data_7KYE # _entry.id 7KYE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7KYE pdb_00007kye 10.2210/pdb7kye/pdb WWPDB D_1000253386 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7KYE _pdbx_database_status.recvd_initial_deposition_date 2020-12-07 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Czub, M.P.' 1 0000-0001-8973-4569 'Porebski, P.J.' 2 0000-0001-8012-5791 'Cymborowski, M.' 3 0000-0001-6511-7945 'Minor, W.' 4 0000-0001-7075-7090 'Center for Structural Genomics of Infectious Diseases (CSGID)' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of a GNAT superfamily PA3944 acetyltransferase in complex with CHES' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Czub, M.P.' 1 0000-0001-8973-4569 primary 'Porebski, P.J.' 2 0000-0001-8012-5791 primary 'Cymborowski, M.' 3 0000-0001-6511-7945 primary 'Minor, W.' 4 0000-0001-7075-7090 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7KYE _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.208 _cell.length_a_esd ? _cell.length_b 44.075 _cell.length_b_esd ? _cell.length_c 97.313 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7KYE _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Acetyltransferase PA3944' 22080.045 1 2.3.1.- ? ? ? 2 non-polymer syn 'COENZYME A' 767.534 1 ? ? ? ? 3 non-polymer syn '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 207.290 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 5 water nat water 18.015 91 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GCN5-related N-acetyltransferase,GNAT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMNANLPPSAISELHGPRLLLRAWRDSDREAFAEMCADPQVMEFFPSVLDRAQSDALVDRVQAHFAERGYGPWALELPG EAAFIGFTGLFDVTMDVHFAPTVEIGWRLAPAYWGRGLAREAAETALDFAFERLRLPEVVAFTTPPNRRSWGLMERLGMR RDPAEDFDHPLLAADHPMRRHILYRVDAARWAER ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMNANLPPSAISELHGPRLLLRAWRDSDREAFAEMCADPQVMEFFPSVLDRAQSDALVDRVQAHFAERGYGPWALELPG EAAFIGFTGLFDVTMDVHFAPTVEIGWRLAPAYWGRGLAREAAETALDFAFERLRLPEVVAFTTPPNRRSWGLMERLGMR RDPAEDFDHPLLAADHPMRRHILYRVDAARWAER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ASN n 1 5 ALA n 1 6 ASN n 1 7 LEU n 1 8 PRO n 1 9 PRO n 1 10 SER n 1 11 ALA n 1 12 ILE n 1 13 SER n 1 14 GLU n 1 15 LEU n 1 16 HIS n 1 17 GLY n 1 18 PRO n 1 19 ARG n 1 20 LEU n 1 21 LEU n 1 22 LEU n 1 23 ARG n 1 24 ALA n 1 25 TRP n 1 26 ARG n 1 27 ASP n 1 28 SER n 1 29 ASP n 1 30 ARG n 1 31 GLU n 1 32 ALA n 1 33 PHE n 1 34 ALA n 1 35 GLU n 1 36 MET n 1 37 CYS n 1 38 ALA n 1 39 ASP n 1 40 PRO n 1 41 GLN n 1 42 VAL n 1 43 MET n 1 44 GLU n 1 45 PHE n 1 46 PHE n 1 47 PRO n 1 48 SER n 1 49 VAL n 1 50 LEU n 1 51 ASP n 1 52 ARG n 1 53 ALA n 1 54 GLN n 1 55 SER n 1 56 ASP n 1 57 ALA n 1 58 LEU n 1 59 VAL n 1 60 ASP n 1 61 ARG n 1 62 VAL n 1 63 GLN n 1 64 ALA n 1 65 HIS n 1 66 PHE n 1 67 ALA n 1 68 GLU n 1 69 ARG n 1 70 GLY n 1 71 TYR n 1 72 GLY n 1 73 PRO n 1 74 TRP n 1 75 ALA n 1 76 LEU n 1 77 GLU n 1 78 LEU n 1 79 PRO n 1 80 GLY n 1 81 GLU n 1 82 ALA n 1 83 ALA n 1 84 PHE n 1 85 ILE n 1 86 GLY n 1 87 PHE n 1 88 THR n 1 89 GLY n 1 90 LEU n 1 91 PHE n 1 92 ASP n 1 93 VAL n 1 94 THR n 1 95 MET n 1 96 ASP n 1 97 VAL n 1 98 HIS n 1 99 PHE n 1 100 ALA n 1 101 PRO n 1 102 THR n 1 103 VAL n 1 104 GLU n 1 105 ILE n 1 106 GLY n 1 107 TRP n 1 108 ARG n 1 109 LEU n 1 110 ALA n 1 111 PRO n 1 112 ALA n 1 113 TYR n 1 114 TRP n 1 115 GLY n 1 116 ARG n 1 117 GLY n 1 118 LEU n 1 119 ALA n 1 120 ARG n 1 121 GLU n 1 122 ALA n 1 123 ALA n 1 124 GLU n 1 125 THR n 1 126 ALA n 1 127 LEU n 1 128 ASP n 1 129 PHE n 1 130 ALA n 1 131 PHE n 1 132 GLU n 1 133 ARG n 1 134 LEU n 1 135 ARG n 1 136 LEU n 1 137 PRO n 1 138 GLU n 1 139 VAL n 1 140 VAL n 1 141 ALA n 1 142 PHE n 1 143 THR n 1 144 THR n 1 145 PRO n 1 146 PRO n 1 147 ASN n 1 148 ARG n 1 149 ARG n 1 150 SER n 1 151 TRP n 1 152 GLY n 1 153 LEU n 1 154 MET n 1 155 GLU n 1 156 ARG n 1 157 LEU n 1 158 GLY n 1 159 MET n 1 160 ARG n 1 161 ARG n 1 162 ASP n 1 163 PRO n 1 164 ALA n 1 165 GLU n 1 166 ASP n 1 167 PHE n 1 168 ASP n 1 169 HIS n 1 170 PRO n 1 171 LEU n 1 172 LEU n 1 173 ALA n 1 174 ALA n 1 175 ASP n 1 176 HIS n 1 177 PRO n 1 178 MET n 1 179 ARG n 1 180 ARG n 1 181 HIS n 1 182 ILE n 1 183 LEU n 1 184 TYR n 1 185 ARG n 1 186 VAL n 1 187 ASP n 1 188 ALA n 1 189 ALA n 1 190 ARG n 1 191 TRP n 1 192 ALA n 1 193 GLU n 1 194 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 194 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA3944 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATSE3_PSEAE _struct_ref.pdbx_db_accession Q9HX72 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNANLPPSAISELHGPRLLLRAWRDSDREAFAEMCADPQVMEFFPSVLDRAQSDALVDRVQAHFAERGYGPWALELPGEA AFIGFTGLFDVTMDVHFAPTVEIGWRLAPAYWGRGLAREAAETALDFAFERLRLPEVVAFTTPPNRRSWGLMERLGMRRD PAEDFDHPLLAADHPMRRHILYRVDAARWAER ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7KYE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 194 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HX72 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 192 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7KYE GLY A 1 ? UNP Q9HX72 ? ? 'expression tag' -1 1 1 7KYE HIS A 2 ? UNP Q9HX72 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 COA non-polymer . 'COENZYME A' ? 'C21 H36 N7 O16 P3 S' 767.534 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NHE non-polymer . '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 'N-CYCLOHEXYLTAURINE; CHES' 'C8 H17 N O3 S' 207.290 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7KYE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 288 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 uL of 20 mg/mL protein incubated with 2.5 mM CoA was mixed with 0.2 uL of the well condition (20%w/v PEG 8K, 100mM CHES pH=9.5 (Emerald - Wizard Full (I & II) #1) and equilibrated against well solution in 96 Well 3 drop Crystallization Plate (Swissci). ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7KYE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.930 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13814 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.100 _reflns.pdbx_Rmerge_I_obs 0.136 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.104 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.147 _reflns.pdbx_Rpim_I_all 0.054 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 84478 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.930 1.960 ? ? ? ? ? ? 554 78.700 ? ? ? ? 0.512 ? ? ? ? ? ? ? ? 3.700 ? 0.823 ? ? 0.581 0.266 ? 1 1 0.836 ? ? 1.960 2.000 ? ? ? ? ? ? 607 84.400 ? ? ? ? 0.474 ? ? ? ? ? ? ? ? 3.900 ? 0.788 ? ? 0.538 0.246 ? 2 1 0.799 ? ? 2.000 2.040 ? ? ? ? ? ? 591 84.500 ? ? ? ? 0.445 ? ? ? ? ? ? ? ? 4.000 ? 0.828 ? ? 0.505 0.230 ? 3 1 0.909 ? ? 2.040 2.080 ? ? ? ? ? ? 622 87.200 ? ? ? ? 0.417 ? ? ? ? ? ? ? ? 4.100 ? 0.816 ? ? 0.470 0.210 ? 4 1 0.861 ? ? 2.080 2.120 ? ? ? ? ? ? 636 88.000 ? ? ? ? 0.487 ? ? ? ? ? ? ? ? 4.300 ? 0.841 ? ? 0.548 0.243 ? 5 1 0.850 ? ? 2.120 2.170 ? ? ? ? ? ? 644 89.900 ? ? ? ? 0.459 ? ? ? ? ? ? ? ? 4.500 ? 0.828 ? ? 0.514 0.224 ? 6 1 0.861 ? ? 2.170 2.230 ? ? ? ? ? ? 653 93.300 ? ? ? ? 0.410 ? ? ? ? ? ? ? ? 4.700 ? 0.922 ? ? 0.456 0.192 ? 7 1 0.904 ? ? 2.230 2.290 ? ? ? ? ? ? 691 95.200 ? ? ? ? 0.483 ? ? ? ? ? ? ? ? 4.900 ? 0.866 ? ? 0.534 0.221 ? 8 1 0.886 ? ? 2.290 2.360 ? ? ? ? ? ? 690 97.200 ? ? ? ? 0.540 ? ? ? ? ? ? ? ? 5.300 ? 0.917 ? ? 0.592 0.236 ? 9 1 0.903 ? ? 2.360 2.430 ? ? ? ? ? ? 710 97.900 ? ? ? ? 0.514 ? ? ? ? ? ? ? ? 6.000 ? 0.895 ? ? 0.560 0.216 ? 10 1 0.936 ? ? 2.430 2.520 ? ? ? ? ? ? 710 100.000 ? ? ? ? 0.510 ? ? ? ? ? ? ? ? 6.400 ? 0.894 ? ? 0.553 0.209 ? 11 1 0.931 ? ? 2.520 2.620 ? ? ? ? ? ? 724 99.700 ? ? ? ? 0.530 ? ? ? ? ? ? ? ? 7.000 ? 0.938 ? ? 0.571 0.209 ? 12 1 0.959 ? ? 2.620 2.740 ? ? ? ? ? ? 733 100.000 ? ? ? ? 0.484 ? ? ? ? ? ? ? ? 7.500 ? 0.914 ? ? 0.520 0.187 ? 13 1 0.964 ? ? 2.740 2.880 ? ? ? ? ? ? 722 100.000 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 7.800 ? 0.946 ? ? 0.405 0.145 ? 14 1 0.960 ? ? 2.880 3.060 ? ? ? ? ? ? 726 100.000 ? ? ? ? 0.278 ? ? ? ? ? ? ? ? 8.000 ? 1.048 ? ? 0.298 0.105 ? 15 1 0.989 ? ? 3.060 3.300 ? ? ? ? ? ? 731 100.000 ? ? ? ? 0.207 ? ? ? ? ? ? ? ? 7.900 ? 1.130 ? ? 0.222 0.079 ? 16 1 0.994 ? ? 3.300 3.630 ? ? ? ? ? ? 750 100.000 ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 7.800 ? 1.301 ? ? 0.130 0.046 ? 17 1 0.996 ? ? 3.630 4.160 ? ? ? ? ? ? 732 100.000 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 7.800 ? 1.521 ? ? 0.092 0.033 ? 18 1 0.997 ? ? 4.160 5.240 ? ? ? ? ? ? 763 100.000 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 7.600 ? 1.599 ? ? 0.076 0.027 ? 19 1 0.997 ? ? 5.240 50.000 ? ? ? ? ? ? 825 99.300 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 6.600 ? 1.838 ? ? 0.072 0.028 ? 20 1 0.997 ? ? # _refine.aniso_B[1][1] 4.7000 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -3.0800 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -1.6200 _refine.B_iso_max 125.930 _refine.B_iso_mean 49.0430 _refine.B_iso_min 29.980 _refine.correlation_coeff_Fo_to_Fc 0.9740 _refine.correlation_coeff_Fo_to_Fc_free 0.9570 _refine.details 'U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7KYE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9300 _refine.ls_d_res_low 32.6900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13113 _refine.ls_number_reflns_R_free 659 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.6800 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1753 _refine.ls_R_factor_R_free 0.2159 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1735 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6EDD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1750 _refine.pdbx_overall_ESU_R_Free 0.1530 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 10.5790 _refine.overall_SU_ML 0.1460 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9300 _refine_hist.d_res_low 32.6900 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 1647 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 184 _refine_hist.pdbx_B_iso_mean_ligand 54.00 _refine_hist.pdbx_B_iso_mean_solvent 52.05 _refine_hist.pdbx_number_atoms_protein 1487 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 69 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.013 1611 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 1469 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.158 1.663 2194 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.100 1.577 3361 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.490 5.000 185 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 24.132 18.879 107 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.119 15.000 232 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.666 15.000 22 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.048 0.200 191 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 1807 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 416 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9310 _refine_ls_shell.d_res_low 1.9810 _refine_ls_shell.number_reflns_all 811 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 38 _refine_ls_shell.number_reflns_R_work 773 _refine_ls_shell.percent_reflns_obs 77.6800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2250 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2800 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7KYE _struct.title 'Structure of a GNAT superfamily PA3944 acetyltransferase in complex with CHES' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7KYE _struct_keywords.text ;PA3944, acetyltransferase, GNAT Superfamily, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 28 ? ASP A 39 ? SER A 26 ASP A 37 1 ? 