_9INFA A0A4D6EED0 ? 1 MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAATCTHLEVCFMYSD 1 2 UNP C6H0Y9_9INFA C6H0Y9 ? 1 ;KHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7K87 A 21 ? 70 ? A0A4D6EED0 1 ? 50 ? 1 50 2 2 7K87 A 74 ? 197 ? C6H0Y9 73 ? 196 ? 73 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7K87 MET A 1 ? UNP A0A4D6EED0 ? ? 'expression tag' -19 1 1 7K87 GLY A 2 ? UNP A0A4D6EED0 ? ? 'expression tag' -18 2 1 7K87 SER A 3 ? UNP A0A4D6EED0 ? ? 'expression tag' -17 3 1 7K87 SER A 4 ? UNP A0A4D6EED0 ? ? 'expression tag' -16 4 1 7K87 HIS A 5 ? UNP A0A4D6EED0 ? ? 'expression tag' -15 5 1 7K87 HIS A 6 ? UNP A0A4D6EED0 ? ? 'expression tag' -14 6 1 7K87 HIS A 7 ? UNP A0A4D6EED0 ? ? 'expression tag' -13 7 1 7K87 HIS A 8 ? UNP A0A4D6EED0 ? ? 'expression tag' -12 8 1 7K87 HIS A 9 ? UNP A0A4D6EED0 ? ? 'expression tag' -11 9 1 7K87 HIS A 10 ? UNP A0A4D6EED0 ? ? 'expression tag' -10 10 1 7K87 SER A 11 ? UNP A0A4D6EED0 ? ? 'expression tag' -9 11 1 7K87 SER A 12 ? UNP A0A4D6EED0 ? ? 'expression tag' -8 12 1 7K87 GLY A 13 ? UNP A0A4D6EED0 ? ? 'expression tag' -7 13 1 7K87 LEU A 14 ? UNP A0A4D6EED0 ? ? 'expression tag' -6 14 1 7K87 VAL A 15 ? UNP A0A4D6EED0 ? ? 'expression tag' -5 15 1 7K87 PRO A 16 ? UNP A0A4D6EED0 ? ? 'expression tag' -4 16 1 7K87 ARG A 17 ? UNP A0A4D6EED0 ? ? 'expression tag' -3 17 1 7K87 GLY A 18 ? UNP A0A4D6EED0 ? ? 'expression tag' -2 18 1 7K87 SER A 19 ? UNP A0A4D6EED0 ? ? 'expression tag' -1 19 1 7K87 HIS A 20 ? UNP A0A4D6EED0 ? ? 'expression tag' 0 20 1 7K87 GLY A 71 ? UNP A0A4D6EED0 ? ? linker 51 21 1 7K87 GLY A 72 ? UNP A0A4D6EED0 ? ? linker 52 22 1 7K87 SER A 73 ? UNP A0A4D6EED0 ? ? linker 53 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QQ4 non-polymer . 'Hexa Vinylpyrrolidone K15' "1,1',1'',1''',1'''',1'''''-[(3R,5R,7R,9S,11R)-dodecane-1,3,5,7,9,11-hexayl]hexa(pyrrolidin-2-one)" 'C36 H56 N6 O6' 668.866 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 W5V non-polymer . '2-(2,6-difluorophenyl)-5-hydroxy-N-[2-(2-methoxypyridin-4-yl)ethyl]-6-oxo-3,6-dihydropyrimidine-4-carboxamide' ? 'C19 H16 F2 N4 O4' 402.352 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7K87 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES PH 7.8, 1 M AMMONIUM SULFATE, 10 MM MNCL2, 10 MM MGCL2, 0.5% PVP K15' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-09-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 57.91 _reflns.entry_id 7K87 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.70 _reflns.d_resolution_low 45.81 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7507 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.6 _reflns.pdbx_Rmerge_I_obs 0.091 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.01 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.101 _reflns.pdbx_Rpim_I_all 0.042 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5615 _reflns_shell.percent_possible_all 98.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.995 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.98 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.097 _reflns_shell.pdbx_Rpim_I_all 0.453 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.649 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 69.45 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7K87 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 44.75 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7504 _refine.ls_number_reflns_R_free 377 _refine.ls_number_reflns_R_work 7127 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.00 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2070 _refine.ls_R_factor_R_free 0.2392 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2054 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5vpt _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.1941 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4479 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 44.75 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 1560 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1445 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 72 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0023 ? 1565 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5753 ? 2116 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0409 ? 221 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0035 ? 268 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.0119 ? 