data_7KLZ # _entry.id 7KLZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7KLZ pdb_00007klz 10.2210/pdb7klz/pdb WWPDB D_1000252694 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-08-18 2 'Structure model' 1 1 2021-12-22 3 'Structure model' 1 2 2023-10-18 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' struct_ncs_dom_lim 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 13 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 14 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 15 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 16 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 17 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 18 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 19 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' 20 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7KLZ _pdbx_database_status.recvd_initial_deposition_date 2020-11-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cui, G.' 1 ? 'Botuyan, M.V.' 2 0000-0002-6466-7432 'Mer, G.' 3 0000-0002-1900-1578 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 5779 _citation.page_last 5779 _citation.title ;SPOP mutation induces replication over-firing by impairing Geminin ubiquitination and triggers replication catastrophe upon ATR inhibition. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-26049-6 _citation.pdbx_database_id_PubMed 34599168 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, J.' 1 ? primary 'Shi, Q.' 2 ? primary 'Cui, G.' 3 ? primary 'Sheng, H.' 4 ? primary 'Botuyan, M.V.' 5 0000-0002-6466-7432 primary 'Zhou, Y.' 6 ? primary 'Yan, Y.' 7 ? primary 'He, Y.' 8 ? primary 'Wang, L.' 9 0000-0003-2072-4826 primary 'Wang, Y.' 10 0000-0002-9749-8591 primary 'Mer, G.' 11 0000-0002-1900-1578 primary 'Ye, D.' 12 ? primary 'Wang, C.' 13 0000-0002-5752-6439 primary 'Huang, H.' 14 0000-0003-2751-6413 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Speckle-type POZ protein' 16434.949 2 ? D140G 'MATH domain' ? 2 polymer syn 'Geminin peptide' 1450.569 2 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HIB homolog 1,Roadkill homolog 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPGHMVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFK FSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGFLLDEANGLLPDDKLTLFCEVSVVQD ; ;GPGHMVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFK FSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGFLLDEANGLLPDDKLTLFCEVSVVQD ; A,B ? 2 'polypeptide(L)' no no AEGTVSSSTDALPCI AEGTVSSSTDALPCI C,D ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'PHOSPHATE ION' _pdbx_entity_nonpoly.comp_id PO4 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 HIS n 1 5 MET n 1 6 VAL n 1 7 VAL n 1 8 LYS n 1 9 PHE n 1 10 SER n 1 11 TYR n 1 12 MET n 1 13 TRP n 1 14 THR n 1 15 ILE n 1 16 ASN n 1 17 ASN n 1 18 PHE n 1 19 SER n 1 20 PHE n 1 21 CYS n 1 22 ARG n 1 23 GLU n 1 24 GLU n 1 25 MET n 1 26 GLY n 1 27 GLU n 1 28 VAL n 1 29 ILE n 1 30 LYS n 1 31 SER n 1 32 SER n 1 33 THR n 1 34 PHE n 1 35 SER n 1 36 SER n 1 37 GLY n 1 38 ALA n 1 39 ASN n 1 40 ASP n 1 41 LYS n 1 42 LEU n 1 43 LYS n 1 44 TRP n 1 45 CYS n 1 46 LEU n 1 47 ARG n 1 48 VAL n 1 49 ASN n 1 50 PRO n 1 51 LYS n 1 52 GLY n 1 53 LEU n 1 54 ASP n 1 55 GLU n 1 56 GLU n 1 57 SER n 1 58 LYS n 1 59 ASP n 1 60 TYR n 1 61 LEU n 1 62 SER n 1 63 LEU n 1 64 TYR n 1 65 LEU n 1 66 LEU n 1 67 LEU n 1 68 VAL n 1 69 SER n 1 70 CYS n 1 71 PRO n 1 72 LYS n 1 73 SER n 1 74 GLU n 1 75 VAL n 1 76 ARG n 1 77 ALA n 1 78 LYS n 1 79 PHE n 1 80 LYS n 1 81 PHE n 1 82 SER n 1 83 ILE n 1 84 LEU n 1 85 ASN n 1 86 ALA n 1 87 LYS n 1 88 GLY n 1 89 GLU n 1 90 GLU n 1 91 THR n 1 92 LYS n 1 93 ALA n 1 94 MET n 1 95 GLU n 1 96 SER n 1 97 GLN n 1 98 ARG n 1 99 ALA n 1 100 TYR n 1 101 ARG n 1 102 PHE n 1 103 VAL n 1 104 GLN n 1 105 GLY n 1 106 LYS n 1 107 ASP n 1 108 TRP n 1 109 GLY n 1 110 PHE n 1 111 LYS n 1 112 LYS n 1 113 PHE n 1 114 ILE n 1 115 ARG n 1 116 ARG n 1 117 GLY n 1 118 PHE n 1 119 LEU n 1 120 LEU n 1 121 ASP n 1 122 GLU n 1 123 ALA n 1 124 ASN n 1 125 GLY n 1 126 LEU n 1 127 LEU n 1 128 PRO n 1 129 ASP n 1 130 ASP n 1 131 LYS n 1 132 LEU n 1 133 THR n 1 134 LEU n 1 135 PHE n 1 136 CYS n 1 137 GLU n 1 138 VAL n 1 139 SER n 1 140 VAL n 1 141 VAL n 1 142 GLN n 1 143 ASP n 2 1 ALA n 2 2 GLU n 2 3 GLY n 2 4 THR n 2 5 VAL n 2 6 SER n 2 7 SER n 2 8 SER n 2 9 THR n 2 10 ASP n 2 11 ALA n 2 12 LEU n 2 13 PRO n 2 14 CYS n 2 15 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 143 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SPOP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 24 ? ? ? A . n A 1 2 PRO 2 25 ? ? ? A . n A 1 3 GLY 3 26 ? ? ? A . n A 1 4 HIS 4 