12 HELX_P HELX_P2 AA2 PRO A 40 ? PHE A 45 ? PRO A 38 PHE A 43 5 ? 6 HELX_P HELX_P3 AA3 ASP A 51 ? GLY A 70 ? ASP A 49 GLY A 68 1 ? 20 HELX_P HELX_P4 AA4 PRO A 111 ? TRP A 114 ? PRO A 109 TRP A 112 5 ? 4 HELX_P HELX_P5 AA5 GLY A 117 ? ARG A 133 ? GLY A 115 ARG A 131 1 ? 17 HELX_P HELX_P6 AA6 ASN A 147 ? LEU A 157 ? ASN A 145 LEU A 155 1 ? 11 HELX_P HELX_P7 AA7 PRO A 163 ? ASP A 166 ? PRO A 161 ASP A 164 5 ? 4 HELX_P HELX_P8 AA8 ALA A 188 ? GLU A 193 ? ALA A 186 GLU A 191 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 100 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 98 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 101 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 99 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.96 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 15 ? HIS A 16 ? LEU A 13 HIS A 14 AA1 2 LEU A 21 ? ARG A 23 ? LEU A 19 ARG A 21 AA1 3 PRO A 73 ? GLU A 77 ? PRO A 71 GLU A 75 AA1 4 GLY A 86 ? VAL A 93 ? GLY A 84 VAL A 91 AA1 5 THR A 102 ? LEU A 109 ? THR A 100 LEU A 107 AA2 1 GLU A 138 ? THR A 143 ? GLU A 136 THR A 141 AA2 2 ARG A 180 ? ASP A 187 ? ARG A 178 ASP A 185 AA2 3 ARG A 160 ? ARG A 161 ? ARG A 158 ARG A 159 AA3 1 GLU A 138 ? THR A 143 ? GLU A 136 THR A 141 AA3 2 ARG A 180 ? ASP A 187 ? ARG A 178 ASP A 185 AA3 3 PHE A 167 ? ASP A 168 ? PHE A 165 ASP A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 15 ? N LEU A 13 O LEU A 22 ? O LEU A 20 AA1 2 3 N LEU A 21 ? N LEU A 19 O GLU A 77 ? O GLU A 75 AA1 3 4 N LEU A 76 ? N LEU A 74 O GLY A 86 ? O GLY A 84 AA1 4 5 N PHE A 91 ? N PHE A 89 O GLU A 104 ? O GLU A 102 AA2 1 2 N ALA A 141 ? N ALA A 139 O TYR A 184 ? O TYR A 182 AA2 2 3 O ARG A 185 ? O ARG A 183 N ARG A 160 ? N ARG A 158 AA3 1 2 N ALA A 141 ? N ALA A 139 O TYR A 184 ? O TYR A 182 AA3 2 3 O HIS A 181 ? O HIS A 179 N PHE A 167 ? N PHE A 165 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A COA 201 ? 22 'binding site for residue COA A 201' AC2 Software A NHE 202 ? 9 'binding site for residue NHE A 202' AC3 Software A EDO 203 ? 2 'binding site for residue EDO A 203' AC4 Software A EDO 204 ? 3 'binding site for residue EDO A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 22 CYS A 37 ? CYS A 35 . ? 1_555 ? 2 AC1 22 VAL A 42 ? VAL A 40 . ? 1_555 ? 3 AC1 22 PHE A 45 ? PHE A 43 . ? 1_555 ? 4 AC1 22 PHE A 46 ? PHE A 44 . ? 1_555 ? 5 AC1 22 GLY A 80 ? GLY A 78 . ? 3_555 ? 6 AC1 22 TRP A 107 ? TRP A 105 . ? 1_555 ? 7 AC1 22 ARG A 108 ? ARG A 106 . ? 1_555 ? 8 AC1 22 LEU A 109 ? LEU A 107 . ? 1_555 ? 9 AC1 22 TRP A 114 ? TRP A 112 . ? 1_555 ? 10 AC1 22 GLY A 115 ? GLY A 113 . ? 1_555 ? 11 AC1 22 ARG A 116 ? ARG A 114 . ? 1_555 ? 12 AC1 22 GLY A 117 ? GLY A 115 . ? 1_555 ? 13 AC1 22 LEU A 118 ? LEU A 116 . ? 1_555 ? 14 AC1 22 ALA A 119 ? ALA A 117 . ? 1_555 ? 15 AC1 22 ARG A 120 ? ARG A 118 . ? 1_555 ? 16 AC1 22 LEU A 153 ? LEU A 151 . ? 1_555 ? 17 AC1 22 ARG A 156 ? ARG A 154 . ? 1_555 ? 18 AC1 22 ARG A 161 ? ARG A 159 . ? 3_545 ? 19 AC1 22 PRO A 163 ? PRO A 161 . ? 3_545 ? 20 AC1 22 HOH F . ? HOH A 303 . ? 1_555 ? 21 AC1 22 HOH F . ? HOH A 319 . ? 1_555 ? 22 AC1 22 HOH F . ? HOH A 340 . ? 1_555 ? 23 AC2 9 ARG A 61 ? ARG A 59 . ? 1_555 ? 24 AC2 9 PRO A 73 ? PRO A 71 . ? 1_555 ? 25 AC2 9 PHE A 87 ? PHE A 85 . ? 1_555 ? 26 AC2 9 MET A 95 ? MET A 93 . ? 1_555 ? 27 AC2 9 GLU A 104 ? GLU A 102 . ? 1_555 ? 28 AC2 9 HIS A 169 ? HIS A 167 . ? 1_555 ? 29 AC2 9 LEU A 171 ? LEU A 169 . ? 1_555 ? 30 AC2 9 HOH F . ? HOH A 318 . ? 1_555 ? 31 AC2 9 HOH F . ? HOH A 333 . ? 1_555 ? 32 AC3 2 ARG A 69 ? ARG A 67 . ? 1_555 ? 33 AC3 2 THR A 102 ? THR A 100 . ? 1_555 ? 34 AC4 3 MET A 43 ? MET A 41 . ? 1_555 ? 35 AC4 3 GLU A 44 ? GLU A 42 . ? 1_555 ? 36 AC4 3 HOH F . ? HOH A 347 . ? 1_555 ? # _atom_sites.entry_id 7KYE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023144 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022689 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010276 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 HIS 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 ASN 4 2 ? ? ? A . n A 1 5 ALA 5 3 ? ? ? A . n A 1 6 ASN 6 4 ? ? ? A . n A 1 7 LEU 7 5 ? ? ? A . n A 1 8 PRO 8 6 ? ? ? A . n A 1 9 PRO 9 7 ? ? ? A . n A 1 10 SER 10 8 ? ? ? A . n A 1 11 ALA 11 9 9 ALA ALA A . n A 1 12 ILE 12 10 10 ILE ILE A . n A 1 13 SER 13 11 11 SER SER A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 LEU 15 13 13 LEU LEU A . n A 1 16 HIS 16 14 14 HIS HIS A . n A 1 17 GLY 17 15 15 GLY GLY A . n A 1 18 PRO 18 16 16 PRO PRO A . n A 1 19 ARG 19 17 17 ARG ARG A . n A 1 20 LEU 20 18 18 LEU LEU A . n A 1 21 LEU 21 19 19 LEU LEU A . n A 1 22 LEU 22 20 20 LEU LEU A . n A 1 23 ARG 23 21 21 ARG ARG A . n A 1 24 ALA 24 22 22 ALA ALA A . n A 1 25 TRP 25 23 23 TRP TRP A . n A 1 26 ARG 26 24 24 ARG ARG A . n A 1 27 ASP 27 25 25 ASP ASP A . n A 1 28 SER 28 26 26 SER SER A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 ARG 30 28 28 ARG ARG A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 ALA 32 30 30 ALA ALA A . n A 1 33 PHE 33 31 31 PHE PHE A . n A 1 34 ALA 34 32 32 ALA ALA A . n A 1 35 GLU 35 33 33 GLU GLU A . n A 1 36 MET 36 34 34 MET MET A . n A 1 37 CYS 37 35 35 CYS CYS A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 ASP 39 37 37 ASP ASP A . n A 1 40 PRO 40 38 38 PRO PRO A . n A 1 41 GLN 41 39 39 GLN GLN A . n A 1 42 VAL 42 40 40 VAL VAL A . n A 1 43 MET 43 41 41 MET MET A . n A 1 44 GLU 44 42 42 GLU GLU A . n A 1 45 PHE 45 43 43 PHE PHE A . n A 1 46 PHE 46 44 44 PHE PHE A . n A 1 47 PRO 47 45 45 PRO PRO A . n A 1 48 SER 48 46 46 SER SER A . n A 1 49 VAL 49 47 47 VAL VAL A . n A 1 50 LEU 50 48 48 LEU LEU A . n A 1 51 ASP 51 49 49 ASP ASP A . n A 1 52 ARG 52 50 50 ARG ARG A . n A 1 53 ALA 53 51 