226 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.70 3.09 . . 149 2317 98.13 . . . 0.3865 . 0.2925 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.09 3.89 . . 108 2373 97.56 . . . 0.2415 . 0.2098 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.89 44.75 . . 120 2437 95.41 . . . 0.1920 . 0.1805 . . . . . . . . . . . # _struct.entry_id 7K87 _struct.title 'The crystal structure of the 2009 H1N1 PA endonuclease in complex with SJ000986436' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7K87 _struct_keywords.text 'NUCLEASE, INFLUENZA, INHIBITOR RESISTANCE, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 19 ? PHE A 29 ? SER A -1 PHE A 9 1 ? 11 HELX_P HELX_P2 AA2 ASN A 30 ? TYR A 44 ? ASN A 10 TYR A 24 1 ? 15 HELX_P HELX_P3 AA3 GLU A 51 ? GLY A 71 ? GLU A 31 GLY A 51 1 ? 21 HELX_P HELX_P4 AA4 ASP A 84 ? GLY A 100 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 127 ? ILE A 139 ? GLU A 126 ILE A 138 1 ? 13 HELX_P HELX_P6 AA6 LYS A 159 ? ASP A 161 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 165 ? ARG A 186 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 188 ? GLN A 194 ? LEU A 187 GLN A 193 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 61 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 41 A MN 402 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc2 metalc ? ? A GLU 81 OE1 ? ? ? 1_555 D MN . MN ? ? A GLU 80 A MN 403 1_555 ? ? ? ? ? ? ? 2.384 ? ? metalc3 metalc ? ? A ASP 109 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 402 1_555 ? ? ? ? ? ? ? 2.410 ? ? metalc4 metalc ? ? A ASP 109 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 108 A MN 403 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc5 metalc ? ? A GLU 120 OE2 ? ? ? 1_555 C MN . MN ? ? A GLU 119 A MN 402 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc6 metalc ? ? A ILE 121 O ? ? ? 1_555 C MN . MN ? ? A ILE 120 A MN 402 1_555 ? ? ? ? ? ? ? 2.104 ? ? metalc7 metalc ? ? C MN . MN ? ? ? 1_555 E W5V . O13 ? ? A MN 402 A W5V 404 1_555 ? ? ? ? ? ? ? 1.993 ? ? metalc8 metalc ? ? C MN . MN ? ? ? 1_555 E W5V . O15 ? ? A MN 402 A W5V 404 1_555 ? ? ? ? ? ? ? 1.865 ? ? metalc9 metalc ? ? D MN . MN ? ? ? 1_555 E W5V . O13 ? ? A MN 403 A W5V 404 1_555 ? ? ? ? ? ? ? 2.295 ? ? metalc10 metalc ? ? D MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 403 A HOH 501 1_555 ? ? ? ? ? ? ? 2.776 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 77 ? ILE A 79 ? PHE A 76 ILE A 78 AA1 2 LEU A 110 ? ASP A 112 ? LEU A 109 ASP A 111 AA1 3 ARG A 117 ? THR A 124 ? ARG A 116 THR A 123 AA1 4 HIS A 145 ? SER A 150 ? HIS A 144 SER A 149 AA1 5 GLU A 155 ? ALA A 157 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 78 ? N GLU A 77 O TYR A 111 ? O TYR A 110 AA1 2 3 N ASP A 112 ? N ASP A 111 O ARG A 117 ? O ARG A 116 AA1 3 4 N GLU A 120 ? N GLU A 119 O HIS A 145 ? O HIS A 144 AA1 4 5 N ILE A 148 ? N ILE A 147 O MET A 156 ? O MET A 155 # _atom_sites.entry_id 7K87 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011173 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011173 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007531 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 8.95735 ? ? ? 7.27484 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 -4 PRO PRO A . n A 1 17 ARG 17 -3 -3 ARG ARG A . n A 1 18 GLY 18 -2 -2 GLY GLY A . n A 1 19 SER 19 -1 -1 SER SER A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 GLU 22 2 2 GLU GLU A . n A 1 23 ASP 23 3 3 ASP ASP A . n A 1 24 PHE 24 4 4 PHE PHE A . n A 1 25 VAL 25 5 5 VAL VAL A . n A 1 26 ARG 26 6 6 ARG ARG A . n A 1 27 GLN 27 7 7 GLN GLN A . n A 1 28 CYS 28 8 8 CYS CYS A . n A 1 29 PHE 29 9 9 PHE PHE A . n A 1 30 ASN 30 10 10 ASN ASN A . n A 1 31 PRO 31 11 11 PRO PRO A . n A 1 32 MET 32 12 12 MET MET A . n A 1 33 ILE 33 13 13 ILE ILE A . n A 1 34 VAL 34 14 14 VAL VAL A . n A 1 35 GLU 35 15 15 GLU GLU A . n A 1 36 LEU 36 16 16 LEU LEU A . n A 1 37 ALA 37 17 17 ALA ALA A . n A 1 38 GLU 38 18 18 GLU GLU A . n A 1 39 LYS 39 19 19 LYS LYS A . n A 1 40 ALA 40 20 20 ALA ALA A . n A 1 41 MET 41 21 21 MET MET A . n A 1 42 LYS 42 22 22 LYS LYS A . n A 1 43 GLU 43 23 23 GLU GLU A . n A 1 44 TYR 44 24 24 TYR TYR A . n A 1 45 GLY 45 25 25 GLY GLY A . n A 1 46 GLU 46 26 26 GLU GLU A . n A 1 47 ASP 47 27 27 ASP ASP A . n A 1 48 PRO 48 28 28 PRO PRO A . n A 1 49 LYS 49 29 29 LYS LYS A . n A 1 50 ILE 50 30 30 ILE ILE A . n A 1 51 GLU 51 31 31 GLU GLU A . n A 1 52 THR 52 32 32 