27 ? ? ? A . n A 1 5 MET 5 28 28 MET MET A . n A 1 6 VAL 6 29 29 VAL VAL A . n A 1 7 VAL 7 30 30 VAL VAL A . n A 1 8 LYS 8 31 31 LYS LYS A . n A 1 9 PHE 9 32 32 PHE PHE A . n A 1 10 SER 10 33 33 SER SER A . n A 1 11 TYR 11 34 34 TYR TYR A . n A 1 12 MET 12 35 35 MET MET A . n A 1 13 TRP 13 36 36 TRP TRP A . n A 1 14 THR 14 37 37 THR THR A . n A 1 15 ILE 15 38 38 ILE ILE A . n A 1 16 ASN 16 39 39 ASN ASN A . n A 1 17 ASN 17 40 40 ASN ASN A . n A 1 18 PHE 18 41 41 PHE PHE A . n A 1 19 SER 19 42 42 SER SER A . n A 1 20 PHE 20 43 43 PHE PHE A . n A 1 21 CYS 21 44 44 CYS CYS A . n A 1 22 ARG 22 45 45 ARG ARG A . n A 1 23 GLU 23 46 46 GLU GLU A . n A 1 24 GLU 24 47 47 GLU GLU A . n A 1 25 MET 25 48 48 MET MET A . n A 1 26 GLY 26 49 49 GLY GLY A . n A 1 27 GLU 27 50 50 GLU GLU A . n A 1 28 VAL 28 51 51 VAL VAL A . n A 1 29 ILE 29 52 52 ILE ILE A . n A 1 30 LYS 30 53 53 LYS LYS A . n A 1 31 SER 31 54 54 SER SER A . n A 1 32 SER 32 55 55 SER SER A . n A 1 33 THR 33 56 56 THR THR A . n A 1 34 PHE 34 57 57 PHE PHE A . n A 1 35 SER 35 58 58 SER SER A . n A 1 36 SER 36 59 59 SER SER A . n A 1 37 GLY 37 60 60 GLY GLY A . n A 1 38 ALA 38 61 61 ALA ALA A . n A 1 39 ASN 39 62 62 ASN ASN A . n A 1 40 ASP 40 63 63 ASP ASP A . n A 1 41 LYS 41 64 64 LYS LYS A . n A 1 42 LEU 42 65 65 LEU LEU A . n A 1 43 LYS 43 66 66 LYS LYS A . n A 1 44 TRP 44 67 67 TRP TRP A . n A 1 45 CYS 45 68 68 CYS CYS A . n A 1 46 LEU 46 69 69 LEU LEU A . n A 1 47 ARG 47 70 70 ARG ARG A . n A 1 48 VAL 48 71 71 VAL VAL A . n A 1 49 ASN 49 72 72 ASN ASN A . n A 1 50 PRO 50 73 73 PRO PRO A . n A 1 51 LYS 51 74 74 LYS LYS A . n A 1 52 GLY 52 75 75 GLY GLY A . n A 1 53 LEU 53 76 76 LEU LEU A . n A 1 54 ASP 54 77 77 ASP ASP A . n A 1 55 GLU 55 78 78 GLU GLU A . n A 1 56 GLU 56 79 79 GLU GLU A . n A 1 57 SER 57 80 80 SER SER A . n A 1 58 LYS 58 81 81 LYS LYS A . n A 1 59 ASP 59 82 82 ASP ASP A . n A 1 60 TYR 60 83 83 TYR TYR A . n A 1 61 LEU 61 84 84 LEU LEU A . n A 1 62 SER 62 85 85 SER SER A . n A 1 63 LEU 63 86 86 LEU LEU A . n A 1 64 TYR 64 87 87 TYR TYR A . n A 1 65 LEU 65 88 88 LEU LEU A . n A 1 66 LEU 66 89 89 LEU LEU A . n A 1 67 LEU 67 90 90 LEU LEU A . n A 1 68 VAL 68 91 91 VAL VAL A . n A 1 69 SER 69 92 92 SER SER A . n A 1 70 CYS 70 93 93 CYS CYS A . n A 1 71 PRO 71 94 94 PRO PRO A . n A 1 72 LYS 72 95 95 LYS LYS A . n A 1 73 SER 73 96 96 SER SER A . n A 1 74 GLU 74 97 97 GLU GLU A . n A 1 75 VAL 75 98 98 VAL VAL A . n A 1 76 ARG 76 99 99 ARG ARG A . n A 1 77 ALA 77 100 100 ALA ALA A . n A 1 78 LYS 78 101 101 LYS LYS A . n A 1 79 PHE 79 102 102 PHE PHE A . n A 1 80 LYS 80 103 103 LYS LYS A . n A 1 81 PHE 81 104 104 PHE PHE A . n A 1 82 SER 82 105 105 SER SER A . n A 1 83 ILE 83 106 106 ILE ILE A . n A 1 84 LEU 84 107 107 LEU LEU A . n A 1 85 ASN 85 108 108 ASN ASN A . n A 1 86 ALA 86 109 109 ALA ALA A . n A 1 87 LYS 87 110 110 LYS LYS A . n A 1 88 GLY 88 111 111 GLY GLY A . n A 1 89 GLU 89 112 112 GLU GLU A . n A 1 90 GLU 90 113 113 GLU GLU A . n A 1 91 THR 91 114 114 THR THR A . n A 1 92 LYS 92 115 115 LYS LYS A . n A 1 93 ALA 93 116 116 ALA ALA A . n A 1 94 MET 94 117 117 MET MET A . n A 1 95 GLU 95 118 118 GLU GLU A . n A 1 96 SER 96 119 119 SER SER A . n A 1 97 GLN 97 120 120 GLN GLN A . n A 1 98 ARG 98 121 121 ARG ARG A . n A 1 99 ALA 99 122 122 ALA ALA A . n A 1 100 TYR 100 123 123 TYR TYR A . n A 1 101 ARG 101 124 124 ARG ARG A . n A 1 102 PHE 102 125 125 PHE PHE A . n A 1 103 VAL 103 126 126 VAL VAL A . n A 1 104 GLN 104 127 127 GLN GLN A . n A 1 105 GLY 105 128 128 GLY GLY A . n A 1 106 LYS 106 129 129 LYS LYS A . n A 1 107 ASP 107 130 130 ASP ASP A . n A 1 108 TRP 108 131 131 TRP TRP A . n A 1 109 GLY 109 132 132 GLY GLY A . n A 1 110 PHE 110 133 133 PHE PHE A . n A 1 111 LYS 111 134 134 LYS LYS A . n A 1 112 LYS 112 135 135 LYS LYS A . n A 1 113 PHE 113 136 136 PHE PHE A . n A 1 114 ILE 114 137 137 ILE ILE A . n A 1 115 ARG 115 138 138 ARG ARG A . n A 1 116 ARG 116 139 139 ARG ARG A . n A 1 117 GLY 117 140 140 GLY GLY A . n A 1 118 PHE 118 141 141 PHE PHE A . n A 1 119 LEU 119 142 142 LEU LEU A . n A 1 120 LEU 120 143 143 LEU LEU A . n A 1 121 ASP 121 144 144 ASP ASP A . n A 1 122 GLU 122 145 145 GLU GLU A . n A 1 123 ALA 123 146 146 ALA ALA A . n A 1 124 ASN 124 147 147 ASN ASN A . n A 1 125 GLY 125 148 148 GLY GLY A . n A 1 126 LEU 126 149 149 LEU LEU A . n A 1 127 LEU 127 150 150 LEU LEU A . n A 1 128 PRO 128 151 151 PRO PRO A . n A 1 129 ASP 129 152 152 ASP ASP A . n A 1 130 ASP 130 153 153 ASP ASP A . n A 1 131 LYS 131 154 154 LYS LYS A . n A 1 132 LEU 132 155 155 LEU LEU A . n A 1 133 THR 133 156 156 THR THR A . n A 1 134 LEU 134 157 157 LEU LEU A . n A 1 135 PHE 135 158 158 PHE PHE A . n A 1 