51 ALA ALA A . n A 1 54 GLN 54 52 52 GLN GLN A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 ASP 56 54 54 ASP ASP A . n A 1 57 ALA 57 55 55 ALA ALA A . n A 1 58 LEU 58 56 56 LEU LEU A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 ASP 60 58 58 ASP ASP A . n A 1 61 ARG 61 59 59 ARG ARG A . n A 1 62 VAL 62 60 60 VAL VAL A . n A 1 63 GLN 63 61 61 GLN GLN A . n A 1 64 ALA 64 62 62 ALA ALA A . n A 1 65 HIS 65 63 63 HIS HIS A . n A 1 66 PHE 66 64 64 PHE PHE A . n A 1 67 ALA 67 65 65 ALA ALA A . n A 1 68 GLU 68 66 66 GLU GLU A . n A 1 69 ARG 69 67 67 ARG ARG A . n A 1 70 GLY 70 68 68 GLY GLY A . n A 1 71 TYR 71 69 69 TYR TYR A . n A 1 72 GLY 72 70 70 GLY GLY A . n A 1 73 PRO 73 71 71 PRO PRO A . n A 1 74 TRP 74 72 72 TRP TRP A . n A 1 75 ALA 75 73 73 ALA ALA A . n A 1 76 LEU 76 74 74 LEU LEU A . n A 1 77 GLU 77 75 75 GLU GLU A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 PRO 79 77 77 PRO PRO A . n A 1 80 GLY 80 78 78 GLY GLY A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 ALA 82 80 80 ALA ALA A . n A 1 83 ALA 83 81 81 ALA ALA A . n A 1 84 PHE 84 82 82 PHE PHE A . n A 1 85 ILE 85 83 83 ILE ILE A . n A 1 86 GLY 86 84 84 GLY GLY A . n A 1 87 PHE 87 85 85 PHE PHE A . n A 1 88 THR 88 86 86 THR THR A . n A 1 89 GLY 89 87 87 GLY GLY A . n A 1 90 LEU 90 88 88 LEU LEU A . n A 1 91 PHE 91 89 89 PHE PHE A . n A 1 92 ASP 92 90 90 ASP ASP A . n A 1 93 VAL 93 91 91 VAL VAL A . n A 1 94 THR 94 92 92 THR THR A . n A 1 95 MET 95 93 93 MET MET A . n A 1 96 ASP 96 94 94 ASP ASP A . n A 1 97 VAL 97 95 95 VAL VAL A . n A 1 98 HIS 98 96 96 HIS HIS A . n A 1 99 PHE 99 97 97 PHE PHE A . n A 1 100 ALA 100 98 98 ALA ALA A . n A 1 101 PRO 101 99 99 PRO PRO A . n A 1 102 THR 102 100 100 THR THR A . n A 1 103 VAL 103 101 101 VAL VAL A . n A 1 104 GLU 104 102 102 GLU GLU A . n A 1 105 ILE 105 103 103 ILE ILE A . n A 1 106 GLY 106 104 104 GLY GLY A . n A 1 107 TRP 107 105 105 TRP TRP A . n A 1 108 ARG 108 106 106 ARG ARG A . n A 1 109 LEU 109 107 107 LEU LEU A . n A 1 110 ALA 110 108 108 ALA ALA A . n A 1 111 PRO 111 109 109 PRO PRO A . n A 1 112 ALA 112 110 110 ALA ALA A . n A 1 113 TYR 113 111 111 TYR TYR A . n A 1 114 TRP 114 112 112 TRP TRP A . n A 1 115 GLY 115 113 113 GLY GLY A . n A 1 116 ARG 116 114 114 ARG ARG A . n A 1 117 GLY 117 115 115 GLY GLY A . n A 1 118 LEU 118 116 116 LEU LEU A . n A 1 119 ALA 119 117 117 ALA ALA A . n A 1 120 ARG 120 118 118 ARG ARG A . n A 1 121 GLU 121 119 119 GLU GLU A . n A 1 122 ALA 122 120 120 ALA ALA A . n A 1 123 ALA 123 121 121 ALA ALA A . n A 1 124 GLU 124 122 122 GLU GLU A . n A 1 125 THR 125 123 123 THR THR A . n A 1 126 ALA 126 124 124 ALA ALA A . n A 1 127 LEU 127 125 125 LEU LEU A . n A 1 128 ASP 128 126 126 ASP ASP A . n A 1 129 PHE 129 127 127 PHE PHE A . n A 1 130 ALA 130 128 128 ALA ALA A . n A 1 131 PHE 131 129 129 PHE PHE A . n A 1 132 GLU 132 130 130 GLU GLU A . n A 1 133 ARG 133 131 131 ARG ARG A . n A 1 134 LEU 134 132 132 LEU LEU A . n A 1 135 ARG 135 133 133 ARG ARG A . n A 1 136 LEU 136 134 134 LEU LEU A . n A 1 137 PRO 137 135 135 PRO PRO A . n A 1 138 GLU 138 136 136 GLU GLU A . n A 1 139 VAL 139 137 137 VAL VAL A . n A 1 140 VAL 140 138 138 VAL VAL A . n A 1 141 ALA 141 139 139 ALA ALA A . n A 1 142 PHE 142 140 140 PHE PHE A . n A 1 143 THR 143 141 141 THR THR A . n A 1 144 THR 144 142 142 THR THR A . n A 1 145 PRO 145 143 143 PRO PRO A . n A 1 146 PRO 146 144 144 PRO PRO A . n A 1 147 ASN 147 145 145 ASN ASN A . n A 1 148 ARG 148 146 146 ARG ARG A . n A 1 149 ARG 149 147 147 ARG ARG A . n A 1 150 SER 150 148 148 SER SER A . n A 1 151 TRP 151 149 149 TRP TRP A . n A 1 152 GLY 152 150 150 GLY GLY A . n A 1 153 LEU 153 151 151 LEU LEU A . n A 1 154 MET 154 152 152 MET MET A . n A 1 155 GLU 155 153 153 GLU GLU A . n A 1 156 ARG 156 154 154 ARG ARG A . n A 1 157 LEU 157 155 155 LEU LEU A . n A 1 158 GLY 158 156 156 GLY GLY A . n A 1 159 MET 159 157 157 MET MET A . n A 1 160 ARG 160 158 158 ARG ARG A . n A 1 161 ARG 161 159 159 ARG ARG A . n A 1 162 ASP 162 160 160 ASP ASP A . n A 1 163 PRO 163 161 161 PRO PRO A . n A 1 164 ALA 164 162 162 ALA ALA A . n A 1 165 GLU 165 163 163 GLU GLU A . n A 1 166 ASP 166 164 164 ASP ASP A . n A 1 167 PHE 167 165 165 PHE PHE A . n A 1 168 ASP 168 166 166 ASP ASP A . n A 1 169 HIS 169 167 167 HIS HIS A . n A 1 170 PRO 170 168 168 PRO PRO A . n A 1 171 LEU 171 169 169 LEU LEU A . n A 1 172 LEU 172 170 170 LEU LEU A . n A 1 173 ALA 173 171 171 ALA ALA A . n A 1 174 ALA 174 172 172 ALA ALA A . n A 1 175 ASP 175 173 173 ASP ASP A . n A 1 176 HIS 176 174 174 HIS HIS A . n A 1 177 PRO 177 175 175 PRO PRO A . n A 1 178 MET 178 176 176 MET MET A . n A 1 179 ARG 179 177 177 ARG ARG A . n A 1 180 ARG 180 178 178 ARG ARG A . n A 1 181 HIS 181 179 179 HIS HIS A . n A 1 182 ILE 182 180 180 ILE ILE A . n A 1 183 LEU 183 181 181 LEU LEU A . n A 1 184 TYR 184 182 182 TYR TYR A . n A 1 185 ARG 185 183 183 ARG ARG A . n A 1 186 VAL 186 184 184 VAL VAL A . n A 1 187 ASP 187 185 185 ASP ASP A . n A 1 188 ALA 188 186 186 ALA ALA A . n A 1 189 ALA 189 187 187 ALA ALA A . n A 1 190 ARG 190 188 188 ARG ARG A . n A 1 191 TRP 191 189 189 TRP TRP A . n A 1 192 ALA 192 190 190 ALA ALA A . n A 1 193 GLU 193 191 191 GLU GLU A . n A 1 194 ARG 194 192 192 ARG ARG A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 COA 1 201 1 COA COA A . C 3 NHE 1 202 1 NHE NHE A . D 4 EDO 1 203 1 EDO EDO A . E 4 EDO 1 204 2 EDO EDO A . F 5 HOH 1 301 160 HOH HOH A . F 5 HOH 2 302 250 HOH HOH A . F 5 HOH 3 303 131 HOH HOH A . F 5 HOH 4 304 90 HOH HOH A . F 5 HOH 5 305 212 HOH HOH A . F 5 HOH 6 306 31 HOH HOH A . F 5 HOH 7 307 18 HOH HOH A . F 5 HOH 8 308 117 HOH HOH A . F 5 HOH 9 309 35 HOH HOH A . F 5 HOH 10 310 243 HOH HOH A . F 5 HOH 11 311 33 HOH HOH A . F 5 HOH 12 312 32 HOH HOH A . F 5 HOH 13 313 9 HOH HOH