THR THR A . n A 1 53 ASN 53 33 33 ASN ASN A . n A 1 54 LYS 54 34 34 LYS LYS A . n A 1 55 PHE 55 35 35 PHE PHE A . n A 1 56 ALA 56 36 36 ALA ALA A . n A 1 57 ALA 57 37 37 ALA ALA A . n A 1 58 THR 58 38 38 THR THR A . n A 1 59 CYS 59 39 39 CYS CYS A . n A 1 60 THR 60 40 40 THR THR A . n A 1 61 HIS 61 41 41 HIS HIS A . n A 1 62 LEU 62 42 42 LEU LEU A . n A 1 63 GLU 63 43 43 GLU GLU A . n A 1 64 VAL 64 44 44 VAL VAL A . n A 1 65 CYS 65 45 45 CYS CYS A . n A 1 66 PHE 66 46 46 PHE PHE A . n A 1 67 MET 67 47 47 MET MET A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 SER 69 49 49 SER SER A . n A 1 70 ASP 70 50 50 ASP ASP A . n A 1 71 GLY 71 51 51 GLY GLY A . n A 1 72 GLY 72 52 52 GLY GLY A . n A 1 73 SER 73 53 53 SER SER A . n A 1 74 LYS 74 73 73 LYS LYS A . n A 1 75 HIS 75 74 74 HIS HIS A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 PHE 77 76 76 PHE PHE A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 ILE 79 78 78 ILE ILE A . n A 1 80 ILE 80 79 79 ILE ILE A . n A 1 81 GLU 81 80 80 GLU GLU A . n A 1 82 GLY 82 81 81 GLY GLY A . n A 1 83 ARG 83 82 82 ARG ARG A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 ARG 85 84 84 ARG ARG A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 MET 87 86 86 MET MET A . n A 1 88 ALA 88 87 87 ALA ALA A . n A 1 89 TRP 89 88 88 TRP TRP A . n A 1 90 THR 90 89 89 THR THR A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 ASN 93 92 92 ASN ASN A . n A 1 94 SER 94 93 93 SER SER A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 CYS 96 95 95 CYS CYS A . n A 1 97 ASN 97 96 96 ASN ASN A . n A 1 98 THR 98 97 97 THR THR A . n A 1 99 THR 99 98 98 THR THR A . n A 1 100 GLY 100 99 99 GLY GLY A . n A 1 101 VAL 101 100 100 VAL VAL A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 PRO 104 103 103 PRO PRO A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 PHE 106 105 105 PHE PHE A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 PRO 108 107 107 PRO PRO A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 LEU 110 109 109 LEU LEU A . n A 1 111 TYR 111 110 110 TYR TYR A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 TYR 113 112 112 TYR TYR A . n A 1 114 LYS 114 113 113 LYS LYS A . n A 1 115 GLU 115 114 114 GLU GLU A . n A 1 116 ASN 116 115 115 ASN ASN A . n A 1 117 ARG 117 116 116 ARG ARG A . n A 1 118 PHE 118 117 117 PHE PHE A . n A 1 119 ILE 119 118 118 ILE ILE A . n A 1 120 GLU 120 119 119 GLU GLU A . n A 1 121 ILE 121 120 120 ILE ILE A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 THR 124 123 123 THR THR A . n A 1 125 ARG 125 124 124 ARG ARG A . n A 1 126 ARG 126 125 125 ARG ARG A . n A 1 127 GLU 127 126 126 GLU GLU A . n A 1 128 VAL 128 127 127 VAL VAL A . n A 1 129 HIS 129 128 128 HIS HIS A . n A 1 130 ILE 130 129 129 ILE ILE A . n A 1 131 TYR 131 130 130 TYR TYR A . n A 1 132 TYR 132 131 131 TYR TYR A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 GLU 134 133 133 GLU GLU A . n A 1 135 LYS 135 134 134 LYS LYS A . n A 1 136 ALA 136 135 135 ALA ALA A . n A 1 137 ASN 137 136 136 ASN ASN A . n A 1 138 LYS 138 137 137 LYS LYS A . n A 1 139 ILE 139 138 138 ILE ILE A . n A 1 140 LYS 140 139 139 LYS LYS A . n A 1 141 SER 141 140 140 SER SER A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 LYS 143 142 142 LYS LYS A . n A 1 144 THR 144 143 143 THR THR A . n A 1 145 HIS 145 144 144 HIS HIS A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 HIS 147 146 146 HIS HIS A . n A 1 148 ILE 148 147 147 ILE ILE A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 SER 150 149 149 SER SER A . n A 1 151 PHE 151 150 150 PHE PHE A . n A 1 152 THR 152 151 151 THR THR A . n A 1 153 GLY 153 152 152 GLY GLY A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 GLU 155 154 154 GLU GLU A . n A 1 156 MET 156 155 155 MET MET A . n A 1 157 ALA 157 156 156 ALA ALA A . n A 1 158 THR 158 157 157 THR THR A . n A 1 159 LYS 159 158 158 LYS LYS A . n A 1 160 ALA 160 159 159 ALA ALA A . n A 1 161 ASP 161 160 160 ASP ASP A . n A 1 162 TYR 162 161 161 TYR TYR A . n A 1 163 THR 163 162 162 THR THR A . n A 1 164 LEU 164 163 163 LEU LEU A . n A 1 165 ASP 165 164 164 ASP ASP A . n A 1 166 GLU 166 165 165 GLU GLU A . n A 1 167 GLU 167 166 166 GLU GLU A . n A 1 168 SER 168 167 167 SER SER A . n A 1 169 ARG 169 168 168 ARG ARG A . n A 1 170 ALA 170 169 169 ALA ALA A . n A 1 171 ARG 171 170 170 ARG ARG A . n A 1 172 ILE 172 171 171 ILE ILE A . n A 1 173 LYS 173 172 172 LYS LYS A . n A 1 174 