136 CYS 136 159 159 CYS CYS A . n A 1 137 GLU 137 160 160 GLU GLU A . n A 1 138 VAL 138 161 161 VAL VAL A . n A 1 139 SER 139 162 162 SER SER A . n A 1 140 VAL 140 163 163 VAL VAL A . n A 1 141 VAL 141 164 164 VAL VAL A . n A 1 142 GLN 142 165 165 GLN GLN A . n A 1 143 ASP 143 166 ? ? ? A . n B 1 1 GLY 1 24 ? ? ? B . n B 1 2 PRO 2 25 ? ? ? B . n B 1 3 GLY 3 26 ? ? ? B . n B 1 4 HIS 4 27 27 HIS HIS B . n B 1 5 MET 5 28 28 MET MET B . n B 1 6 VAL 6 29 29 VAL VAL B . n B 1 7 VAL 7 30 30 VAL VAL B . n B 1 8 LYS 8 31 31 LYS LYS B . n B 1 9 PHE 9 32 32 PHE PHE B . n B 1 10 SER 10 33 33 SER SER B . n B 1 11 TYR 11 34 34 TYR TYR B . n B 1 12 MET 12 35 35 MET MET B . n B 1 13 TRP 13 36 36 TRP TRP B . n B 1 14 THR 14 37 37 THR THR B . n B 1 15 ILE 15 38 38 ILE ILE B . n B 1 16 ASN 16 39 39 ASN ASN B . n B 1 17 ASN 17 40 40 ASN ASN B . n B 1 18 PHE 18 41 41 PHE PHE B . n B 1 19 SER 19 42 42 SER SER B . n B 1 20 PHE 20 43 43 PHE PHE B . n B 1 21 CYS 21 44 44 CYS CYS B . n B 1 22 ARG 22 45 45 ARG ARG B . n B 1 23 GLU 23 46 46 GLU GLU B . n B 1 24 GLU 24 47 47 GLU GLU B . n B 1 25 MET 25 48 48 MET MET B . n B 1 26 GLY 26 49 49 GLY GLY B . n B 1 27 GLU 27 50 50 GLU GLU B . n B 1 28 VAL 28 51 51 VAL VAL B . n B 1 29 ILE 29 52 52 ILE ILE B . n B 1 30 LYS 30 53 53 LYS LYS B . n B 1 31 SER 31 54 54 SER SER B . n B 1 32 SER 32 55 55 SER SER B . n B 1 33 THR 33 56 56 THR THR B . n B 1 34 PHE 34 57 57 PHE PHE B . n B 1 35 SER 35 58 58 SER SER B . n B 1 36 SER 36 59 59 SER SER B . n B 1 37 GLY 37 60 60 GLY GLY B . n B 1 38 ALA 38 61 61 ALA ALA B . n B 1 39 ASN 39 62 62 ASN ASN B . n B 1 40 ASP 40 63 63 ASP ASP B . n B 1 41 LYS 41 64 64 LYS LYS B . n B 1 42 LEU 42 65 65 LEU LEU B . n B 1 43 LYS 43 66 66 LYS LYS B . n B 1 44 TRP 44 67 67 TRP TRP B . n B 1 45 CYS 45 68 68 CYS CYS B . n B 1 46 LEU 46 69 69 LEU LEU B . n B 1 47 ARG 47 70 70 ARG ARG B . n B 1 48 VAL 48 71 71 VAL VAL B . n B 1 49 ASN 49 72 72 ASN ASN B . n B 1 50 PRO 50 73 73 PRO PRO B . n B 1 51 LYS 51 74 74 LYS LYS B . n B 1 52 GLY 52 75 75 GLY GLY B . n B 1 53 LEU 53 76 76 LEU LEU B . n B 1 54 ASP 54 77 77 ASP ASP B . n B 1 55 GLU 55 78 78 GLU GLU B . n B 1 56 GLU 56 79 79 GLU GLU B . n B 1 57 SER 57 80 80 SER SER B . n B 1 58 LYS 58 81 81 LYS LYS B . n B 1 59 ASP 59 82 82 ASP ASP B . n B 1 60 TYR 60 83 83 TYR TYR B . n B 1 61 LEU 61 84 84 LEU LEU B . n B 1 62 SER 62 85 85 SER SER B . n B 1 63 LEU 63 86 86 LEU LEU B . n B 1 64 TYR 64 87 87 TYR TYR B . n B 1 65 LEU 65 88 88 LEU LEU B . n B 1 66 LEU 66 89 89 LEU LEU B . n B 1 67 LEU 67 90 90 LEU LEU B . n B 1 68 VAL 68 91 91 VAL VAL B . n B 1 69 SER 69 92 92 SER SER B . n B 1 70 CYS 70 93 93 CYS CYS B . n B 1 71 PRO 71 94 94 PRO PRO B . n B 1 72 LYS 72 95 95 LYS LYS B . n B 1 73 SER 73 96 96 SER SER B . n B 1 74 GLU 74 97 97 GLU GLU B . n B 1 75 VAL 75 98 98 VAL VAL B . n B 1 76 ARG 76 99 99 ARG ARG B . n B 1 77 ALA 77 100 100 ALA ALA B . n B 1 78 LYS 78 101 101 LYS LYS B . n B 1 79 PHE 79 102 102 PHE PHE B . n B 1 80 LYS 80 103 103 LYS LYS B . n B 1 81 PHE 81 104 104 PHE PHE B . n B 1 82 SER 82 105 105 SER SER B . n B 1 83 ILE 83 106 106 ILE ILE B . n B 1 84 LEU 84 107 107 LEU LEU B . n B 1 85 ASN 85 108 108 ASN ASN B . n B 1 86 ALA 86 109 109 ALA ALA B . n B 1 87 LYS 87 110 110 LYS LYS B . n B 1 88 GLY 88 111 111 GLY GLY B . n B 1 89 GLU 89 112 112 GLU GLU B . n B 1 90 GLU 90 113 113 GLU GLU B . n B 1 91 THR 91 114 114 THR THR B . n B 1 92 LYS 92 115 115 LYS LYS B . n B 1 93 ALA 93 116 116 ALA ALA B . n B 1 94 MET 94 117 117 MET MET B . n B 1 95 GLU 95 118 118 GLU GLU B . n B 1 96 SER 96 119 119 SER SER B . n B 1 97 GLN 97 120 120 GLN GLN B . n B 1 98 ARG 98 121 121 ARG ARG B . n B 1 99 ALA 99 122 122 ALA ALA B . n B 1 100 TYR 100 123 123 TYR TYR B . n B 1 101 ARG 101 124 124 ARG ARG B . n B 1 102 PHE 102 125 125 PHE PHE B . n B 1 103 VAL 103 126 126 VAL VAL B . n B 1 104 GLN 104 127 127 GLN GLN B . n B 1 105 GLY 105 128 128 GLY GLY B . n B 1 106 LYS 106 129 129 LYS LYS B . n B 1 107 ASP 107 130 130 ASP ASP B . n B 1 108 TRP 108 131 131 TRP TRP B . n B 1 109 GLY 109 132 132 GLY GLY B . n B 1 110 PHE 110 133 133 PHE PHE B . n B 1 111 LYS 111 134 134 LYS LYS B . n B 1 112 LYS 112 135 135 LYS LYS B . n B 1 113 PHE 113 136 136 PHE PHE B . n B 1 114 ILE 114 137 137 ILE ILE B . n B 1 115 ARG 115 138 138 ARG ARG B . n B 1 116 ARG 116 139 139 ARG ARG B . n B 1 117 GLY 117 140 140 GLY GLY B . n B 1 118 PHE 118 141 141 PHE PHE B . n B 1 119 LEU 119 142 142 LEU LEU B . n B 1 120 LEU 120 143 143 LEU LEU B . n B 1 121 ASP 121 144 144 ASP ASP B . n B 1 122 GLU 122 145 145 GLU GLU B . n B 1 123 ALA 123 146 146 ALA ALA B . n B 1 124 ASN 124 147 147 ASN ASN B . n B 1 125 GLY 125 148 148 GLY GLY B . n B 1 126 LEU 126 149 149 LEU LEU B . n B 1 127 LEU 127 150 150 LEU LEU B . n B 1 128 PRO 128 151 151 PRO PRO B . n B 1 129 ASP 129 152 152 ASP ASP B . n B 1 130 ASP 130 153 153 ASP ASP B . n B 1 131 LYS 131 154 154 LYS LYS B . n B 1 132 LEU 132 155 155 LEU LEU B . n B 1 133 THR 133 156 156 THR THR B . n B 1 134 LEU 134 157 157 LEU LEU B . n B 1 135 PHE 135 158 158 PHE PHE B . n B 1 136 CYS 136 159 159 CYS CYS B . n B 1 137 GLU 137 160 160 GLU GLU B . n B 1 138 VAL 138 161 161 VAL VAL B . n B 1 139 SER 139 162 162 SER SER B . n B 1 140 VAL 140 163 163 VAL VAL B . n B 1 141 VAL 141 164 164 VAL VAL B . n B 1 142 GLN 142 165 165 GLN GLN B . n B 1 143 ASP 143 166 ? ? ? B . n C 2 1 ALA 1 195 ? ? ? C . n C 2 2 GLU 2 196 196 GLU GLU C . n C 2 3 GLY 3 197 197 GLY GLY C . n C 2 4 THR 4 198 198 THR THR C . n C 2 5 VAL 5 199 199 VAL VAL C . n C 2 6 SER 6 200 200 SER SER C . n C 2 7 SER 7 201 201 SER SER C . n C 2 8 SER 8 202 202 SER SER C . n C 2 9 THR 9 203 203 THR THR C . n C 2 10 ASP 10 204 204 ASP ASP C . n C 2 11 ALA 11 205 ? ? ? C . n C 2 12 LEU 12 206 ? ? ? C . n C 2 13 PRO 13 207 ? ? ? C . n C 2 14 CYS 14 208 ? ? ? C . n C 2 15 ILE 15 209 ? ? ? C . n D 2 1 ALA 1 195 ? ? ? D . n D 2 2 GLU 2 196 196 GLU GLU D . n D 2 3 GLY 3 197 197 GLY GLY D . n D 2 4 THR 4 198 198 THR THR D . n D 2 5 VAL 5 199 199 VAL VAL D . n D 2 6 SER 6 200 200 SER SER D . n D 2 7 SER 7 201 201 SER SER D . n D 2 8 SER 8 202 202 SER SER D . n D 2 9 THR 9 203 203 THR THR D . n D 2 10 ASP 10 204 204 ASP ASP D . n D 2 11 ALA 11 205 ? ? ? D . n D 2 12 LEU 12 206 ? ? ? D . n D 2 13 PRO 13 207 ? ? ? D . n D 2 14 CYS 14 208 ? ? ? D . n D 2 15 ILE 15 209 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 PO4 1 201 1 PO4 PO4 A . F 3 PO4 1 202 2 PO4 PO4 A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 62 ? CG ? A ASN 39 CG 2 1 Y 1 A ASN 62 ? OD1 ? A ASN 39 OD1 3 1 Y 1 A ASN 62 ? ND2 ? A ASN 39 ND2 4 1 Y 1 A ASP 63 ? CG ? A ASP 40 CG 5 1 Y 1 A ASP 63 ? OD1 ? A ASP 40 OD1 6 1 Y 1 A ASP 63 ? OD2 ? A ASP 40 OD2 7 1 Y 1 A LYS 74 ? CG ? A LYS 51 CG 8 1 Y 1 A LYS 74 ? CD ? A LYS 51 CD 9 1 Y 1 A LYS 74 ? CE ? A LYS 51 CE 10 1 Y 1 A LYS 74 ? NZ ? A LYS 51 NZ 11 1 Y 1 A LYS 95 ? CG ? A LYS 72 CG 12 1 Y 1 A LYS 95 ? CD ? A LYS 72 CD 13 1 Y 1 A LYS 95 ? CE ? A LYS 72 CE 14 1 Y 1 A LYS 95 ? NZ ? A LYS 72 NZ 15 1 Y 1 A ARG 124 ? CG ? A ARG 101 CG 16 1 Y 1 A ARG 124 ? CD ? A ARG 101 CD 17 1 Y 1 A ARG 124 ? NE ? A ARG 101 NE 18 1 Y 1 A ARG 124 ? CZ ? A ARG 101 CZ 19 1 Y 1 A ARG 124 ? NH1 ? A ARG 101 NH1 20 1 Y 1 A ARG 124 ? NH2 ? A ARG 101 NH2 21 1 Y 1 A GLN 165 ? CG ? A GLN 142 CG 22 1 Y 1 A GLN 165 ? CD ? A GLN 142 CD 23 1 Y 1 A GLN 165 ? OE1 ? A GLN 142 OE1 24 1 Y 1 A GLN 165 ? NE2 ? A GLN 142 NE2 25 1 Y 1 B HIS 27 ? CG ? B HIS 4 CG 26 1 Y 1 B HIS 27 ? ND1 ? B HIS 4 ND1 27 1 Y 1 B HIS 27 ? CD2 ? B HIS 4 CD2 28 1 Y 1 B HIS 27 ? CE1 ? B HIS 4 CE1 29 1 Y 1 B HIS 27 ? NE2 ? B HIS 4 NE2 30 1 Y 1 B MET 28 ? CG ? B MET 5 CG 31 1 Y 1 B MET 28 ? SD ? B MET 5 SD 32 1 Y 1 B MET 28 ? CE ? B MET 5 CE 33 1 Y 1 B ASP 63 ? CG ? B ASP 40 CG 34 1 Y 1 B ASP 63 ? OD1 ? B ASP 40 OD1 35 1 Y 1 B ASP 63 ? OD2 ? B ASP 40 OD2 36 1 Y 1 B LYS 81 ? CG ? B LYS 58 CG 37 1 Y 1 B LYS 81 ? CD ? B LYS 58 CD 38 1 Y 1 B LYS 81 ? CE ? B LYS 58 CE 39 1 Y 1 B LYS 81 ? NZ ? B LYS 58 NZ 40 1 Y 1 B LYS 95 ? CG ? B LYS 72 CG 41 1 Y 1 B LYS 95 ? CD ? B LYS 72 CD 42 1 Y 1 B LYS 95 ? CE ? B LYS 72 CE 43 1 Y 1 B LYS 95 ? NZ ? B LYS 72 NZ 44 1 Y 1 B GLU 97 ? CG ? B GLU 74 CG 45 1 Y 1 B GLU 97 ? CD ? B GLU 74 CD 46 1 Y 1 B GLU 97 ? OE1 ? B GLU 74 OE1 47 1 Y 1 B GLU 97 ? OE2 ? B GLU 74 OE2 48 1 Y 1 B GLN 120 ? CG ? B GLN 97 CG 49 1 Y 1 B GLN 120 ? CD ? B GLN 97 CD 50 1 Y 1 B GLN 120 ? OE1 ? B GLN 97 OE1 51 1 Y 1 B GLN 120 ? NE2 ? B GLN 97 NE2 52 1 Y 1 B ARG 124 ? CG ? B ARG 101 CG 53 1 Y 1 B ARG 124 ? CD ? B ARG 101 CD 54 1 Y 1 B ARG 124 ? NE ? B ARG 101 NE 55 1 Y 1 B ARG 124 ? CZ ? B ARG 101 CZ 56 1 Y 1 B ARG 124 ? NH1 ? B ARG 101 NH1 57 1 Y 1 B ARG 124 ? NH2 ? B ARG 101 NH2 58 1 Y 1 B LYS 129 ? CG ? B LYS 106 CG 59 1 Y 1 B LYS 129 ? CD ? B LYS 106 CD 60 1 Y 1 B LYS 129 ? CE ? B LYS 106 CE 61 1 Y 1 B LYS 129 ? NZ ? B LYS 106 NZ 62 1 Y 1 B LYS 134 ? CG ? B LYS 111 CG 63 1 Y 1 B LYS 134 ? CD ? B LYS 111 CD 64 1 Y 1 B LYS 134 ? CE ? B LYS 111 CE 65 1 Y 1 B LYS 134 ? NZ ? B LYS 111 NZ 66 1 Y 1 B GLU 145 ? CG ? B GLU 122 CG 67 1 Y 1 B GLU 145 ? CD ? B GLU 122 CD 68 1 Y 1 B GLU 145 ? OE1 ? B GLU 122 OE1 69 1 Y 1 B GLU 145 ? OE2 ? B GLU 122 OE2 70 1 Y 1 D GLU 196 ? CG ? D GLU 2 CG 71 1 Y 1 D GLU 196 ? CD ? D GLU 2 CD 72 1 Y 1 D GLU 196 ? OE1 ? D GLU 2 OE1 73 1 Y 1 D GLU 196 ? OE2 ? D GLU 2 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7KLZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.060 _cell.length_a_esd ? _cell.length_b 103.060 _cell.length_b_esd ? _cell.length_c 131.810 _cell.length_c_esd ? _cell.volume 1400001.936 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7KLZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7KLZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.89 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 74.