A . F 5 HOH 14 314 215 HOH HOH A . F 5 HOH 15 315 42 HOH HOH A . F 5 HOH 16 316 13 HOH HOH A . F 5 HOH 17 317 8 HOH HOH A . F 5 HOH 18 318 203 HOH HOH A . F 5 HOH 19 319 1 HOH HOH A . F 5 HOH 20 320 248 HOH HOH A . F 5 HOH 21 321 62 HOH HOH A . F 5 HOH 22 322 107 HOH HOH A . F 5 HOH 23 323 11 HOH HOH A . F 5 HOH 24 324 238 HOH HOH A . F 5 HOH 25 325 5 HOH HOH A . F 5 HOH 26 326 10 HOH HOH A . F 5 HOH 27 327 232 HOH HOH A . F 5 HOH 28 328 39 HOH HOH A . F 5 HOH 29 329 197 HOH HOH A . F 5 HOH 30 330 51 HOH HOH A . F 5 HOH 31 331 241 HOH HOH A . F 5 HOH 32 332 231 HOH HOH A . F 5 HOH 33 333 253 HOH HOH A . F 5 HOH 34 334 3 HOH HOH A . F 5 HOH 35 335 108 HOH HOH A . F 5 HOH 36 336 129 HOH HOH A . F 5 HOH 37 337 195 HOH HOH A . F 5 HOH 38 338 14 HOH HOH A . F 5 HOH 39 339 17 HOH HOH A . F 5 HOH 40 340 159 HOH HOH A . F 5 HOH 41 341 25 HOH HOH A . F 5 HOH 42 342 211 HOH HOH A . F 5 HOH 43 343 19 HOH HOH A . F 5 HOH 44 344 200 HOH HOH A . F 5 HOH 45 345 249 HOH HOH A . F 5 HOH 46 346 234 HOH HOH A . F 5 HOH 47 347 247 HOH HOH A . F 5 HOH 48 348 176 HOH HOH A . F 5 HOH 49 349 22 HOH HOH A . F 5 HOH 50 350 175 HOH HOH A . F 5 HOH 51 351 225 HOH HOH A . F 5 HOH 52 352 6 HOH HOH A . F 5 HOH 53 353 28 HOH HOH A . F 5 HOH 54 354 20 HOH HOH A . F 5 HOH 55 355 239 HOH HOH A . F 5 HOH 56 356 236 HOH HOH A . F 5 HOH 57 357 245 HOH HOH A . F 5 HOH 58 358 24 HOH HOH A . F 5 HOH 59 359 182 HOH HOH A . F 5 HOH 60 360 140 HOH HOH A . F 5 HOH 61 361 120 HOH HOH A . F 5 HOH 62 362 46 HOH HOH A . F 5 HOH 63 363 112 HOH HOH A . F 5 HOH 64 364 2 HOH HOH A . F 5 HOH 65 365 139 HOH HOH A . F 5 HOH 66 366 52 HOH HOH A . F 5 HOH 67 367 41 HOH HOH A . F 5 HOH 68 368 237 HOH HOH A . F 5 HOH 69 369 251 HOH HOH A . F 5 HOH 70 370 26 HOH HOH A . F 5 HOH 71 371 235 HOH HOH A . F 5 HOH 72 372 240 HOH HOH A . F 5 HOH 73 373 194 HOH HOH A . F 5 HOH 74 374 205 HOH HOH A . F 5 HOH 75 375 252 HOH HOH A . F 5 HOH 76 376 201 HOH HOH A . F 5 HOH 77 377 209 HOH HOH A . F 5 HOH 78 378 71 HOH HOH A . F 5 HOH 79 379 213 HOH HOH A . F 5 HOH 80 380 202 HOH HOH A . F 5 HOH 81 381 233 HOH HOH A . F 5 HOH 82 382 92 HOH HOH A . F 5 HOH 83 383 207 HOH HOH A . F 5 HOH 84 384 101 HOH HOH A . F 5 HOH 85 385 190 HOH HOH A . F 5 HOH 86 386 40 HOH HOH A . F 5 HOH 87 387 244 HOH HOH A . F 5 HOH 88 388 242 HOH HOH A . F 5 HOH 89 389 192 HOH HOH A . F 5 HOH 90 390 54 HOH HOH A . F 5 HOH 91 391 147 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-16 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 15.7790 -2.4200 20.4880 0.6179 ? 0.0058 ? -0.1612 ? 0.3999 ? 0.0352 ? 0.4674 ? 9.5192 ? -1.4683 ? -3.0301 ? 5.4318 ? -1.4284 ? 8.0810 ? 0.0812 ? -0.0939 ? 0.1942 ? 0.9909 ? -0.1368 ? -1.0033 ? 0.3574 ? 1.0047 ? 0.0556 ? 2 'X-RAY DIFFRACTION' ? refined 4.1160 1.0380 4.5710 0.0798 ? -0.0275 ? 0.0454 ? 0.2736 ? -0.0117 ? 0.2634 ? 4.0507 ? -0.7312 ? 1.7732 ? 2.0633 ? -0.3688 ? 3.0942 ? 0.0293 ? 0.4239 ? -0.0385 ? 0.1752 ? -0.1484 ? 0.1486 ? 0.2072 ? -0.0562 ? 0.1190 ? 3 'X-RAY DIFFRACTION' ? refined 17.3190 4.4500 4.4980 0.0566 ? 0.0124 ? 0.0151 ? 0.2657 ? 0.0358 ? 0.2501 ? 12.3644 ? 1.5567 ? 6.1360 ? 5.9311 ? 3.4297 ? 6.6466 ? -0.0236 ? 0.4195 ? 0.4854 ? 0.1835 ? 0.0154 ? -0.1843 ? 0.0337 ? 0.1114 ? 0.0083 ? 4 'X-RAY DIFFRACTION' ? refined 12.9720 6.1950 12.7950 0.1080 ? -0.0084 ? -0.0306 ? 0.1936 ? 0.0119 ? 0.2033 ? 1.6712 ? 1.7420 ? -0.9240 ? 5.6817 ? -0.5307 ? 1.0441 ? 0.0126 ? 0.0725 ? -0.0374 ? 0.4177 ? 0.0073 ? -0.1675 ? 0.0620 ? 0.1259 ? -0.0199 ? 5 'X-RAY DIFFRACTION' ? refined 9.2520 6.9640 18.8710 0.3101 ? -0.0234 ? -0.0096 ? 0.1727 ? 0.0029 ? 0.2009 ? 3.3722 ? 2.1801 ? -0.7747 ? 4.7722 ? -0.2476 ? 0.5886 ? 0.0513 ? -0.0265 ? 0.1071 ? 0.9773 ? -0.0190 ? -0.0094 ? 0.0565 ? 0.1187 ? -0.0324 ? 6 'X-RAY DIFFRACTION' ? refined 13.3760 15.6660 17.0090 0.2302 ? -0.0167 ? -0.0307 ? 0.1751 ? -0.0156 ? 0.2077 ? 8.9179 ? -0.7147 ? 2.0019 ? 3.8181 ? -0.1849 ? 3.9949 ? -0.0362 ? -0.2116 ? -0.0455 ? 0.7484 ? -0.0042 ? -0.2655 ? 0.1118 ? 0.2394 ? 0.0403 ? 7 'X-RAY DIFFRACTION' ? refined 5.0210 20.9230 12.6290 0.0991 ? -0.0046 ? 0.0649 ? 0.1884 ? -0.0291 ? 0.2554 ? 2.2540 ? 0.6864 ? -0.2457 ? 4.6733 ? -0.5175 ? 3.6927 ? 0.1002 ? 0.2819 ? 0.1379 ? 0.3976 ? -0.0547 ? 0.3256 ? -0.1683 ? -0.1418 ? -0.0455 ? 8 'X-RAY DIFFRACTION' ? refined 13.8040 15.6750 29.2310 1.0651 ? -0.0063 ? -0.1829 ? 0.6589 ? -0.1073 ? 0.5126 ? 5.1962 ? 5.9522 ? 5.6406 ? 17.8960 ? 0.2024 ? 9.7438 ? 0.6124 ? -1.3021 ? 0.4079 ? 2.3293 ? -0.8823 ? 0.4745 ? -0.0588 ? -1.7068 ? 0.2699 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 9 ? ? ? A 19 ? ? ? 2 'X-RAY DIFFRACTION' 2 ? ? A 20 ? ? ? A 52 ? ? ? 3 'X-RAY DIFFRACTION' 3 ? ? A 53 ? ? ? A 67 ? ? ? 4 'X-RAY DIFFRACTION' 4 ? ? A 68 ? ? ? A 97 ? ? ? 5 'X-RAY DIFFRACTION' 5 ? ? A 98 ? ? ? A 130 ? ? ? 6 'X-RAY DIFFRACTION' 6 ? ? A 131 ? ? ? A 145 ? ? ? 7 'X-RAY DIFFRACTION' 7 ? ? A 146 ? ? ? A 183 ? ? ? 8 'X-RAY DIFFRACTION' 8 ? ? A 184 ? ? ? A 192 ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_entry_details.entry_id 7KYE _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 79 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -134.43 _pdbx_validate_torsion.psi -67.78 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A HIS 0 ? A HIS 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A ASN 2 ? A ASN 4 5 1 Y 1 A ALA 3 ? A ALA 5 6 1 Y 1 A ASN 4 ? A ASN 6 7 1 Y 1 A LEU 5 ? A LEU 7 8 1 Y 1 A PRO 6 ? A PRO 8 9 1 Y 1 A PRO 7 ? A PRO 9 10 1 Y 1 A SER 8 ? A SER 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 COA N1A N Y N 74 COA C2A C Y N 75 COA N3A N Y N 76 COA C4A C Y N 77 COA C5A C Y N 78 COA C6A C Y N 79 COA N6A N N N 80 COA N7A N Y N 81 COA C8A C Y N 82 COA N9A N Y N 83 COA C1B C N R 84 COA C2B C N R 85 COA O2B O N N 86 COA C3B C N S 87 COA O3B O N N 88 COA P3B P N N 89 COA O7A O N N 