THR 174 173 173 THR THR A . n A 1 175 ARG 175 174 174 ARG ARG A . n A 1 176 LEU 176 175 175 LEU LEU A . n A 1 177 PHE 177 176 176 PHE PHE A . n A 1 178 THR 178 177 177 THR THR A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 GLN 181 180 180 GLN GLN A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 MET 183 182 182 MET MET A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 SER 185 184 184 SER SER A . n A 1 186 ARG 186 185 185 ARG ARG A . n A 1 187 SER 187 186 186 SER SER A . n A 1 188 LEU 188 187 187 LEU LEU A . n A 1 189 TRP 189 188 188 TRP TRP A . n A 1 190 ASP 190 189 189 ASP ASP A . n A 1 191 SER 191 190 190 SER SER A . n A 1 192 PHE 192 191 191 PHE PHE A . n A 1 193 ARG 193 192 192 ARG ARG A . n A 1 194 GLN 194 193 193 GLN GLN A . n A 1 195 SER 195 194 194 SER SER A . n A 1 196 GLU 196 195 195 GLU GLU A . n A 1 197 ARG 197 196 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 QQ4 1 401 401 QQ4 PVP A . C 3 MN 1 402 201 MN MN A . D 3 MN 1 403 202 MN MN A . E 4 W5V 1 404 301 W5V 569 A . F 5 HOH 1 501 2 HOH HOH A . F 5 HOH 2 502 7 HOH HOH A . F 5 HOH 3 503 12 HOH HOH A . F 5 HOH 4 504 1 HOH HOH A . F 5 HOH 5 505 4 HOH HOH A . F 5 HOH 6 506 27 HOH HOH A . F 5 HOH 7 507 28 HOH HOH A . F 5 HOH 8 508 53 HOH HOH A . F 5 HOH 9 509 8 HOH HOH A . F 5 HOH 10 510 38 HOH HOH A . F 5 HOH 11 511 10 HOH HOH A . F 5 HOH 12 512 21 HOH HOH A . F 5 HOH 13 513 31 HOH HOH A . F 5 HOH 14 514 13 HOH HOH A . F 5 HOH 15 515 30 HOH HOH A . F 5 HOH 16 516 45 HOH HOH A . F 5 HOH 17 517 33 HOH HOH A . F 5 HOH 18 518 9 HOH HOH A . F 5 HOH 19 519 24 HOH HOH A . F 5 HOH 20 520 29 HOH HOH A . F 5 HOH 21 521 19 HOH HOH A . F 5 HOH 22 522 3 HOH HOH A . F 5 HOH 23 523 51 HOH HOH A . F 5 HOH 24 524 5 HOH HOH A . F 5 HOH 25 525 6 HOH HOH A . F 5 HOH 26 526 15 HOH HOH A . F 5 HOH 27 527 37 HOH HOH A . F 5 HOH 28 528 40 HOH HOH A . F 5 HOH 29 529 39 HOH HOH A . F 5 HOH 30 530 54 HOH HOH A . F 5 HOH 31 531 52 HOH HOH A . F 5 HOH 32 532 41 HOH HOH A . F 5 HOH 33 533 22 HOH HOH A . F 5 HOH 34 534 18 HOH HOH A . F 5 HOH 35 535 20 HOH HOH A . F 5 HOH 36 536 35 HOH HOH A . F 5 HOH 37 537 44 HOH HOH A . F 5 HOH 38 538 46 HOH HOH A . F 5 HOH 39 539 34 HOH HOH A . F 5 HOH 40 540 47 HOH HOH A . F 5 HOH 41 541 14 HOH HOH A . F 5 HOH 42 542 17 HOH HOH A . F 5 HOH 43 543 16 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details octameric _pdbx_struct_assembly.oligomeric_count 8 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 17960 ? 1 MORE -140 ? 1 'SSA (A^2)' 58880 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 89.5020000000 0.0000000000 -1.0000000000 0.0000000000 89.5020000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -y+1,x,z 0.0000000000 -1.0000000000 0.0000000000 89.5020000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_565 y,-x+1,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 89.5020000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 89.5020000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 89.5020000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 8 'crystal symmetry operation' 8_665 -y+1,-x+1,-z 0.0000000000 -1.0000000000 0.0000000000 89.5020000000 -1.0000000000 0.0000000000 0.0000000000 89.5020000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 97.2 ? 2 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 175.7 ? 3 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 82.3 ? 4 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 84.4 ? 5 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 88.9 ? 6 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 91.3 ? 7 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O13 ? E W5V . ? A W5V 404 ? 1_555 102.4 ? 8 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O13 ? E W5V . ? A W5V 404 ? 1_555 94.1 ? 9 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O13 ? E W5V . ? A W5V 404 ? 1_555 81.9 ? 10 O ? A ILE 121 ? A ILE 120 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O13 ? E W5V . ? A W5V 404 ? 1_555 172.1 ? 11 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O15 ? E W5V . ? A W5V 404 ? 1_555 87.0 ? 12 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O15 ? E W5V . ? A W5V 404 ? 1_555 171.1 ? 13 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O15 ? E W5V . ? A W5V 404 ? 1_555 92.9 ? 14 O ? A ILE 121 ? A ILE 120 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O15 ? E W5V . ? A W5V 404 ? 1_555 83.8 ? 