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;One microliter of the protein complex in 20 mM Tris-HCl, pH 7.6, 50 mM NaCl and 5 mM dithiothreitol was mixed with on microliter of 0.2 M ammonium citrate dibasic and 20% (W/V) PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 77.87 _reflns.entry_id 7KLZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.39 _reflns.d_resolution_low 47.99 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10264 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 37.0 _reflns.pdbx_Rmerge_I_obs 0.096 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.24 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.39 _reflns_shell.d_res_low 3.52 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 985 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.27 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 89.27 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7KLZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.40 _refine.ls_d_res_low 47.99 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10264 _refine.ls_number_reflns_R_free 1026 _refine.ls_number_reflns_R_work 9238 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2130 _refine.ls_R_factor_R_free 0.2414 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2098 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.40 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6F8G _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.2103 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4481 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.40 _refine_hist.d_res_low 47.99 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2307 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2297 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0019 ? 2349 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4792 ? 3161 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0389 ? 349 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0029 ? 395 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 1.8538 ? 1395 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.40 3.58 . . 142 1281 100.00 . . . 0.3269 . 0.2798 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.58 3.80 . . 143 1288 100.00 . . . 0.3086 . 0.2436 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.80 4.10 . . 144 1300 100.00 . . . 0.2806 . 0.2385 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.10 4.51 . . 145 1298 99.93 . . . 0.2263 . 0.1867 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.51 5.16 . . 146 1315 100.00 . . . 0.1952 . 0.1595 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.16 6.50 . . 148 1334 100.00 . . . 0.2211 . 0.1927 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.50 47.99 . . 158 1422 99.37 . . . 0.2255 . 0.2194 . . . . . . . . . . . # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? 1 2 ? 2 2 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A MET 5 . A VAL 141 . A MET 28 A VAL 164 ? ;(chain 'A' and ((resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 133 or (resid 134 and (name N or name CA or name C or name O or name CB )) or resid 135 through 144 or (resid 145 through 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 165)) ; 1 2 1 B MET 5 . B VAL 141 . B MET 28 B VAL 164 ? ;(chain 'B' and (resid 28 through 61 or (resid 62 through 63 and (name N or name CA or name C or name O or name CB )) or resid 64 through 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 164 or (resid 165 and (name N or name CA or name C or name O or name CB )))) ; 2 1 1 C GLU 2 . C THR 9 . C GLU 196 C THR 203 ? ;(chain 'C' and ((resid 196 and (name N or name CA or name C or name O or name CB )) or resid 197 through 204)) ; 2 2 1 D GLU 2 . D THR 9 . D GLU 196 D THR 203 ? ;chain 'D' ; # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 7KLZ _struct.title 'Structure of SPOP MATH domain in complex with a Geminin peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7KLZ _struct_keywords.text 'SPOP, Geminin, MATH domain, E3 ubiquitin ligase, DNA damage response, DNA replication, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SPOP_HUMAN O43791 ? 1 ;VVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILN AKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQD ; 29 2 UNP GEMI_HUMAN O75496 ? 