90 COA O8A O N N 91 COA O9A O N N 92 COA C4B C N R 93 COA O4B O N N 94 COA C5B C N N 95 COA O5B O N N 96 COA P1A P N S 97 COA O1A O N N 98 COA O2A O N N 99 COA O3A O N N 100 COA P2A P N S 101 COA O4A O N N 102 COA O5A O N N 103 COA O6A O N N 104 COA CBP C N N 105 COA CCP C N N 106 COA CDP C N N 107 COA CEP C N N 108 COA CAP C N R 109 COA OAP O N N 110 COA C9P C N N 111 COA O9P O N N 112 COA N8P N N N 113 COA C7P C N N 114 COA C6P C N N 115 COA C5P C N N 116 COA O5P O N N 117 COA N4P N N N 118 COA C3P C N N 119 COA C2P C N N 120 COA S1P S N N 121 COA H2A H N N 122 COA H61A H N N 123 COA H62A H N N 124 COA H8A H N N 125 COA H1B H N N 126 COA H2B H N N 127 COA HO2A H N N 128 COA H3B H N N 129 COA HOA8 H N N 130 COA HOA9 H N N 131 COA H4B H N N 132 COA H51A H N N 133 COA H52A H N N 134 COA HOA2 H N N 135 COA HOA5 H N N 136 COA H121 H N N 137 COA H122 H N N 138 COA H131 H N N 139 COA H132 H N N 140 COA H133 H N N 141 COA H141 H N N 142 COA H142 H N N 143 COA H143 H N N 144 COA H10 H N N 145 COA HO1 H N N 146 COA HN8 H N N 147 COA H71 H N N 148 COA H72 H N N 149 COA H61 H N N 150 COA H62 H N N 151 COA HN4 H N N 152 COA H31 H N N 153 COA H32 H N N 154 COA H21 H N N 155 COA H22 H N N 156 COA HS1 H N N 157 CYS N N N N 158 CYS CA C N R 159 CYS C C N N 160 CYS O O N N 161 CYS CB C N N 162 CYS SG S N N 163 CYS OXT O N N 164 CYS H H N N 165 CYS H2 H N N 166 CYS HA H N N 167 CYS HB2 H N N 168 CYS HB3 H N N 169 CYS HG H N N 170 CYS HXT H N N 171 EDO C1 C N N 172 EDO O1 O N N 173 EDO C2 C N N 174 EDO O2 O N N 175 EDO H11 H N N 176 EDO H12 H N N 177 EDO HO1 H N N 178 EDO H21 H N N 179 EDO H22 H N N 180 EDO HO2 H N N 181 GLN N N N N 182 GLN CA C N S 183 GLN C C N N 184 GLN O O N N 185 GLN CB C N N 186 GLN CG C N N 187 GLN CD C N N 188 GLN OE1 O N N 189 GLN NE2 N N N 190 GLN OXT O N N 191 GLN H H N N 192 GLN H2 H N N 193 GLN HA H N N 194 GLN HB2 H N N 195 GLN HB3 H N N 196 GLN HG2 H N N 197 GLN HG3 H N N 198 GLN HE21 H N N 199 GLN HE22 H N N 200 GLN HXT H N N 201 GLU N N N N 202 GLU CA C N S 203 GLU C C N N 204 GLU O O N N 205 GLU CB C N N 206 GLU CG C N N 207 GLU CD C N N 208 GLU OE1 O N N 209 GLU OE2 O N N 210 GLU OXT O N N 211 GLU H H N N 212 GLU H2 H N N 213 GLU HA H N N 214 GLU HB2 H N N 215 GLU HB3 H N N 216 GLU HG2 H N N 217 GLU HG3 H N N 218 GLU HE2 H N N 219 GLU HXT H N N 220 GLY N N N N 221 GLY CA C N N 222 GLY C C N N 223 GLY O O N N 224 GLY OXT O N N 225 GLY H H N N 226 GLY H2 H N N 227 GLY HA2 H N N 228 GLY HA3 H N N 229 GLY HXT H N N 230 HIS N N N N 231 HIS CA C N S 232 HIS C C N N 233 HIS O O N N 234 HIS CB C N N 235 HIS CG C Y N 236 HIS ND1 N Y N 237 HIS CD2 C Y N 238 HIS CE1 C Y N 239 HIS NE2 N Y N 240 HIS OXT O N N 241 HIS H H N N 242 HIS H2 H N N 243 HIS HA H N N 244 HIS HB2 H N N 245 HIS HB3 H N N 246 HIS HD1 H N N 247 HIS HD2 H N N 248 HIS HE1 H N N 249 HIS HE2 H N N 250 HIS HXT H N N 251 HOH O O N N 252 HOH H1 H N N 253 HOH H2 H N N 254 ILE N N N N 255 ILE CA C N S 256 ILE C C N N 257 ILE O O N N 258 ILE CB C N S 259 ILE CG1 C N N 260 ILE CG2 C N N 261 ILE CD1 C N N 262 ILE OXT O N N 263 ILE H H N N 264 ILE H2 H N N 265 ILE HA H N N 266 ILE HB H N N 267 ILE HG12 H N N 268 ILE HG13 H N N 269 ILE HG21 H N N 270 ILE HG22 H N N 271 ILE HG23 H N N 272 ILE HD11 H N N 273 ILE HD12 H N N 274 ILE HD13 H N N 275 ILE HXT H N N 276 LEU N N N N 277 LEU CA C N S 278 LEU C C N N 279 LEU O O N N 280 LEU CB C N N 281 LEU CG C N N 282 LEU CD1 C N N 283 LEU CD2 C N N 284 LEU OXT O N N 285 LEU H H N N 286 LEU H2 H N N 287 LEU HA H N N 288 LEU HB2 H N N 289 LEU HB3 H N N 290 LEU HG H N N 291 LEU HD11 H N N 292 LEU HD12 H N N 293 LEU HD13 H N N 294 LEU HD21 H N N 295 LEU HD22 H N N 296 LEU HD23 H N N 297 LEU HXT H N N 298 MET N N N N 299 MET CA C N S 300 MET C C N N 301 MET O O N N 302 MET CB C N N 303 MET CG C N N 304 MET SD S N N 305 MET CE C N N 306 MET OXT O N N 307 MET H H N N 308 MET H2 H N N 309 MET HA H N N 310 MET HB2 H N N 311 MET HB3 H N N 312 MET HG2 H N N 313 MET HG3 H N N 314 MET HE1 H N N 315 MET HE2 H N N 316 MET HE3 H N N 317 MET HXT H N N 318 NHE "C3'" C N N 319 NHE "C2'" C N N 320 NHE "C1'" C N N 321 NHE "C6'" C N N 322 NHE N N N N 323 NHE C1 C N N 324 NHE C2 C N N 325 NHE S S N N 326 NHE O1 O N N 327 NHE O2 O N N 328 NHE O3 O N N 329 NHE "C5'" C N N 330 NHE "C4'" C N N 331 NHE "H3'1" H N N 332 NHE "H3'2" H N N 333 NHE "H2'1" H N N 334 NHE "H2'2" H N N 335 NHE "HC'1" H N N 336 NHE "H6'1" H N N 337 NHE "H6'2" H N N 338 NHE HN H N N 339 NHE HC11 H N N 340 NHE HC12 H N N 341 NHE HC21 H N N 342 NHE HC22 H N N 343 NHE HO3 H N N 344 NHE "H5'1" H N N 345 NHE "H5'2" H N N 346 NHE "H4'1" H N N 347 NHE "H4'2" H N N 348 PHE N N N N 349 PHE CA C N S 350 PHE C C N N 351 PHE O O N N 352 PHE CB C N N 353 PHE CG C Y N 354 PHE CD1 C Y N 355 PHE CD2 C Y N 356 PHE CE1 C Y N 357 PHE CE2 C Y N 358 PHE CZ C Y N 359 PHE OXT O N N 360 PHE H H N N 361 PHE H2 H N N 362 PHE HA H N N 363 PHE HB2 H N N 364 PHE HB3 H N N 365 PHE HD1 H N N 366 PHE HD2 H N N 367 PHE HE1 H N N 368 PHE HE2 H N N 369 PHE HZ H N N 370 PHE HXT H N N 371 PRO N N N N 372 PRO CA C N S 373 PRO C C N N 374 PRO O O N N 375 PRO CB C N N 376 PRO CG C N N 377 PRO CD C N N 378 PRO OXT O N N 379 PRO H H N N 380 PRO HA H N N 381 PRO HB2 H N N 382 PRO HB3 H N N 383 PRO HG2 H N N 384 PRO HG3 H N N 385 PRO HD2 H N N 386 PRO HD3 H N N 387 PRO HXT H N N 388 SER N N N N 389 SER CA C N S 390 SER C C N N 391 SER O O N N 392 SER CB C N N 393 SER OG O N N 394 SER OXT O N N 395 SER H H N N 396 SER H2 H N N 397 SER HA H N N 398 SER HB2 H N N 399 SER HB3 H N N 400 SER HG H N N 401 SER HXT H N N 402 THR N N N N 403 THR CA C N S 404 THR C C N N 405 THR O O N N 406 THR CB C N R 407 THR OG1 O N N 408 THR CG2 C N N 409 THR OXT O N N 410 THR H H N N 411 THR H2 H N N 412 THR HA H N N 413 THR HB H N N 414 THR HG1 H N N 415 THR HG21 H N N 416 THR HG22 H N N 417 THR HG23 H N N 418 THR HXT H N N 419 TRP N N N N 420 TRP CA C N S 421 TRP C C N N 422 TRP O O N N 423 TRP CB C N N 424 TRP CG C Y N 425 TRP CD1 C Y N 426 TRP CD2 C Y N 427 TRP NE1 N Y N 428 TRP CE2 C Y N 429 TRP CE3 C Y N 430 TRP CZ2 C Y N 431 TRP CZ3 C Y N 432 TRP CH2 C Y N 433 TRP OXT O N N 434 TRP H H N N 435 TRP H2 H N N 436 TRP HA H N N 437 TRP HB2 H N N 438 TRP HB3 H N N 439 TRP HD1 H N N 440 TRP HE1 H N N 441 TRP HE3 H N N 442 TRP HZ2 H N N 443 TRP HZ3 H N N 444 TRP HH2 H N N 445 TRP HXT H N N 446 TYR N N N N 447 TYR CA C N S 448 TYR C C N N 449 TYR O O N N 450 TYR CB C N N 451 TYR CG C Y N 452 TYR CD1 C Y N 453 TYR CD2 C Y N 454 TYR CE1 C Y N 455 TYR CE2 C Y N 456 TYR CZ C Y N 457 TYR OH O N N 458 TYR OXT O N N 459 TYR H H N N 460 TYR H2 H N N 461 TYR HA H N N 462 TYR HB2 H N N 463 TYR HB3 H N N 464 TYR HD1 H N N 465 TYR HD2 H N N 466 TYR HE1 H N N 467 TYR HE2 H N N 468 TYR HH H N N 469 TYR HXT H N N 470 VAL N N N N 471 VAL CA C N S 472 VAL C C N N 473 VAL O O N N 474 VAL CB C N N 475 VAL CG1 C N N 476 VAL CG2 C N N 477 VAL OXT O N N 478 VAL H H N N 479 VAL H2 H N N 480 VAL HA H N N 481 VAL HB H N N 482 VAL HG11 H N N 483 VAL HG12 H N N 484 VAL HG13 H N N 485 VAL HG21 H N N 486 VAL HG22 H N N 487 VAL HG23 H N N 488 VAL HXT H N N 489 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 COA N1A C2A sing Y N 70 COA N1A C6A doub Y N 71 COA C2A N3A doub Y N 72 COA C2A H2A sing N N 73 COA N3A C4A sing Y N 74 COA C4A C5A doub Y N 75 COA C4A N9A sing Y N 76 COA C5A C6A sing Y N 77 COA C5A N7A sing Y N 78 COA C6A N6A sing N N 79 COA N6A H61A sing N N 80 COA N6A H62A sing N N 81 COA N7A C8A doub Y N 82 COA C8A N9A sing Y N 83 COA C8A H8A sing N N 84 COA N9A C1B sing N N 85 COA C1B C2B sing N N 86 COA C1B O4B sing N N 87 COA C1B H1B sing N N 88 COA C2B O2B sing N N 89 COA C2B C3B sing N N 90 COA C2B H2B sing N N 91 COA O2B HO2A sing N N 92 COA C3B O3B sing N N 93 COA C3B C4B sing N N 94 COA C3B H3B sing N N 95 COA O3B P3B sing N N 96 COA P3B O7A doub N N 97 COA P3B O8A sing N N 98 COA P3B O9A sing N N 99 COA O8A HOA8 sing N N 100 COA O9A HOA9 sing N N 101 COA C4B O4B sing N N 102 COA C4B C5B sing N N 103 COA C4B H4B sing N N 104 COA C5B O5B sing N N 105 COA C5B H51A sing N N 106 COA C5B H52A sing N N 107 COA O5B P1A sing N N 108 COA P1A O1A doub N N 109 COA P1A O2A sing N N 110 COA P1A O3A sing N N 111 COA O2A HOA2 sing N N 112 COA O3A P2A sing N N 113 COA P2A O4A doub N N 114 COA P2A O5A sing N N 115 COA P2A O6A sing N N 116 COA O5A HOA5 sing N N 117 COA O6A CCP sing N N 118 COA CBP CCP sing N N 119 COA CBP CDP sing N N 120 COA CBP CEP sing N N 121 COA CBP CAP sing N N 122 COA CCP H121 sing N N 123 COA CCP H122 sing N N 124 COA CDP H131 sing N N 125 COA CDP H132 sing N N 126 COA CDP H133 sing N N 127 COA CEP H141 sing N N 128 COA CEP H142 sing N N 129 COA CEP H143 sing N N 130 COA CAP OAP sing N N 131 COA CAP C9P sing N N 132 COA CAP H10 sing N N 133 COA OAP HO1 sing N N 134 COA C9P O9P doub N N 135 COA C9P N8P sing N N 136 COA N8P C7P sing N N 137 COA N8P HN8 sing N N 138 COA C7P C6P sing N N 139 COA C7P H71 sing N N 140 COA C7P H72 sing N N 141 COA C6P C5P sing N N 142 COA C6P H61 sing N N 143 COA C6P H62 sing N N 144 COA C5P O5P doub N N 145 COA C5P N4P sing N N 146 COA N4P C3P sing N N 147 COA N4P HN4 sing N N 148 COA C3P C2P sing N N 149 COA C3P H31 sing N N 150 COA C3P H32 sing N N 151 COA C2P S1P sing N N 152 COA C2P H21 sing N N 153 COA C2P H22 sing N N 154 COA S1P HS1 sing N N 155 CYS N CA sing N N 156 CYS N H sing N N 157 CYS N H2 sing N N 158 CYS CA C sing N N 159 CYS CA CB sing N N 160 CYS CA HA sing N N 161 CYS C O doub N N 162 CYS C OXT sing N N 163 CYS CB SG sing N N 164 CYS CB HB2 sing N N 165 CYS CB HB3 sing N N 166 CYS SG HG sing N N 167 CYS OXT HXT sing N N 168 EDO C1 O1 sing N N 169 EDO C1 C2 sing N N 170 EDO C1 H11 sing N N 171 EDO C1 H12 sing N N 172 EDO O1 HO1 sing N N 173 EDO C2 O2 sing N N 174 EDO C2 H21 sing N N 175 EDO C2 H22 sing N N 176 EDO O2 HO2 sing N N 177 GLN N CA sing N N 178 GLN N H sing N N 179 GLN N H2 sing N N 180 GLN CA C sing N N 181 GLN CA CB sing N N 182 GLN CA HA sing N N 183 GLN C O doub N N 184 GLN C OXT sing N N 185 GLN CB CG sing N N 186 GLN CB HB2 sing N N 187 GLN CB HB3 sing N N 188 GLN CG CD sing N N 189 GLN CG HG2 sing N N 190 GLN CG HG3 sing N N 191 GLN CD OE1 doub N N 192 GLN CD NE2 sing N N 193 GLN NE2 HE21 sing N N 194 GLN NE2 HE22 sing N N 195 GLN OXT HXT sing N N 196 GLU N CA sing N N 197 GLU N H sing N N 198 GLU N H2 sing N N 199 GLU CA C sing N N 200 GLU CA CB sing N N 201 GLU CA HA sing N N 202 GLU C O doub N N 203 GLU C OXT sing N N 204 GLU CB CG sing N N 205 GLU CB HB2 sing N N 206 GLU CB HB3 sing N N 207 GLU CG CD sing N N 208 GLU CG HG2 sing N N 209 GLU CG HG3 sing N N 210 GLU CD OE1 doub N N 211 GLU CD OE2 sing N N 212 GLU OE2 HE2 sing N N 213 GLU OXT HXT sing N N 214 GLY N CA sing N N 215 GLY N H sing N N 216 GLY N H2 sing N N 217 GLY CA C sing N N 218 GLY CA HA2 sing N N 219 GLY CA HA3 sing N N 220 GLY C O doub N N 221 GLY C OXT sing N N 222 GLY OXT HXT sing N N 223 HIS N CA sing N N 224 HIS N H sing N N 225 HIS N H2 sing N N 226 HIS CA C sing N N 227 HIS CA CB sing N N 228 HIS CA HA sing N N 229 HIS C O doub N N 230 HIS C OXT sing N N 231 HIS CB CG sing N N 232 HIS CB HB2 sing N N 233 HIS CB HB3 sing N N 234 HIS CG ND1 sing Y N 235 HIS CG CD2 doub Y N 236 HIS ND1 CE1 doub Y N 237 HIS ND1 HD1 sing N N 238 HIS CD2 NE2 sing Y N 239 HIS CD2 HD2 sing N N 240 HIS CE1 NE2 sing Y N 241 HIS CE1 HE1 sing N N 242 HIS NE2 HE2 sing N N 243 HIS OXT HXT sing N N 244 HOH O H1 sing N N 245 HOH O H2 sing N N 246 ILE N CA sing N N 247 ILE N H sing N N 248 ILE N H2 sing N N 249 ILE CA C sing N N 250 ILE CA CB sing N N 251 ILE CA HA sing N N 252 ILE C O doub N N 253 ILE C OXT sing N N 254 ILE CB CG1 sing N N 255 ILE CB CG2 sing N N 256 ILE CB HB sing N N 257 ILE CG1 CD1 sing N N 258 ILE CG1 HG12 sing N N 259 ILE CG1 HG13 sing N N 260 ILE CG2 HG21 sing N N 261 ILE CG2 HG22 sing N N 262 ILE CG2 HG23 sing N N 263 ILE CD1 HD11 sing N N 264 ILE CD1 HD12 sing N N 265 ILE CD1 HD13 sing N N 266 ILE OXT HXT sing N N 267 LEU N CA sing N N 268 LEU N H sing N N 269 LEU N H2 sing N N 270 LEU CA C sing N N 271 LEU CA CB sing N N 272 LEU CA HA sing N N 273 LEU C O doub N N 274 LEU C OXT sing N N 275 LEU CB CG sing N N 276 LEU CB HB2 sing N N 277 LEU CB HB3 sing N N 278 LEU CG CD1 sing N N 279 LEU CG CD2 sing N N 280 LEU CG HG sing N N 281 LEU CD1 HD11 sing N N 282 LEU CD1 HD12 sing N N 283 LEU CD1 HD13 sing N N 284 LEU CD2 HD21 sing N N 285 LEU CD2 HD22 sing N N 286 LEU CD2 HD23 sing N N 287 LEU OXT HXT sing N N 288 MET N CA sing N N 289 MET N H sing N N 290 MET N H2 sing N N 291 MET CA C sing N N 292 MET CA CB sing N N 293 MET CA HA sing N N 294 MET C O doub N N 295 MET C OXT sing N N 296 MET CB CG sing N N 297 MET CB HB2 sing N N 298 MET CB HB3 sing N N 299 MET CG SD sing N N 300 MET CG HG2 sing N N 301 MET CG HG3 sing N N 302 MET SD CE sing N N 303 MET CE HE1 sing N N 304 MET CE HE2 sing N N 305 MET CE HE3 sing N N 306 MET OXT HXT sing N N 307 NHE "C3'" "C2'" sing N N 308 NHE "C3'" "C4'" sing N N 309 NHE "C3'" "H3'1" sing N N 310 NHE "C3'" "H3'2" sing N N 311 NHE "C2'" "C1'" sing N N 312 NHE "C2'" "H2'1" sing N N 313 NHE "C2'" "H2'2" sing N N 314 NHE "C1'" "C6'" sing N N 315 NHE "C1'" N sing N N 316 NHE "C1'" "HC'1" sing N N 317 NHE "C6'" "C5'" sing N N 318 NHE "C6'" "H6'1" sing N N 319 NHE "C6'" "H6'2" sing N N 320 NHE N C1 sing N N 321 NHE N HN sing N N 322 NHE C1 C2 sing N N 323 NHE C1 HC11 sing N N 324 NHE C1 HC12 sing N N 325 NHE C2 S sing N N 326 NHE C2 HC21 sing N N 327 NHE C2 HC22 sing N N 328 NHE S O1 doub N N 329 NHE S O2 doub N N 330 NHE S O3 sing N N 331 NHE O3 HO3 sing N N 332 NHE "C5'" "C4'" sing N N 333 NHE "C5'" "H5'1" sing N N 334 NHE "C5'" "H5'2" sing N N 335 NHE "C4'" "H4'1" sing N N 336 NHE "C4'" "H4'2" sing N N 337 PHE N CA sing N N 338 PHE N H sing N N 339 PHE N H2 sing N N 340 PHE CA C sing N N 341 PHE CA CB sing N N 342 PHE CA HA sing N N 343 PHE C O doub N N 344 PHE C OXT sing N N 345 PHE CB CG sing N N 346 PHE CB HB2 sing N N 347 PHE CB HB3 sing N N 348 PHE CG CD1 doub Y N 349 PHE CG CD2 sing Y N 350 PHE CD1 CE1 sing Y N 351 PHE CD1 HD1 sing N N 352 PHE CD2 CE2 doub Y N 353 PHE CD2 HD2 sing N N 354 PHE CE1 CZ doub Y N 355 PHE CE1 HE1 sing N N 356 PHE CE2 CZ sing Y N 357 PHE CE2 HE2 sing N N 358 PHE CZ HZ sing N N 359 PHE OXT HXT sing N N 360 PRO N CA sing N N 361 PRO N CD sing N N 362 PRO N H sing N N 363 PRO CA C sing N N 364 PRO CA CB sing N N 365 PRO CA HA sing N N 366 PRO C O doub N N 367 PRO C OXT sing N N 368 PRO CB CG sing N N 369 PRO CB HB2 sing N N 370 PRO CB HB3 sing N N 371 PRO CG CD sing N N 372 PRO CG HG2 sing N N 373 PRO CG HG3 sing N N 374 PRO CD HD2 sing N N 375 PRO CD HD3 sing N N 376 PRO OXT HXT sing N N 377 SER N CA sing N N 378 SER N H sing N N 379 SER N H2 sing N N 380 SER CA C sing N N 381 SER CA CB sing N N 382 SER CA HA sing N N 383 SER C O doub N N 384 SER C OXT sing N N 385 SER CB OG sing N N 386 SER CB HB2 sing N N 387 SER CB HB3 sing N N 388 SER OG HG sing N N 389 SER OXT HXT sing N N 390 THR N CA sing N N 391 THR N H sing N N 392 THR N H2 sing N N 393 THR CA C sing N N 394 THR CA CB sing N N 395 THR CA HA sing N N 396 THR C O doub N N 397 THR C OXT sing N N 398 THR CB OG1 sing N N 399 THR CB CG2 sing N N 400 THR CB HB sing N N 401 THR OG1 HG1 sing N N 402 THR CG2 HG21 sing N N 403 THR CG2 HG22 sing N N 404 THR CG2 HG23 sing N N 405 THR OXT HXT sing N N 406 TRP N CA sing N N 407 TRP N H sing N N 408 TRP N H2 sing N N 409 TRP CA C sing N N 410 TRP CA CB sing N N 411 TRP CA HA sing N N 412 TRP C O doub N N 413 TRP C OXT sing N N 414 TRP CB CG sing N N 415 TRP CB HB2 sing N N 416 TRP CB HB3 sing N N 417 TRP CG CD1 doub Y N 418 TRP CG CD2 sing Y N 419 TRP CD1 NE1 sing Y N 420 TRP CD1 HD1 sing N N 421 TRP CD2 CE2 doub Y N 422 TRP CD2 CE3 sing Y N 423 TRP NE1 CE2 sing Y N 424 TRP NE1 HE1 sing N N 425 TRP CE2 CZ2 sing Y N 426 TRP CE3 CZ3 doub Y N 427 TRP CE3 HE3 sing N N 428 TRP CZ2 CH2 doub Y N 429 TRP CZ2 HZ2 sing N N 430 TRP CZ3 CH2 sing Y N 431 TRP CZ3 HZ3 sing N N 432 TRP CH2 HH2 sing N N 433 TRP OXT HXT sing N N 434 TYR N CA sing N N 435 TYR N H sing N N 436 TYR N H2 sing N N 437 TYR CA C sing N N 438 TYR CA CB sing N N 439 TYR CA HA sing N N 440 TYR C O doub N N 441 TYR C OXT sing N N 442 TYR CB CG sing N N 443 TYR CB HB2 sing N N 444 TYR CB HB3 sing N N 445 TYR CG CD1 doub Y N 446 TYR CG CD2 sing Y N 447 TYR CD1 CE1 sing Y N 448 TYR CD1 HD1 sing N N 449 TYR CD2 CE2 doub Y N 450 TYR CD2 HD2 sing N N 451 TYR CE1 CZ doub Y N 452 TYR CE1 HE1 sing N N 453 TYR CE2 CZ sing Y N 454 TYR CE2 HE2 sing N N 455 TYR CZ OH sing N N 456 TYR OH HH sing N N 457 TYR OXT HXT sing N N 458 VAL N CA sing N N 459 VAL N H sing N N 460 VAL N H2 sing N N 461 VAL CA C sing N N 462 VAL CA CB sing N N 463 VAL CA HA sing N N 464 VAL C O doub N N 465 VAL C OXT sing N N 466 VAL CB CG1 sing N N 467 VAL CB CG2 sing N N 468 VAL CB HB sing N N 469 VAL CG1 HG11 sing N N 470 VAL CG1 HG12 sing N N 471 VAL CG1 HG13 sing N N 472 VAL CG2 HG21 sing N N 473 VAL CG2 HG22 sing N N 474 VAL CG2 HG23 sing N N 475 VAL OXT HXT sing N N 476 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 COA ? ? COA ? ? 'SUBJECT OF INVESTIGATION' ? 2 NHE ? ? NHE ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COENZYME A' COA 3 '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' NHE 4 1,2-ETHANEDIOL EDO 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6EDD _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 1 homology ? #