15 O13 ? E W5V . ? A W5V 404 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O15 ? E W5V . ? A W5V 404 ? 1_555 92.6 ? 16 OE1 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 101.7 ? 17 OE1 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O13 ? E W5V . ? A W5V 404 ? 1_555 151.7 ? 18 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O13 ? E W5V . ? A W5V 404 ? 1_555 77.9 ? 19 OE1 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 74.9 ? 20 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 92.7 ? 21 O13 ? E W5V . ? A W5V 404 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 133.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-29 2 'Structure model' 1 1 2023-03-29 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z 3 y,-x,z 4 x,-y,-z 5 -x,y,-z 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z 9 x+1/2,y+1/2,z+1/2 10 -y+1/2,x+1/2,z+1/2 11 y+1/2,-x+1/2,z+1/2 12 x+1/2,-y+1/2,-z+1/2 13 -x+1/2,y+1/2,-z+1/2 14 -x+1/2,-y+1/2,z+1/2 15 y+1/2,x+1/2,-z+1/2 16 -y+1/2,-x+1/2,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 35.2029027787 20.8341621595 7.59404373687 0.749765503508 ? -0.022316010488 ? 0.234119392779 ? 0.65168059741 ? -0.0303921274395 ? 0.532234364251 ? 5.72037152247 ? -1.76725386883 ? 1.50946112604 ? 3.07347617065 ? 0.166915762465 ? 5.87035041777 ? 0.172482282496 ? 0.881567572719 ? -0.416319714981 ? -0.576419470526 ? -0.40100438879 ? 0.0509156013386 ? 0.772489019555 ? 0.406480820599 ? 0.14005233221 ? 2 'X-RAY DIFFRACTION' ? refined 48.4469699661 21.2760159458 22.0889174294 0.804739596888 ? -0.0400595559983 ? 0.151673607648 ? 0.606886652232 ? 0.215331752393 ? 0.470066043217 ? 7.06423015616 ? -0.490270807715 ? -0.516919903568 ? 2.55730705479 ? -1.15364092641 ? 2.72154573653 ? 0.0608814305784 ? -0.389303029389 ? -0.150828676616 ? 0.421688734918 ? -0.283848483702 ? -0.291266576721 ? 0.515813884986 ? 0.230257403138 ? 0.17501808307 ? 3 'X-RAY DIFFRACTION' ? refined 35.097748248 10.9291028535 27.6447007861 1.40070271546 ? -0.0510164748259 ? 0.194893944182 ? 0.599661706087 ? 0.272743944188 ? 0.699844238538 ? 0.576946318123 ? -0.231280376941 ? 0.0908026744676 ? 0.120984265714 ? 0.00366899216756 ? 0.0711655458045 ? 0.0842861417765 ? -0.0523414838376 ? -0.199489061644 ? -0.472321015823 ? 0.39864404669 ? 0.414908468018 ? 0.490167687648 ? -0.408738162045 ? 0.21348209802 ? 4 'X-RAY DIFFRACTION' ? refined 29.9324190268 22.2662635532 22.1064719076 0.789363460269 ? -0.177046831778 ? 0.317295995841 ? 0.535738729133 ? -0.00698419187766 ? 0.53280373062 ? 4.22559245809 ? -0.132285834367 ? 1.74256324049 ? 0.749254370698 ? -0.77830098383 ? 5.60714709208 ? 0.0413095247223 ? -0.477760856284 ? -0.192113583337 ? 0.192199359058 ? -0.157409695929 ? 0.207290998169 ? 0.567831532272 ? -0.58398818656 ? -0.0166574179174 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 3 A -2 ? A 55 A 50 ? ? ;chain 'A' and (resid -2 through 50 ) ; 2 'X-RAY DIFFRACTION' 2 A 56 A 51 ? A 112 A 126 ? ? ;chain 'A' and (resid 51 through 126 ) ; 3 'X-RAY DIFFRACTION' 3 A 113 A 127 ? A 124 A 138 ? ? ;chain 'A' and (resid 127 through 138 ) ; 4 'X-RAY DIFFRACTION' 4 A 125 A 139 ? A 181 A 195 ? ? ;chain 'A' and (resid 139 through 195 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_3965 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 7K87 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 MN _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 MN _pdbx_validate_close_contact.auth_seq_id_1 403 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O10 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 W5V _pdbx_validate_close_contact.auth_seq_id_2 404 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.64 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A -3 ? ? 67.70 154.38 2 1 ILE A 30 ? ? -103.19 -62.28 3 1 ARG A 125 ? ? -130.90 -156.52 4 1 SER A 140 ? ? -67.76 92.15 5 1 THR A 162 ? ? 