2 AEGTVSSSTDAKPCI 195 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7KLZ A 6 ? 143 ? O43791 29 ? 166 ? 29 166 2 1 7KLZ B 6 ? 143 ? O43791 29 ? 166 ? 29 166 3 2 7KLZ C 1 ? 15 ? O75496 195 ? 209 ? 195 209 4 2 7KLZ D 1 ? 15 ? O75496 195 ? 209 ? 195 209 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7KLZ GLY A 1 ? UNP O43791 ? ? 'expression tag' 24 1 1 7KLZ PRO A 2 ? UNP O43791 ? ? 'expression tag' 25 2 1 7KLZ GLY A 3 ? UNP O43791 ? ? 'expression tag' 26 3 1 7KLZ HIS A 4 ? UNP O43791 ? ? 'expression tag' 27 4 1 7KLZ MET A 5 ? UNP O43791 ? ? 'expression tag' 28 5 1 7KLZ GLY A 117 ? UNP O43791 ASP 140 'engineered mutation' 140 6 2 7KLZ GLY B 1 ? UNP O43791 ? ? 'expression tag' 24 7 2 7KLZ PRO B 2 ? UNP O43791 ? ? 'expression tag' 25 8 2 7KLZ GLY B 3 ? UNP O43791 ? ? 'expression tag' 26 9 2 7KLZ HIS B 4 ? UNP O43791 ? ? 'expression tag' 27 10 2 7KLZ MET B 5 ? UNP O43791 ? ? 'expression tag' 28 11 2 7KLZ GLY B 117 ? UNP O43791 ASP 140 'engineered mutation' 140 12 3 7KLZ LEU C 12 ? UNP O75496 LYS 206 conflict 206 13 4 7KLZ LEU D 12 ? UNP O75496 LYS 206 conflict 206 14 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 910 ? 1 MORE -3 ? 1 'SSA (A^2)' 8000 ? 2 'ABSA (A^2)' 830 ? 2 MORE -4 ? 2 'SSA (A^2)' 8020 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E,F 2 1 B,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 21 ? GLY A 26 ? CYS A 44 GLY A 49 1 ? 6 HELX_P HELX_P2 AA2 ARG A 116 ? ASP A 121 ? ARG A 139 ASP A 144 1 ? 6 HELX_P HELX_P3 AA3 LEU A 127 ? ASP A 129 ? LEU A 150 ASP A 152 5 ? 3 HELX_P HELX_P4 AA4 ASP B 54 ? LYS B 58 ? ASP B 77 LYS B 81 5 ? 5 HELX_P HELX_P5 AA5 ARG B 116 ? ASP B 121 ? ARG B 139 ASP B 144 1 ? 6 HELX_P HELX_P6 AA6 LEU B 127 ? ASP B 129 ? LEU B 150 ASP B 152 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 21 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 21 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 44 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 44 _struct_conn.ptnr2_symmetry 6_454 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.030 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 21 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id B _pdbx_modification_feature.modified_residue_label_seq_id 21 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 44 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id B _pdbx_modification_feature.modified_residue_auth_seq_id 44 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 6_454 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 4 ? AA6 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 7 ? ASN A 16 ? VAL A 30 ASN A 39 AA1 2 LYS A 131 ? VAL A 141 ? LYS A 154 VAL A 164 AA1 3 VAL A 75 ? LEU A 84 ? VAL A 98 LEU A 107 AA1 4 GLU A 90 ? GLU A 95 ? GLU A 113 GLU A 118 AA2 1 VAL A 7 ? ASN A 16 ? VAL A 30 ASN A 39 AA2 2 LYS A 131 ? VAL A 141 ? LYS A 154 VAL A 164 AA2 3 VAL A 75 ? LEU A 84 ? VAL A 98 LEU A 107 AA2 4 TYR A 100 ? PHE A 102 ? TYR A 123 PHE A 125 AA3 1 ILE A 29 ? LYS A 30 ? ILE A 52 LYS A 53 AA3 2 TRP A 44 ? ASN A 49 ? TRP A 67 ASN A 72 AA3 3 TYR A 60 ? LEU A 67 ? TYR A 83 LEU A 90 AA3 4 ASP A 107 ? ARG A 115 ? ASP A 130 ARG A 138 AA4 1 MET B 5 ? ASN B 16 ? MET B 28 ASN B 39 AA4 2 LYS B 131 ? GLN B 142 ? LYS B 154 GLN B 165 AA4 3 VAL B 75 ? LEU B 84 ? VAL B 98 LEU B 107 AA4 4 GLU B 90 ? GLU B 95 ? GLU B 113 GLU B 118 AA5 1 MET B 5 ? ASN B 16 ? MET B 28 ASN B 39 AA5 2 LYS B 131 ? GLN B 142 ? LYS B 154 GLN B 165 AA5 3 VAL B 75 ? LEU B 84 ? VAL B 98 LEU B 107 AA5 4 TYR B 100 ? PHE B 102 ? TYR B 123 PHE B 125 AA6 1 ILE B 29 ? LYS B 30 ? ILE B 52 LYS B 53 AA6 2 TRP B 44 ? ASN B 49 ? TRP B 67 ASN B 72 AA6 3 TYR B 60 ? LEU B 67 ? TYR B 83 LEU B 90 AA6 4 ASP B 107 ? ARG B 115 ? ASP B 130 ARG B 138 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 13 ? N TRP A 36 O LEU A 134 ? O LEU A 157 AA1 2 3 O VAL A 141 ? O VAL A 164 N ARG A 76 ? N ARG A 99 AA1 3 4 N PHE A 81 ? N PHE A 104 O MET A 94 ? O MET A 117 AA2 1 2 N TRP A 13 ? N TRP A 36 O LEU A 134 ? O LEU A 157 AA2 2 3 O VAL A 141 ? O VAL A 164 N ARG A 76 ? N ARG A 99 AA2 3 4 N VAL A 75 ? N VAL A 98 O PHE A 102 ? O PHE A 125 AA3 1 2 N ILE A 29 ? N ILE A 52 O VAL A 48 ? O VAL A 71 AA3 2 3 N ARG A 47 ? N ARG A 70 O TYR A 64 ? O TYR A 87 AA3 3 4 N LEU A 65 ? N LEU A 88 O TRP A 108 ? O TRP A 131 AA4 1 2 N ILE B 15 ? N ILE B 38 O LEU B 132 ? O LEU B 155 AA4 2 3 O VAL B 141 ? O VAL B 164 N ARG B 76 ? N ARG B 99 AA4 3 4 N ILE B 83 ? N ILE B 106 O THR B 91 ? O THR B 114 AA5 1 2 N ILE B 15 ? N ILE B 38 O LEU B 132 ? O LEU B 155 AA5 2 3 O VAL B 141 ? O VAL B 164 N ARG B 76 ? N ARG B 99 AA5 3 4 N VAL B 75 ? N VAL B 98 O PHE B 102 ? O PHE B 125 AA6 1 2 N ILE B 29 ? N ILE B 52 O VAL B 48 ? O VAL B 71 AA6 2 3 N ARG B 47 ? N ARG B 70 O TYR B 64 ? O TYR B 87 AA6 3 4 N LEU B 61 ? N LEU B 84 O ILE B 114 ? O ILE B 137 # _pdbx_entry_details.entry_id 7KLZ _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -19.5722651093 27.650683936 -18.6967617411 0.23387881144 ? 0.0789859698574 ? -0.000403746657166 ? 0.895288530804 ? -0.0502153866138 ? 0.553053256871 ? 0.342173998867 ? -0.588776260034 ? -0.0172473537462 ? 1.80344648841 ? -0.513036467766 ? 0.375236128106 ? 0.167297271379 ? -0.860393760037 ? -0.122609344994 ? 0.0321789521151 ? -0.173447475698 ? 0.254637087666 ? 0.394082445885 ? -0.239362464996 ? -0.0550083771484 ? 2 'X-RAY DIFFRACTION' ? refined -7.33182021137 25.0548801875 -8.64872512177 0.831297039827 ? 0.0993635712208 ? -0.0266506745972 ? 1.01028466666 ? 0.0940056892528 ? 0.628373463675 ? 1.11468243748 ? -1.63877762778 ? -2.41770104582 ? 8.91699510488 ? 0.842534547033 ? 9.46712841974 ? -0.979012194311 ? -0.371851261099 ? -0.0692834892691 ? 1.38499967129 ? -0.526569836292 ? -0.333254484105 ? 0.905537437835 ? 1.7055007536 ? 0.952710620587 ? 3 'X-RAY DIFFRACTION' ? refined -21.2024133739 34.9014061838 -11.0334080527 0.46409379274 ? 0.0618898879044 ? 0.0116173938492 ? 0.952266528279 ? -0.28142924931 ? 0.44920882532 ? 0.693835279469 ? 0.896947291987 ? -0.587216161401 ? 3.00422348295 ? 0.251490671679 ? 1.05819579338 ? -0.159941500244 ? -1.10080769415 ? 0.651603006715 ? 0.460957838698 ? -0.162279182541 ? 0.33204401177 ? -0.278110062436 ? -0.753421526638 ? 0.429899952638 ? 4 'X-RAY DIFFRACTION' ? refined -11.8920665037 38.4476992008 -15.5211235104 0.491503039929 ? -0.12736261504 ? -0.0535319161496 ? 0.937146728288 ? -0.31667615508 ? 0.811704897616 ? 1.33840382545 ? 0.15355368599 ? 1.31234854054 ? 3.17263103534 ? 0.157869219451 ? 4.20151904401 ? 0.0232295304119 ? -0.964335953914 ? 0.427137774947 ? -0.10936759392 ? -0.096113240578 ? 0.0937998803756 ? -0.522589714205 ? 0.476989911449 ? 0.0868227772788 ? 5 'X-RAY DIFFRACTION' ? refined -18.6209416945 35.6254873255 -22.5125430189 0.338223767195 ? 0.146032151036 ? -0.098738549024 ? 0.584289705672 ? -0.216257755739 ? 0.606154963158 ? 0.641332739951 ? -0.235878415076 ? -0.773447901617 ? 2.39569226917 ? 0.193730041919 ? 1.85586889803 ? -0.263589716379 ? -0.803872876892 ? 0.317331317593 ? -0.102742433044 ? 0.140673016471 ? 0.430245242974 ? -0.248480598431 ? -0.552546071094 ? 0.108012616818 ? 6 'X-RAY DIFFRACTION' ? refined 1.58817905458 28.7174541142 -19.7773854239 0.354589725083 ? 0.153900282199 ? -0.0213413314455 ? 1.0415169502 ? -0.0861459185677 ? 0.599784406537 ? 9.45574897414 ? 1.43242744614 ? 4.16671908174 ? 3.02051201517 ? -1.20243742164 ? 3.0211604666 ? 0.635168558425 ? -0.796284709797 ? -0.749069559858 ? 0.073356685305 ? -0.257462767552 ? -0.320368242298 ? -0.532794188699 ? -0.838776720852 ? -0.0374735788375 ? 7 'X-RAY DIFFRACTION' ? refined 17.1535106012 29.5637905094 -15.9684553252 0.257126980159 ? 0.0422295604172 ? 0.0598332654647 ? 0.881957648938 ? -0.0605884131579 ? 0.626447557443 ? 0.54481725592 ? -0.701322523911 ? 0.632147446355 ? 1.60223525547 ? 0.447403748982 ? 3.05041171627 ? -0.292392209066 ? 0.899044282055 ? -0.183452816498 ? -0.295035560075 ? 0.417114273529 ? -0.647639140571 ? -0.489733856536 ? -0.0396900851743 ? 0.0948379366512 ? 8 'X-RAY DIFFRACTION' ? refined -3.47001462618 16.578454234 -22.6089419212 1.05399882633 ? -0.297267838946 ? 0.294128291782 ? 1.29984737912 ? -0.419445630114 ? 0.951302707307 ? 1.28482322641 ? 0.252917912677 ? -2.38393760753 ? 2.06651396014 ? -3.36204844439 ? 8.57480712818 ? -0.804562564375 ? 0.31652943343 ? -0.96255412985 ? 0.586545461374 ? 0.104290642572 ? 2.03226490109 ? 1.56871056408 ? -1.53092083056 ? 0.251562998702 ? 9 'X-RAY DIFFRACTION' ? refined 18.1343239224 32.6283022258 -26.5662769443 0.394733986739 ? -0.0585993214542 ? 0.086633948254 ? 1.19512629172 ? -0.0453197401307 ? 0.726767020301 ? 3.74945802409 ? -1.24306359101 ? 0.275264730705 ? 4.91118469594 ? 0.035775561272 ? 0.62501311886 ? 0.370241922779 ? 1.31616962386 ? 0.841756343374 ? -0.866652657086 ? 0.027435690653 ? -0.663607220906 ? -0.000610542469675 ? 0.517622068951 ? -0.206451742031 ? 10 'X-RAY DIFFRACTION' ? refined 4.53967503462 31.3767470231 -25.0617763758 0.687639360464 ? 0.111282064658 ? -0.152198080023 ? 1.33842519678 ? -0.0973844450868 ? 0.636537286527 ? 3.00667071264 ? 0.277412973588 ? 0.616183161573 ? 3.67308310188 ? -0.335248637396 ? 3.1716101925 ? -0.331445964196 ? 1.11964090142 ? -0.100206051458 ? -0.612462268872 ? 0.0407684165844 ? 0.839067593302 ? -0.12846815269 ? -0.661863304377 ? 0.320866695829 ? 11 'X-RAY DIFFRACTION' ? refined 8.36905983334 31.9325360637 -31.6066575203 0.906702402904 ? -0.00950910669174 ? -0.110976076054 ? 