66.07 -44.83 6 1 SER A 194 ? ? -146.85 -30.70 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG -3 ? CZ ? A ARG 17 CZ 2 1 Y 1 A ARG -3 ? NH1 ? A ARG 17 NH1 3 1 Y 1 A ARG -3 ? NH2 ? A ARG 17 NH2 4 1 Y 1 A GLU 15 ? CD ? A GLU 35 CD 5 1 Y 1 A GLU 15 ? OE1 ? A GLU 35 OE1 6 1 Y 1 A GLU 15 ? OE2 ? A GLU 35 OE2 7 1 Y 1 A ARG 84 ? NE ? A ARG 85 NE 8 1 Y 1 A ARG 84 ? CZ ? A ARG 85 CZ 9 1 Y 1 A ARG 84 ? NH1 ? A ARG 85 NH1 10 1 Y 1 A ARG 84 ? NH2 ? A ARG 85 NH2 11 1 Y 1 A GLU 101 ? CG ? A GLU 102 CG 12 1 Y 1 A GLU 101 ? CD ? A GLU 102 CD 13 1 Y 1 A GLU 101 ? OE1 ? A GLU 102 OE1 14 1 Y 1 A GLU 101 ? OE2 ? A GLU 102 OE2 15 1 Y 1 A LYS 104 ? CG ? A LYS 105 CG 16 1 Y 1 A LYS 104 ? CD ? A LYS 105 CD 17 1 Y 1 A LYS 104 ? CE ? A LYS 105 CE 18 1 Y 1 A LYS 104 ? NZ ? A LYS 105 NZ 19 1 Y 1 A LEU 132 ? CG ? A LEU 133 CG 20 1 Y 1 A LEU 132 ? CD1 ? A LEU 133 CD1 21 1 Y 1 A LEU 132 ? CD2 ? A LEU 133 CD2 22 1 Y 1 A LYS 137 ? CG ? A LYS 138 CG 23 1 Y 1 A LYS 137 ? CD ? A LYS 138 CD 24 1 Y 1 A LYS 137 ? CE ? A LYS 138 CE 25 1 Y 1 A LYS 137 ? NZ ? A LYS 138 NZ 26 1 Y 1 A LYS 139 ? CG ? A LYS 140 CG 27 1 Y 1 A LYS 139 ? CD ? A LYS 140 CD 28 1 Y 1 A LYS 139 ? CE ? A LYS 140 CE 29 1 Y 1 A LYS 139 ? NZ ? A LYS 140 NZ 30 1 Y 1 A GLU 141 ? CG ? A GLU 142 CG 31 1 Y 1 A GLU 141 ? CD ? A GLU 142 CD 32 1 Y 1 A GLU 141 ? OE1 ? A GLU 142 OE1 33 1 Y 1 A GLU 141 ? OE2 ? A GLU 142 OE2 34 1 Y 1 A LYS 142 ? CG ? A LYS 143 CG 35 1 Y 1 A LYS 142 ? CD ? A LYS 143 CD 36 1 Y 1 A LYS 142 ? CE ? A LYS 143 CE 37 1 Y 1 A LYS 142 ? NZ ? A LYS 143 NZ 38 1 Y 1 A MET 155 ? CG ? A MET 156 CG 39 1 Y 1 A MET 155 ? SD ? A MET 156 SD 40 1 Y 1 A MET 155 ? CE ? A MET 156 CE 41 1 Y 1 A LYS 158 ? CE ? A LYS 159 CE 42 1 Y 1 A LYS 158 ? NZ ? A LYS 159 NZ 43 1 Y 1 A ARG 170 ? NE ? A ARG 171 NE 44 1 Y 1 A ARG 170 ? CZ ? A ARG 171 CZ 45 1 Y 1 A ARG 170 ? NH1 ? A ARG 171 NH1 46 1 Y 1 A ARG 170 ? NH2 ? A ARG 171 NH2 47 1 Y 1 A GLN 193 ? CG ? A GLN 194 CG 48 1 Y 1 A GLN 193 ? CD ? A GLN 194 CD 49 1 Y 1 A GLN 193 ? OE1 ? A GLN 194 OE1 50 1 Y 1 A GLN 193 ? NE2 ? A GLN 194 NE2 51 1 N 1 A QQ4 401 ? C12 ? B QQ4 1 C12 52 1 N 1 A QQ4 401 ? C19 ? B QQ4 1 C19 53 1 N 1 A QQ4 401 ? C20 ? B QQ4 1 C20 54 1 N 1 A QQ4 401 ? C21 ? B QQ4 1 C21 55 1 N 1 A QQ4 401 ? C42 ? B QQ4 1 C42 56 1 N 1 A QQ4 401 ? N02 ? B QQ4 1 N02 57 1 N 1 A QQ4 401 ? O05 ? B QQ4 1 O05 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A ARG 196 ? A ARG 197 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MN MN MN N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 QQ4 C12 C N N 291 QQ4 C11 C N N 292 QQ4 C10 C N N 293 QQ4 C01 C N R 294 QQ4 C02 C N N 295 QQ4 C03 C N R 296 QQ4 C04 C N N 297 QQ4 C05 C N R 298 QQ4 C06 C N N 299 QQ4 C07 C N S 300 QQ4 C08 C N N 301 QQ4 C09 C N R 302 QQ4 C19 C N N 303 QQ4 C20 C N N 304 QQ4 C21 C N N 305 QQ4 C22 C N N 306 QQ4 C23 C N N 307 QQ4 C24 C N N 308 QQ4 C25 C N N 309 QQ4 C26 C N N 310 QQ4 C27 C N N 311 QQ4 C28 C N N 312 QQ4 C29 C N N 313 QQ4 C30 C N N 314 QQ4 C31 C N N 315 QQ4 C32 C N N 316 QQ4 C33 C N N 317 QQ4 C34 C N N 318 QQ4 C35 C N N 319 QQ4 C36 C N N 320 QQ4 C37 C N N 321 QQ4 C38 C N N 322 QQ4 C39 C N N 323 QQ4 C40 C N N 324 QQ4 C41 C N N 325 QQ4 C42 C N N 326 QQ4 N02 N N N 327 QQ4 N03 N N N 328 QQ4 N04 N N N 329 QQ4 N05 N N N 330 QQ4 N06 N N N 331 QQ4 N07 N N N 332 QQ4 O02 O N N 333 QQ4 O03 O N N 334 QQ4 O04 O N N 335 QQ4 O05 O N N 336 QQ4 O06 O N N 337 QQ4 O07 O N N 338 QQ4 H1 H N N 339 QQ4 H2 H N N 340 QQ4 H3 H N N 341 QQ4 H4 H N N 342 QQ4 H5 H N N 343 QQ4 H6 H N N 344 QQ4 H7 H N N 345 QQ4 H8 H N N 346 QQ4 H9 H N N 347 QQ4 H10 H N N 348 QQ4 H11 H N N 349 QQ4 H12 H N N 350 QQ4 H13 H N N 351 QQ4 H14 H N N 352 QQ4 H15 H N N 353 QQ4 H16 H N N 354 QQ4 H17 H N N 355 QQ4 H18 H N N 356 QQ4 H19 H N N 357 QQ4 H20 H N N 358 QQ4 H21 H N N 359 QQ4 H22 H N N 360 QQ4 H23 H N N 361 QQ4 H24 H N N 362 QQ4 H25 H N N 363 QQ4 H26 H N N 364 QQ4 H27 H N N 365 QQ4 H28 H N N 366 QQ4 H29 H N N 367 QQ4 H30 H N N 368 QQ4 H31 H N N 369 QQ4 H32 H N N 370 QQ4 H33 H N N 371 QQ4 H34 H N N 372 QQ4 H35 H N N 373 QQ4 H36 H N N 374 QQ4 H37 H N N 375 QQ4 H38 H N N 376 QQ4 H39 H N N 377 QQ4 H40 H N N 378 QQ4 H41 H N N 379 QQ4 H42 H N N 380 QQ4 H43 H N N 381 QQ4 H44 H N N 382 QQ4 H45 H N N 383 QQ4 H46 H N N 384 QQ4 H47 H N N 385 QQ4 H48 H N N 386 QQ4 H49 H N N 387 QQ4 H50 H N N 388 QQ4 H51 H N N 389 QQ4 H52 H N N 390 QQ4 H53 H N N 391 QQ4 H54 H N N 392 QQ4 H55 H N N 393 QQ4 H56 H N N 394 SER N N N N 395 SER CA C N S 396 SER C C N N 397 SER O O N N 398 SER CB C N N 399 SER OG O N N 400 SER OXT O N N 401 SER H H N N 402 SER H2 H N N 403 SER HA H N N 404 SER HB2 H N N 405 SER HB3 H N N 406 SER HG H N N 407 SER HXT H N N 408 THR N N N N 409 THR CA C N S 410 THR C C N N 411 THR O O N N 412 THR CB C N R 413 THR OG1 O N N 414 THR CG2 C N N 415 THR OXT O N N 416 THR H H N N 417 THR H2 H N N 418 THR HA H N N 419 THR HB H N N 420 THR HG1 H N N 421 THR HG21 H N N 422 THR HG22 H N N 423 THR HG23 H N N 424 THR HXT H N N 425 TRP N N N N 426 TRP CA C N S 427 TRP C C N N 428 TRP O O N N 429 TRP CB C N N 430 TRP CG C Y N 431 TRP CD1 C Y N 432 TRP CD2 C Y N 433 TRP NE1 N Y N 434 TRP CE2 C Y N 435 TRP CE3 C Y N 436 TRP CZ2 C Y N 437 TRP CZ3 C Y N 438 TRP CH2 C Y N 439 TRP OXT O N N 440 TRP H H N N 441 TRP H2 H N N 442 TRP HA H N N 443 TRP HB2 H N N 444 TRP HB3 H N N 445 TRP HD1 H N N 446 TRP HE1 H N N 447 TRP HE3 H N N 448 TRP HZ2 H N N 449 TRP HZ3 H N N 450 TRP HH2 H N N 451 TRP HXT H N N 452 TYR N N N N 453 TYR CA C N S 454 TYR C C N N 455 TYR O O N N 456 TYR CB C N N 457 TYR CG C Y N 458 TYR CD1 C Y N 459 TYR CD2 C Y N 460 TYR CE1 C Y N 461 TYR CE2 C Y N 462 TYR CZ C Y N 463 TYR OH O N N 464 TYR OXT O N N 465 TYR H H N N 466 TYR H2 H N N 467 TYR HA H N N 468 TYR HB2 H N N 469 TYR HB3 H N N 470 TYR HD1 H N N 471 TYR HD2 H N N 472 TYR HE1 H N N 473 TYR HE2 H N N 474 TYR HH H N N 475 TYR HXT H N N 476 VAL N N N N 477 VAL CA C N S 478 VAL C C N N 479 VAL O O N N 480 VAL CB C N N 481 VAL CG1 C N N 482 VAL CG2 C N N 483 VAL OXT O N N 484 VAL H H N N 485 VAL H2 H N N 486 VAL HA H N N 487 VAL HB H N N 488 VAL HG11 H N N 489 VAL HG12 H N N 490 VAL HG13 H N N 491 VAL HG21 H N N 492 VAL HG22 H N N 493 VAL HG23 H N N 494 VAL HXT H N N 495 W5V C11 C N N 496 W5V C12 C N N 497 W5V C14 C N N 498 W5V C17 C N N 499 W5V C19 C Y N 500 W5V C20 C Y N 501 W5V C01 C N N 502 W5V C03 C Y N 503 W5V C04 C Y N 504 W5V C05 C Y N 505 W5V C06 C N N 506 W5V C07 C N N 507 W5V C09 C N N 508 W5V C22 C Y N 509 W5V C23 C Y N 510 W5V C24 C Y N 511 W5V C25 C Y N 512 W5V C27 C Y N 513 W5V C28 C Y N 514 W5V F21 F N N 515 W5V F26 F N N 516 W5V N08 N N N 517 W5V N16 N N N 518 W5V N18 N N N 519 W5V N29 N Y N 520 W5V O02 O N N 521 W5V O10 O N N 522 W5V O13 O N N 523 W5V O15 O N N 524 W5V H1 H N N 525 W5V H2 H N N 526 W5V H3 H N N 527 W5V H4 H N N 528 W5V H5 H N N 529 W5V H6 H N N 530 W5V H7 H N N 531 W5V H8 H N N 532 W5V H9 H N N 533 W5V H10 H N N 534 W5V H11 H N N 535 W5V H12 H N N 536 W5V H13 H N N 537 W5V H14 H N N 538 W5V H15 H N N 539 W5V H16 H N N 540 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 QQ4 C21 C20 sing N N 277 QQ4 C21 N02 sing N N 278 QQ4 C20 C19 sing N N 279 QQ4 C19 C42 sing N N 280 QQ4 N02 C12 sing N N 281 QQ4 N02 C42 sing N N 282 QQ4 C12 C11 sing N N 283 QQ4 C42 O05 doub N N 284 QQ4 C38 C41 sing N N 285 QQ4 C38 N07 sing N N 286 QQ4 C41 C40 sing N N 287 QQ4 C10 C09 sing N N 288 QQ4 C11 C01 sing N N 289 QQ4 C40 C39 sing N N 290 QQ4 N07 C09 sing N N 291 QQ4 N07 C39 sing N N 292 QQ4 C01 C02 sing N N 293 QQ4 C01 N03 sing N N 294 QQ4 C08 C09 sing N N 295 QQ4 C08 C07 sing N N 296 QQ4 C02 C03 sing N N 297 QQ4 C39 O07 doub N N 298 QQ4 C26 C27 sing N N 299 QQ4 C26 N04 sing N N 300 QQ4 C22 N03 sing N N 301 QQ4 C22 C25 sing N N 302 QQ4 N03 C23 sing N N 303 QQ4 C06 C07 sing N N 304 QQ4 C06 C05 sing N N 305 QQ4 C07 N06 sing N N 306 QQ4 C27 C28 sing N N 307 QQ4 C03 N04 sing N N 308 QQ4 C03 C04 sing N N 309 QQ4 C25 C24 sing N N 310 QQ4 N04 C29 sing N N 311 QQ4 C04 C05 sing N N 312 QQ4 O04 C30 doub N N 313 QQ4 C23 O02 doub N N 314 QQ4 C23 C24 sing N N 315 QQ4 C05 N05 sing N N 316 QQ4 N06 C34 sing N N 317 QQ4 N06 C37 sing N N 318 QQ4 C34 C35 sing N N 319 QQ4 C28 C29 sing N N 320 QQ4 C29 O03 doub N N 321 QQ4 C30 N05 sing N N 322 QQ4 C30 C31 sing N N 323 QQ4 N05 C33 sing N N 324 QQ4 C37 O06 doub N N 325 QQ4 C37 C36 sing N N 326 QQ4 C35 C36 sing N N 327 QQ4 C31 C32 sing N N 328 QQ4 C33 C32 sing N N 329 QQ4 C12 H1 sing N N 330 QQ4 C12 H2 sing N N 331 QQ4 C11 H3 sing N N 332 QQ4 C11 H4 sing N N 333 QQ4 C10 H5 sing N N 334 QQ4 C10 H6 sing N N 335 QQ4 C10 H7 sing N N 336 QQ4 C01 H8 sing N N 337 QQ4 C02 H9 sing N N 338 QQ4 C02 H10 sing N N 339 QQ4 C03 H11 sing N N 340 QQ4 C04 H12 sing N N 341 QQ4 C04 H13 sing N N 342 QQ4 C05 H14 sing N N 343 QQ4 C06 H15 sing N N 344 QQ4 C06 H16 sing N N 345 QQ4 C07 H17 sing N N 346 QQ4 C08 H18 sing N N 347 QQ4 C08 H19 sing N N 348 QQ4 C09 H20 sing N N 349 QQ4 C19 H21 sing N N 350 QQ4 C19 H22 sing N N 351 QQ4 C20 H23 sing N N 352 QQ4 C20 H24 sing N N 353 QQ4 C21 H25 sing N N 354 QQ4 C21 H26 sing N N 355 QQ4 C22 H27 sing N N 356 QQ4 C22 H28 sing N N 357 QQ4 C24 H29 sing N N 358 QQ4 C24 H30 sing N N 359 QQ4 C25 H31 sing N N 360 QQ4 C25 H32 sing N N 361 QQ4 C26 H33 sing N N 362 QQ4 C26 H34 sing N N 363 QQ4 C27 H35 sing N N 364 QQ4 C27 H36 sing N N 365 QQ4 C28 H37 sing N N 366 QQ4 C28 H38 sing N N 367 QQ4 C31 H39 sing N N 368 QQ4 C31 H40 sing N N 369 QQ4 C32 H41 sing N N 370 QQ4 C32 H42 sing N N 371 QQ4 C33 H43 sing N N 372 QQ4 C33 H44 sing N N 373 QQ4 C34 H45 sing N N 374 QQ4 C34 H46 sing N N 375 QQ4 C35 H47 sing N N 376 QQ4 C35 H48 sing N N 377 QQ4 C36 H49 sing N N 378 QQ4 C36 H50 sing N N 379 QQ4 C38 H51 sing N N 380 QQ4 C38 H52 sing N N 381 QQ4 C40 H53 sing N N 382 QQ4 C40 H54 sing N N 383 QQ4 C41 H55 sing N N 384 QQ4 C41 H56 sing N N 385 SER N CA sing N N 386 SER N H sing N N 387 SER N H2 sing N N 388 SER CA C sing N N 389 SER CA CB sing N N 390 SER CA HA sing N N 391 SER C O doub N N 392 SER C OXT sing N N 393 SER CB OG sing N N 394 SER CB HB2 sing N N 395 SER CB HB3 sing N N 396 SER OG HG sing N N 397 SER OXT HXT sing N N 398 THR N CA sing N N 399 THR N H sing N N 400 THR N H2 sing N N 401 THR CA C sing N N 402 THR CA CB sing N N 403 THR CA HA sing N N 404 THR C O doub N N 405 THR C OXT sing N N 406 THR CB OG1 sing N N 407 THR CB CG2 sing N N 408 THR CB HB sing N N 409 THR OG1 HG1 sing N N 410 THR CG2 HG21 sing N N 411 THR CG2 HG22 sing N N 412 THR CG2 HG23 sing N N 413 THR OXT HXT sing N N 414 TRP N CA sing N N 415 TRP N H sing N N 416 TRP N H2 sing N N 417 TRP CA C sing N N 418 TRP CA CB sing N N 419 TRP CA HA sing N N 420 TRP C O doub N N 421 TRP C OXT sing N N 422 TRP CB CG sing N N 423 TRP CB HB2 sing N N 424 TRP CB HB3 sing N N 425 TRP CG CD1 doub Y N 426 TRP CG CD2 sing Y N 427 TRP CD1 NE1 sing Y N 428 TRP CD1 HD1 sing N N 429 TRP CD2 CE2 doub Y N 430 TRP CD2 CE3 sing Y N 431 TRP NE1 CE2 sing Y N 432 TRP NE1 HE1 sing N N 433 TRP CE2 CZ2 sing Y N 434 TRP CE3 CZ3 doub Y N 435 TRP CE3 HE3 sing N N 436 TRP CZ2 CH2 doub Y N 437 TRP CZ2 HZ2 sing N N 438 TRP CZ3 CH2 sing Y N 439 TRP CZ3 HZ3 sing N N 440 TRP CH2 HH2 sing N N 441 TRP OXT HXT sing N N 442 TYR N CA sing N N 443 TYR N H sing N N 444 TYR N H2 sing N N 445 TYR CA C sing N N 446 TYR CA CB sing N N 447 TYR CA HA sing N N 448 TYR C O doub N N 449 TYR C OXT sing N N 450 TYR CB CG sing N N 451 TYR CB HB2 sing N N 452 TYR CB HB3 sing N N 453 TYR CG CD1 doub Y N 454 TYR CG CD2 sing Y N 455 TYR CD1 CE1 sing Y N 456 TYR CD1 HD1 sing N N 457 TYR CD2 CE2 doub Y N 458 TYR CD2 HD2 sing N N 459 TYR CE1 CZ doub Y N 460 TYR CE1 HE1 sing N N 461 TYR CE2 CZ sing Y N 462 TYR CE2 HE2 sing N N 463 TYR CZ OH sing N N 464 TYR OH HH sing N N 465 TYR OXT HXT sing N N 466 VAL N CA sing N N 467 VAL N H sing N N 468 VAL N H2 sing N N 469 VAL CA C sing N N 470 VAL CA CB sing N N 471 VAL CA HA sing N N 472 VAL C O doub N N 473 VAL C OXT sing N N 474 VAL CB CG1 sing N N 475 VAL CB CG2 sing N N 476 VAL CB HB sing N N 477 VAL CG1 HG11 sing N N 478 VAL CG1 HG12 sing N N 479 VAL CG1 HG13 sing N N 480 VAL CG2 HG21 sing N N 481 VAL CG2 HG22 sing N N 482 VAL CG2 HG23 sing N N 483 VAL OXT HXT sing N N 484 W5V C28 N29 doub Y N 485 W5V C28 C27 sing Y N 486 W5V N29 C03 sing Y N 487 W5V C27 C05 doub Y N 488 W5V C01 O02 sing N N 489 W5V C03 O02 sing N N 490 W5V C03 C04 doub Y N 491 W5V C05 C04 sing Y N 492 W5V C05 C06 sing N N 493 W5V C06 C07 sing N N 494 W5V C24 C23 doub Y N 495 W5V C24 C25 sing Y N 496 W5V C23 C22 sing Y N 497 W5V C07 N08 sing N N 498 W5V F26 C25 sing N N 499 W5V C25 C19 doub Y N 500 W5V C22 C20 doub Y N 501 W5V N08 C09 sing N N 502 W5V C19 C20 sing Y N 503 W5V C19 C17 sing N N 504 W5V C20 F21 sing N N 505 W5V N18 C17 sing N N 506 W5V N18 C11 sing N N 507 W5V C17 N16 doub N N 508 W5V C09 C11 sing N N 509 W5V C09 O10 doub N N 510 W5V C11 C12 doub N N 511 W5V N16 C14 sing N N 512 W5V C12 C14 sing N N 513 W5V C12 O13 sing N N 514 W5V C14 O15 doub N N 515 W5V C01 H1 sing N N 516 W5V C01 H2 sing N N 517 W5V C01 H3 sing N N 518 W5V C04 H4 sing N N 519 W5V C06 H5 sing N N 520 W5V C06 H6 sing N N 521 W5V C07 H7 sing N N 522 W5V C07 H8 sing N N 523 W5V C22 H9 sing N N 524 W5V C23 H10 sing N N 525 W5V C24 H11 sing N N 526 W5V C27 H12 sing N N 527 W5V C28 H13 sing N N 528 W5V N08 H14 sing N N 529 W5V N18 H15 sing N N 530 W5V O13 H16 sing N N 531 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id W5V _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id W5V _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'Hexa Vinylpyrrolidone K15' QQ4 3 'MANGANESE (II) ION' MN 4 '2-(2,6-difluorophenyl)-5-hydroxy-N-[2-(2-methoxypyridin-4-yl)ethyl]-6-oxo-3,6-dihydropyrimidine-4-carboxamide' W5V 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5VPT _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'I 4 2 2' _space_group.name_Hall 'I 4 2' _space_group.IT_number 97 _space_group.crystal_system tetragonal _space_group.id 1 #