1.89010739458 ? 0.0291924965058 ? 0.880422525081 ? 3.24623924064 ? 0.246773442219 ? 1.00591866262 ? 1.7771821133 ? 0.988400622284 ? 3.91554569589 ? -0.242120294361 ? 2.63988942088 ? 0.1234111745 ? -0.8995355073 ? 0.318272668776 ? -0.173449475517 ? -0.857301391393 ? 0.559700896177 ? 0.0026684958318 ? 12 'X-RAY DIFFRACTION' ? refined 9.51289247358 37.8253262364 -17.9191047166 0.463468593832 ? 0.00144358713055 ? 0.0554980229241 ? 0.657767258557 ? -0.0497899779771 ? 0.403552377486 ? 4.03053210114 ? -0.0779944087519 ? 2.42389585588 ? 3.48160299222 ? 0.827956069009 ? 4.73466291787 ? -0.301932271514 ? 0.212376269792 ? 0.826396081541 ? -0.443155548344 ? 0.0290180354708 ? 0.0840581336633 ? -0.894068163232 ? -0.484055404337 ? 0.148336494356 ? 13 'X-RAY DIFFRACTION' ? refined -20.3431206598 42.9270911755 -10.0034216894 0.657620779354 ? 0.103230770538 ? 0.240094839493 ? 0.502218376392 ? -0.451478086059 ? 1.36068979435 ? 1.45022955953 ? -0.811662678678 ? -1.64001706703 ? 2.14774048326 ? 0.348164916082 ? 2.67287392473 ? 0.472552430438 ? 0.215218569839 ? -0.241549863763 ? 0.0252556608599 ? -0.424282958516 ? 0.832547452138 ? -0.646809558757 ? -0.465912003797 ? 0.25936588488 ? 14 'X-RAY DIFFRACTION' ? refined 12.9264174129 31.7579553129 -35.1510454044 0.623115961556 ? -0.0785414691431 ? 0.202302195825 ? 1.92417293321 ? 0.0863711513163 ? 0.579248116802 ? 4.62522979918 ? -5.1694616306 ? -2.20780617942 ? 7.17276377732 ? 1.29803400865 ? 7.87079480981 ? 1.02820375573 ? 0.522985246629 ? 0.792360852916 ? -0.541358457126 ? -0.0568032687738 ? -0.403695406499 ? -1.14374824796 ? 0.370882884089 ? 0.0315449818485 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 28 through 53 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 54 through 66 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 67 through 97 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 98 through 129 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 130 through 165 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 27 through 39 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 40 through 59 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 60 through 66 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 67 through 84 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 85 through 116 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 117 through 138 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 139 through 165 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 196 through 204 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 196 through 204 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 24 ? A GLY 1 2 1 Y 1 A PRO 25 ? A PRO 2 3 1 Y 1 A GLY 26 ? A GLY 3 4 1 Y 1 A HIS 27 ? A HIS 4 5 1 Y 1 A ASP 166 ? A ASP 143 6 1 Y 1 B GLY 24 ? B GLY 1 7 1 Y 1 B PRO 25 ? B PRO 2 8 1 Y 1 B GLY 26 ? B GLY 3 9 1 Y 1 B ASP 166 ? B ASP 143 10 1 Y 1 C ALA 195 ? C ALA 1 11 1 Y 1 C ALA 205 ? C ALA 11 12 1 Y 1 C LEU 206 ? C LEU 12 13 1 Y 1 C PRO 207 ? C PRO 13 14 1 Y 1 C CYS 208 ? C CYS 14 15 1 Y 1 C ILE 209 ? C ILE 15 16 1 Y 1 D ALA 195 ? D ALA 1 17 1 Y 1 D ALA 205 ? D ALA 11 18 1 Y 1 D LEU 206 ? D LEU 12 19 1 Y 1 D PRO 207 ? D PRO 13 20 1 Y 1 D CYS 208 ? D CYS 14 21 1 Y 1 D ILE 209 ? D ILE 15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PO4 P P N N 270 PO4 O1 O N N 271 PO4 O2 O N N 272 PO4 O3 O N N 273 PO4 O4 O N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PO4 P O1 doub N N 258 PO4 P O2 sing N N 259 PO4 P O3 sing N N 260 PO4 P O4 sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TRP N CA sing N N 308 TRP N H sing N N 309 TRP N H2 sing N N 310 TRP CA C sing N N 311 TRP CA CB sing N N 312 TRP CA HA sing N N 313 TRP C O doub N N 314 TRP C OXT sing N N 315 TRP CB CG sing N N 316 TRP CB HB2 sing N N 317 TRP CB HB3 sing N N 318 TRP CG CD1 doub Y N 319 TRP CG CD2 sing Y N 320 TRP CD1 NE1 sing Y N 321 TRP CD1 HD1 sing N N 322 TRP CD2 CE2 doub Y N 323 TRP CD2 CE3 sing Y N 324 TRP NE1 CE2 sing Y N 325 TRP NE1 HE1 sing N N 326 TRP CE2 CZ2 sing Y N 327 TRP CE3 CZ3 doub Y N 328 TRP CE3 HE3 sing N N 329 TRP CZ2 CH2 doub Y N 330 TRP CZ2 HZ2 sing N N 331 TRP CZ3 CH2 sing Y N 332 TRP CZ3 HZ3 sing N N 333 TRP CH2 HH2 sing N N 334 TRP OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R01 CA132878' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6F8G _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 7KLZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009703 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009703 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007587 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #