data_7L1I # _entry.id 7L1I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7L1I pdb_00007l1i 10.2210/pdb7l1i/pdb WWPDB D_1000253169 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7L1I _pdbx_database_status.recvd_initial_deposition_date 2020-12-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Walton, W.G.' 1 0000-0001-6745-534X 'Lietzan, A.D.' 2 0000-0001-6388-2491 'Redinbo, M.R.' 3 0000-0003-0814-5346 'Dangl, J.L.' 4 0000-0003-3199-8654 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Microbiol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2058-5276 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 1817 _citation.page_last 1833 _citation.title 'Diverse MarR bacterial regulators of auxin catabolism in the plant microbiome.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41564-022-01244-3 _citation.pdbx_database_id_PubMed 36266335 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Conway, J.M.' 1 0000-0002-2715-2149 primary 'Walton, W.G.' 2 ? primary 'Salas-Gonzalez, I.' 3 0000-0002-0347-5058 primary 'Law, T.F.' 4 ? primary 'Lindberg, C.A.' 5 ? primary 'Crook, L.E.' 6 ? primary 'Kosina, S.M.' 7 0000-0003-2885-1248 primary 'Fitzpatrick, C.R.' 8 ? primary 'Lietzan, A.D.' 9 0000-0001-6388-2491 primary 'Northen, T.R.' 10 0000-0001-8404-3259 primary 'Jones, C.D.' 11 ? primary 'Finkel, O.M.' 12 0000-0003-4770-0402 primary 'Redinbo, M.R.' 13 0000-0003-0814-5346 primary 'Dangl, J.L.' 14 0000-0003-3199-8654 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7L1I _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.672 _cell.length_a_esd ? _cell.length_b 72.672 _cell.length_b_esd ? _cell.length_c 125.125 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7L1I _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MarR family multidrug resistance pump transcriptional regulator' 20127.865 1 ? ? ? ? 2 non-polymer syn '1H-INDOL-3-YLACETIC ACID' 175.184 1 ? ? ? ? 3 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 4 water nat water 18.015 9 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSNAMLDHLEQFLPNKEPSSIQNFPFFWISQVNGKYSQLIEKSIKKLGIDNTRRKIILST NALGEASITDIANLSTLKLTTATKAVYRLVEDGIVEVYSSTTDERISMVKLTAKGVELVEQINQISVVTLAGILNAFSED ELHNLNHQLKKLFDLMPSS ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSNAMLDHLEQFLPNKEPSSIQNFPFFWISQVNGKYSQLIEKSIKKLGIDNTRRKIILST NALGEASITDIANLSTLKLTTATKAVYRLVEDGIVEVYSSTTDERISMVKLTAKGVELVEQINQISVVTLAGILNAFSED ELHNLNHQLKKLFDLMPSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 ASN n 1 24 ALA n 1 25 MET n 1 26 LEU n 1 27 ASP n 1 28 HIS n 1 29 LEU n 1 30 GLU n 1 31 GLN n 1 32 PHE n 1 33 LEU n 1 34 PRO n 1 35 ASN n 1 36 LYS n 1 37 GLU n 1 38 PRO n 1 39 SER n 1 40 SER n 1 41 ILE n 1 42 GLN n 1 43 ASN n 1 44 PHE n 1 45 PRO n 1 46 PHE n 1 47 PHE n 1 48 TRP n 1 49 ILE n 1 50 SER n 1 51 GLN n 1 52 VAL n 1 53 ASN n 1 54 GLY n 1 55 LYS n 1 56 TYR n 1 57 SER n 1 58 GLN n 1 59 LEU n 1 60 ILE n 1 61 GLU n 1 62 LYS n 1 63 SER n 1 64 ILE n 1 65 LYS n 1 66 LYS n 1 67 LEU n 1 68 GLY n 1 69 ILE n 1 70 ASP n 1 71 ASN n 1 72 THR n 1 73 ARG n 1 74 ARG n 1 75 LYS n 1 76 ILE n 1 77 ILE n 1 78 LEU n 1 79 SER n 1 80 THR n 1 81 ASN n 1 82 ALA n 1 83 LEU n 1 84 GLY n 1 85 GLU n 1 86 ALA n 1 87 SER n 1 88 ILE n 1 89 THR n 1 90 ASP n 1 91 ILE n 1 92 ALA n 1 93 ASN n 1 94 LEU n 1 95 SER n 1 96 THR n 1 97 LEU n 1 98 LYS n 1 99 LEU n 1 100 THR n 1 101 THR n 1 102 ALA n 1 103 THR n 1 104 LYS n 1 105 ALA n 1 106 VAL n 1 107 TYR n 1 108 ARG n 1 109 LEU n 1 110 VAL n 1 111 GLU n 1 112 ASP n 1 113 GLY n 1 114 ILE n 1 115 VAL n 1 116 GLU n 1 117 VAL n 1 118 TYR n 1 119 SER n 1 120 SER n 1 121 THR n 1 122 THR n 1 123 ASP n 1 124 GLU n 1 125 ARG n 1 126 ILE n 1 127 SER n 1 128 MET n 1 129 VAL n 1 130 LYS n 1 131 LEU n 1 132 THR n 1 133 ALA n 1 134 LYS n 1 135 GLY n 1 136 VAL n 1 137 GLU n 1 138 LEU n 1 139 VAL n 1 140 GLU n 1 141 GLN n 1 142 ILE n 1 143 ASN n 1 144 GLN n 1 145 ILE n 1 146 SER n 1 147 VAL n 1 148 VAL n 1 149 THR n 1 150 LEU n 1 151 ALA n 1 152 GLY n 1 153 ILE n 1 154 LEU n 1 155 ASN n 1 156 ALA n 1 157 PHE n 1 158 SER n 1 159 GLU n 1 160 ASP n 1 161 GLU n 1 162 LEU n 1 163 HIS n 1 164 ASN n 1 165 LEU n 1 166 ASN n 1 167 HIS n 1 168 GLN n 1 169 LEU n 1 170 LYS n 1 171 LYS n 1 172 LEU n 1 173 PHE n 1 174 ASP n 1 175 LEU n 1 176 MET n 1 177 PRO n 1 178 SER n 1 179 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 179 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'marR_1, NCTC13305_00397' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter baumannii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 470 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A334T093_ACIBA _struct_ref.pdbx_db_accession A0A334T093 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AMLDHLEQFLPNKEPSSIQNFPFFWISQVNGKYSQLIEKSIKKLGIDNTRRKIILSTNALGEASITDIANLSTLKLTTAT KAVYRLVEDGIVEVYSSTTDERISMVKLTAKGVELVEQINQISVVTLAGILNAFSEDELHNLNHQLKKLFDLMPSS ; _struct_ref.pdbx_align_begin 19 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7L1I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A334T093 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 155 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7L1I MET A 1 ? UNP A0A334T093 ? ? 'initiating methionine' -23 1 1 7L1I HIS A 2 ? UNP A0A334T093 ? ? 'expression tag' -22 2 1 7L1I HIS A 3 ? UNP A0A334T093 ? ? 'expression tag' -21 3 1 7L1I HIS A 4 ? UNP A0A334T093 ? ? 'expression tag' -20 4 1 7L1I HIS A 5 ? UNP A0A334T093 ? ? 'expression tag' -19 5 1 7L1I HIS A 6 ? UNP A0A334T093 ? ? 'expression tag' -18 6 1 7L1I HIS A 7 ? UNP A0A334T093 ? ? 'expression tag' -17 7 1 7L1I SER A 8 ? UNP A0A334T093 ? ? 'expression tag' -16 8 1 7L1I SER A 9 ? UNP A0A334T093 ? ? 'expression tag' -15 9 1 7L1I GLY A 10 ? UNP A0A334T093 ? ? 'expression tag' -14 10 1 7L1I VAL A 11 ? UNP A0A334T093 ? ? 'expression tag' -13 11 1 7L1I ASP A 12 ? UNP A0A334T093 ? ? 'expression tag' -12 12 1 7L1I LEU A 13 ? UNP A0A334T093 ? ? 'expression tag' -11 13 1 7L1I GLY A 14 ? UNP A0A334T093 ? ? 'expression tag' -10 14 1 7L1I THR A 15 ? UNP A0A334T093 ? ? 'expression tag' -9 15 1 7L1I GLU A 16 ? UNP A0A334T093 ? ? 'expression tag' -8 16 1 7L1I ASN A 17 ? UNP A0A334T093 ? ? 'expression tag' -7 17 1 7L1I LEU A 18 ? UNP A0A334T093 ? ? 'expression tag' -6 18 1 7L1I TYR A 19 ? UNP A0A334T093 ? ? 'expression tag' -5 19 1 7L1I PHE A 20 ? UNP A0A334T093 ? ? 'expression tag' -4 20 1 7L1I GLN A 21 ? UNP A0A334T093 ? ? 'expression tag' -3 21 1 7L1I SER A 22 ? UNP A0A334T093 ? ? 'expression tag' -2 22 1 7L1I ASN A 23 ? UNP A0A334T093 ? ? 'expression tag' -1 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IAC non-polymer . '1H-INDOL-3-YLACETIC ACID' 'INDOLE ACETIC ACID' 'C10 H9 N O2' 175.184 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7L1I _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M CHES: NaOH, pH 9.5, 30 % (w/v) PEG 3000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7L1I _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.350 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8439 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.400 _reflns.pdbx_Rmerge_I_obs 0.101 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.271 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.105 _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 121829 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.350 2.390 ? ? ? ? ? ? 321 77.500 ? ? ? ? 0.734 ? ? ? ? ? ? ? ? 5.100 ? 0.523 ? ? 0.810 0.333 ? 1 1 0.782 ? ? ? ? ? ? ? ? ? ? 2.390 2.430 ? ? ? ? ? ? 364 83.100 ? ? ? ? 0.582 ? ? ? ? ? ? ? ? 5.700 ? 0.490 ? ? 0.636 0.250 ? 2 1 0.832 ? ? ? ? ? ? ? ? ? ? 2.430 2.480 ? ? ? ? ? ? 358 88.200 ? ? ? ? 0.505 ? ? ? ? ? ? ? ? 6.900 ? 0.555 ? ? 0.542 0.194 ? 3 1 0.887 ? ? ? ? ? ? ? ? ? ? 2.480 2.530 ? ? ? ? ? ? 389 92.000 ? ? ? ? 0.460 ? ? ? ? ? ? ? ? 8.000 ? 0.531 ? ? 0.490 0.166 ? 4 1 0.915 ? ? ? ? ? ? ? ? ? ? 2.530 2.590 ? ? ? ? ? ? 404 94.600 ? ? ? ? 0.460 ? ? ? ? ? ? ? ? 9.700 ? 0.563 ? ? 0.485 0.151 ? 5 1 0.940 ? ? ? ? ? ? ? ? ? ? 2.590 2.650 ? ? ? ? ? ? 412 99.300 ? ? ? ? 0.434 ? ? ? ? ? ? ? ? 11.300 ? 0.560 ? ? 0.454 0.129 ? 6 1 0.949 ? ? ? ? ? ? ? ? ? ? 2.650 2.710 ? ? ? ? ? ? 420 100.000 ? ? ? ? 0.358 ? ? ? ? ? ? ? ? 14.200 ? 0.602 ? ? 0.371 0.097 ? 7 1 0.974 ? ? ? ? ? ? ? ? ? ? 2.710 2.790 ? ? ? ? ? ? 437 100.000 ? ? ? ? 0.324 ? ? ? ? ? ? ? ? 15.900 ? 0.664 ? ? 0.335 0.082 ? 8 1 0.979 ? ? ? ? ? ? ? ? ? ? 2.790 2.870 ? ? ? ? ? ? 424 100.000 ? ? ? ? 0.263 ? ? ? ? ? ? ? ? 17.800 ? 0.748 ? ? 0.271 0.064 ? 9 1 0.989 ? ? ? ? ? ? ? ? ? ? 2.870 2.960 ? ? ? ? ? ? 423 99.800 ? ? ? ? 0.265 ? ? ? ? ? ? ? ? 18.200 ? 0.761 ? ? 0.273 0.063 ? 10 1 0.986 ? ? ? ? ? ? ? ? ? ? 2.960 3.070 ? ? ? ? ? ? 426 100.000 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 17.100 ? 1.072 ? ? 0.208 0.050 ? 11 1 0.986 ? ? ? ? ? ? ? ? ? ? 3.070 3.190 ? ? ? ? ? ? 425 100.000 ? ? ? ? 0.173 ? ? ? ? ? ? ? ? 17.600 ? 1.366 ? ? 0.178 0.042 ? 12 1 0.990 ? ? ? ? ? ? ? ? ? ? 3.190 3.330 ? ? ? ? ? ? 434 100.000 ? ? ? ? 0.144 ? ? ? ? ? ? ? ? 16.900 ? 1.515 ? ? 0.149 0.036 ? 13 1 0.992 ? ? ? ? ? ? ? ? ? ? 3.330 3.510 ? ? ? ? ? ? 434 100.000 ? ? ? ? 0.123 ? ? ? ? ? ? ? ? 18.100 ? 1.578 ? ? 0.126 0.029 ? 14 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.510 3.730 ? ? ? ? ? ? 432 100.000 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 17.200 ? 2.572 ? ? 0.111 0.027 ? 15 1 0.994 ? ? ? ? ? ? ? ? ? ? 3.730 4.020 ? ? ? ? ? ? 448 100.000 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 17.100 ? 2.732 ? ? 0.103 0.025 ? 16 1 0.991 ? ? ? ? ? ? ? ? ? ? 4.020 4.420 ? ? ? ? ? ? 435 99.500 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 17.500 ? 3.206 ? ? 0.087 0.020 ? 17 1 0.997 ? ? ? ? ? ? ? ? ? ? 4.420 5.060 ? ? ? ? ? ? 458 100.000 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 16.700 ? 3.627 ? ? 0.085 0.021 ? 18 1 0.998 ? ? ? ? ? ? ? ? ? ? 5.060 6.370 ? ? ? ? ? ? 467 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 16.900 ? 4.016 ? ? 0.081 0.019 ? 19 1 0.995 ? ? ? ? ? ? ? ? ? ? 6.370 50.000 ? ? ? ? ? ? 528 100.000 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 14.500 ? 10.530 ? ? 0.086 0.022 ? 20 1 0.996 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -1.0400 _refine.aniso_B[1][2] -0.5200 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -1.0400 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 3.3900 _refine.B_iso_max 149.420 _refine.B_iso_mean 63.6260 _refine.B_iso_min 38.310 _refine.correlation_coeff_Fo_to_Fc 0.9580 _refine.correlation_coeff_Fo_to_Fc_free 0.9380 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7L1I _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3500 _refine.ls_d_res_low 36.3600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7995 _refine.ls_number_reflns_R_free 404 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.8200 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2160 _refine.ls_R_factor_R_free 0.2586 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2140 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7KUA _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3790 _refine.pdbx_overall_ESU_R_Free 0.2580 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 21.4900 _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3500 _refine_hist.d_res_low 36.3600 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1352 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 169 _refine_hist.pdbx_B_iso_mean_ligand 50.95 _refine_hist.pdbx_B_iso_mean_solvent 60.56 _refine_hist.pdbx_number_atoms_protein 1329 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.013 1376 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1340 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.787 1.645 1864 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.533 1.585 3088 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.224 5.000 170 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.976 25.000 64 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.582 15.000 255 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.505 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.086 0.200 188 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1545 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 299 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.3510 _refine_ls_shell.d_res_low 2.4120 _refine_ls_shell.number_reflns_all 496 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_R_work 473 _refine_ls_shell.percent_reflns_obs 78.6100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2790 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3020 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7L1I _struct.title 'Crystal structure of the MarR family transcriptional regulator from Acineotobacter baumannii bound to Indole 3 acetic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7L1I _struct_keywords.text 'Transcriptional Regulator, Ligand Binding, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 22 ? GLN A 31 ? SER A -2 GLN A 7 1 ? 10 HELX_P HELX_P2 AA2 SER A 39 ? ASN A 43 ? SER A 15 ASN A 19 5 ? 5 HELX_P HELX_P3 AA3 PHE A 44 ? LYS A 65 ? PHE A 20 LYS A 41 1 ? 22 HELX_P HELX_P4 AA4 ASP A 70 ? GLY A 84 ? ASP A 46 GLY A 60 1 ? 15 HELX_P HELX_P5 AA5 ILE A 88 ? SER A 95 ? ILE A 64 SER A 71 1 ? 8 HELX_P HELX_P6 AA6 LYS A 98 ? ASP A 112 ? LYS A 74 ASP A 88 1 ? 15 HELX_P HELX_P7 AA7 THR A 132 ? ALA A 156 ? THR A 108 ALA A 132 1 ? 25 HELX_P HELX_P8 AA8 SER A 158 ? MET A 176 ? SER A 134 MET A 152 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 86 ? SER A 87 ? ALA A 62 SER A 63 AA1 2 SER A 127 ? LEU A 131 ? SER A 103 LEU A 107 AA1 3 VAL A 115 ? SER A 119 ? VAL A 91 SER A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 86 ? N ALA A 62 O VAL A 129 ? O VAL A 105 AA1 2 3 O MET A 128 ? O MET A 104 N TYR A 118 ? N TYR A 94 # _atom_sites.entry_id 7L1I _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013760 _atom_sites.fract_transf_matrix[1][2] 0.007945 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015889 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007992 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -23 ? ? ? A . n A 1 2 HIS 2 -22 ? ? ? A . n A 1 3 HIS 3 -21 ? ? ? A . n A 1 4 HIS 4 -20 ? ? ? A . n A 1 5 HIS 5 -19 ? ? ? A . n A 1 6 HIS 6 -18 ? ? ? A . n A 1 7 HIS 7 -17 ? ? ? A . n A 1 8 SER 8 -16 ? ? ? A . n A 1 9 SER 9 -15 ? ? ? A . n A 1 10 GLY 10 -14 -14 GLY GLY A . n A 1 11 VAL 11 -13 -13 VAL VAL A . n A 1 12 ASP 12 -12 -12 ASP ASP A . n A 1 13 LEU 13 -11 -11 LEU LEU A . n A 1 14 GLY 14 -10 -10 GLY GLY A . n A 1 15 THR 15 -9 -9 THR THR A . n A 1 16 GLU 16 -8 -8 GLU GLU A . n A 1 17 ASN 17 -7 -7 ASN ASN A . n A 1 18 LEU 18 -6 -6 LEU LEU A . n A 1 19 TYR 19 -5 -5 TYR TYR A . n A 1 20 PHE 20 -4 -4 PHE PHE A . n A 1 21 GLN 21 -3 -3 GLN GLN A . n A 1 22 SER 22 -2 -2 SER SER A . n A 1 23 ASN 23 -1 -1 ASN ASN A . n A 1 24 ALA 24 0 0 ALA ALA A . n A 1 25 MET 25 1 1 MET MET A . n A 1 26 LEU 26 2 2 LEU LEU A . n A 1 27 ASP 27 3 3 ASP ASP A . n A 1 28 HIS 28 4 4 HIS HIS A . n A 1 29 LEU 29 5 5 LEU LEU A . n A 1 30 GLU 30 6 6 GLU GLU A . n A 1 31 GLN 31 7 7 GLN GLN A . n A 1 32 PHE 32 8 8 PHE PHE A . n A 1 33 LEU 33 9 9 LEU LEU A . n A 1 34 PRO 34 10 10 PRO PRO A . n A 1 35 ASN 35 11 11 ASN ASN A . n A 1 36 LYS 36 12 12 LYS LYS A . n A 1 37 GLU 37 13 13 GLU GLU A . n A 1 38 PRO 38 14 14 PRO PRO A . n A 1 39 SER 39 15 15 SER SER A . n A 1 40 SER 40 16 16 SER SER A . n A 1 41 ILE 41 17 17 ILE ILE A . n A 1 42 GLN 42 18 18 GLN GLN A . n A 1 43 ASN 43 19 19 ASN ASN A . n A 1 44 PHE 44 20 20 PHE PHE A . n A 1 45 PRO 45 21 21 PRO PRO A . n A 1 46 PHE 46 22 22 PHE PHE A . n A 1 47 PHE 47 23 23 PHE PHE A . n A 1 48 TRP 48 24 24 TRP TRP A . n A 1 49 ILE 49 25 25 ILE ILE A . n A 1 50 SER 50 26 26 SER SER A . n A 1 51 GLN 51 27 27 GLN GLN A . n A 1 52 VAL 52 28 28 VAL VAL A . n A 1 53 ASN 53 29 29 ASN ASN A . n A 1 54 GLY 54 30 30 GLY GLY A . n A 1 55 LYS 55 31 31 LYS LYS A . n A 1 56 TYR 56 32 32 TYR TYR A . n A 1 57 SER 57 33 33 SER SER A . n A 1 58 GLN 58 34 34 GLN GLN A . n A 1 59 LEU 59 35 35 LEU LEU A . n A 1 60 ILE 60 36 36 ILE ILE A . n A 1 61 GLU 61 37 37 GLU GLU A . n A 1 62 LYS 62 38 38 LYS LYS A . n A 1 63 SER 63 39 39 SER SER A . n A 1 64 ILE 64 40 40 ILE ILE A . n A 1 65 LYS 65 41 41 LYS LYS A . n A 1 66 LYS 66 42 42 LYS LYS A . n A 1 67 LEU 67 43 43 LEU LEU A . n A 1 68 GLY 68 44 44 GLY GLY A . n A 1 69 ILE 69 45 45 ILE ILE A . n A 1 70 ASP 70 46 46 ASP ASP A . n A 1 71 ASN 71 47 47 ASN ASN A . n A 1 72 THR 72 48 48 THR THR A . n A 1 73 ARG 73 49 49 ARG ARG A . n A 1 74 ARG 74 50 50 ARG ARG A . n A 1 75 LYS 75 51 51 LYS LYS A . n A 1 76 ILE 76 52 52 ILE ILE A . n A 1 77 ILE 77 53 53 ILE ILE A . n A 1 78 LEU 78 54 54 LEU LEU A . n A 1 79 SER 79 55 55 SER SER A . n A 1 80 THR 80 56 56 THR THR A . n A 1 81 ASN 81 57 57 ASN ASN A . n A 1 82 ALA 82 58 58 ALA ALA A . n A 1 83 LEU 83 59 59 LEU LEU A . n A 1 84 GLY 84 60 60 GLY GLY A . n A 1 85 GLU 85 61 61 GLU GLU A . n A 1 86 ALA 86 62 62 ALA ALA A . n A 1 87 SER 87 63 63 SER SER A . n A 1 88 ILE 88 64 64 ILE ILE A . n A 1 89 THR 89 65 65 THR THR A . n A 1 90 ASP 90 66 66 ASP ASP A . n A 1 91 ILE 91 67 67 ILE ILE A . n A 1 92 ALA 92 68 68 ALA ALA A . n A 1 93 ASN 93 69 69 ASN ASN A . n A 1 94 LEU 94 70 70 LEU LEU A . n A 1 95 SER 95 71 71 SER SER A . n A 1 96 THR 96 72 72 THR THR A . n A 1 97 LEU 97 73 73 LEU LEU A . n A 1 98 LYS 98 74 74 LYS LYS A . n A 1 99 LEU 99 75 75 LEU LEU A . n A 1 100 THR 100 76 76 THR THR A . n A 1 101 THR 101 77 77 THR THR A . n A 1 102 ALA 102 78 78 ALA ALA A . n A 1 103 THR 103 79 79 THR THR A . n A 1 104 LYS 104 80 80 LYS LYS A . n A 1 105 ALA 105 81 81 ALA ALA A . n A 1 106 VAL 106 82 82 VAL VAL A . n A 1 107 TYR 107 83 83 TYR TYR A . n A 1 108 ARG 108 84 84 ARG ARG A . n A 1 109 LEU 109 85 85 LEU LEU A . n A 1 110 VAL 110 86 86 VAL VAL A . n A 1 111 GLU 111 87 87 GLU GLU A . n A 1 112 ASP 112 88 88 ASP ASP A . n A 1 113 GLY 113 89 89 GLY GLY A . n A 1 114 ILE 114 90 90 ILE ILE A . n A 1 115 VAL 115 91 91 VAL VAL A . n A 1 116 GLU 116 92 92 GLU GLU A . n A 1 117 VAL 117 93 93 VAL VAL A . n A 1 118 TYR 118 94 94 TYR TYR A . n A 1 119 SER 119 95 95 SER SER A . n A 1 120 SER 120 96 96 SER SER A . n A 1 121 THR 121 97 97 THR THR A . n A 1 122 THR 122 98 98 THR THR A . n A 1 123 ASP 123 99 99 ASP ASP A . n A 1 124 GLU 124 100 100 GLU GLU A . n A 1 125 ARG 125 101 101 ARG ARG A . n A 1 126 ILE 126 102 102 ILE ILE A . n A 1 127 SER 127 103 103 SER SER A . n A 1 128 MET 128 104 104 MET MET A . n A 1 129 VAL 129 105 105 VAL VAL A . n A 1 130 LYS 130 106 106 LYS LYS A . n A 1 131 LEU 131 107 107 LEU LEU A . n A 1 132 THR 132 108 108 THR THR A . n A 1 133 ALA 133 109 109 ALA ALA A . n A 1 134 LYS 134 110 110 LYS LYS A . n A 1 135 GLY 135 111 111 GLY GLY A . n A 1 136 VAL 136 112 112 VAL VAL A . n A 1 137 GLU 137 113 113 GLU GLU A . n A 1 138 LEU 138 114 114 LEU LEU A . n A 1 139 VAL 139 115 115 VAL VAL A . n A 1 140 GLU 140 116 116 GLU GLU A . n A 1 141 GLN 141 117 117 GLN GLN A . n A 1 142 ILE 142 118 118 ILE ILE A . n A 1 143 ASN 143 119 119 ASN ASN A . n A 1 144 GLN 144 120 120 GLN GLN A . n A 1 145 ILE 145 121 121 ILE ILE A . n A 1 146 SER 146 122 122 SER SER A . n A 1 147 VAL 147 123 123 VAL VAL A . n A 1 148 VAL 148 124 124 VAL VAL A . n A 1 149 THR 149 125 125 THR THR A . n A 1 150 LEU 150 126 126 LEU LEU A . n A 1 151 ALA 151 127 127 ALA ALA A . n A 1 152 GLY 152 128 128 GLY GLY A . n A 1 153 ILE 153 129 129 ILE ILE A . n A 1 154 LEU 154 130 130 LEU LEU A . n A 1 155 ASN 155 131 131 ASN ASN A . n A 1 156 ALA 156 132 132 ALA ALA A . n A 1 157 PHE 157 133 133 PHE PHE A . n A 1 158 SER 158 134 134 SER SER A . n A 1 159 GLU 159 135 135 GLU GLU A . n A 1 160 ASP 160 136 136 ASP ASP A . n A 1 161 GLU 161 137 137 GLU GLU A . n A 1 162 LEU 162 138 138 LEU LEU A . n A 1 163 HIS 163 139 139 HIS HIS A . n A 1 164 ASN 164 140 140 ASN ASN A . n A 1 165 LEU 165 141 141 LEU LEU A . n A 1 166 ASN 166 142 142 ASN ASN A . n A 1 167 HIS 167 143 143 HIS HIS A . n A 1 168 GLN 168 144 144 GLN GLN A . n A 1 169 LEU 169 145 145 LEU LEU A . n A 1 170 LYS 170 146 146 LYS LYS A . n A 1 171 LYS 171 147 147 LYS LYS A . n A 1 172 LEU 172 148 148 LEU LEU A . n A 1 173 PHE 173 149 149 PHE PHE A . n A 1 174 ASP 174 150 150 ASP ASP A . n A 1 175 LEU 175 151 151 LEU LEU A . n A 1 176 MET 176 152 152 MET MET A . n A 1 177 PRO 177 153 153 PRO PRO A . n A 1 178 SER 178 154 154 SER SER A . n A 1 179 SER 179 155 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IAC 1 201 201 IAC IAA A . C 3 NI 1 202 1 NI NI A . D 4 HOH 1 301 9 HOH HOH A . D 4 HOH 2 302 7 HOH HOH A . D 4 HOH 3 303 3 HOH HOH A . D 4 HOH 4 304 4 HOH HOH A . D 4 HOH 5 305 1 HOH HOH A . D 4 HOH 6 306 6 HOH HOH A . D 4 HOH 7 307 8 HOH HOH A . D 4 HOH 8 308 2 HOH HOH A . D 4 HOH 9 309 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8960 ? 1 MORE -73 ? 1 'SSA (A^2)' 16600 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+5/6 0.5000000000 -0.8660254038 0.0000000000 36.3360000000 -0.8660254038 -0.5000000000 0.0000000000 62.9357981438 0.0000000000 0.0000000000 -1.0000000000 104.2708333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-09 2 'Structure model' 1 1 2022-11-23 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 27.2324 _pdbx_refine_tls.origin_y 34.3658 _pdbx_refine_tls.origin_z 54.1918 _pdbx_refine_tls.T[1][1] 0.0170 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0088 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0489 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0843 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0400 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.1798 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.2347 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.2044 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.4607 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 4.2265 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 1.1087 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.4891 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0923 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.1496 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.2928 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0901 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.1606 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1126 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1283 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.1073 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.2529 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id -14 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 201 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? DENZO ? ? program . 2 ? 'data scaling' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? SCALEPACK ? ? program . 3 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk ? ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Oct. 31, 2020' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.27 5 # _pdbx_entry_details.entry_id 7L1I _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 100 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.83 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 THR _pdbx_validate_symm_contact.auth_seq_id_1 97 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 THR _pdbx_validate_symm_contact.auth_seq_id_2 97 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 10_775 _pdbx_validate_symm_contact.dist 2.12 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 49 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 49 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 49 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.11 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.19 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 41 ? ? -24.50 -61.55 2 1 LEU A 43 ? ? -59.09 -0.50 3 1 SER A 63 ? ? -19.06 120.53 4 1 ASP A 99 ? ? -163.02 105.46 5 1 PRO A 153 ? ? -94.41 -90.93 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ALA _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 62 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 SER _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 63 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 143.87 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -23 ? A MET 1 2 1 Y 1 A HIS -22 ? A HIS 2 3 1 Y 1 A HIS -21 ? A HIS 3 4 1 Y 1 A HIS -20 ? A HIS 4 5 1 Y 1 A HIS -19 ? A HIS 5 6 1 Y 1 A HIS -18 ? A HIS 6 7 1 Y 1 A HIS -17 ? A HIS 7 8 1 Y 1 A SER -16 ? A SER 8 9 1 Y 1 A SER -15 ? A SER 9 10 1 Y 1 A SER 155 ? A SER 179 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 IAC C C Y N 147 IAC C1 C Y N 148 IAC C2 C Y N 149 IAC C3 C Y N 150 IAC C4 C Y N 151 IAC C5 C Y N 152 IAC C7 C Y N 153 IAC C8 C Y N 154 IAC C17 C N N 155 IAC C18 C N N 156 IAC N N Y N 157 IAC O2 O N N 158 IAC O3 O N N 159 IAC H2 H N N 160 IAC H3 H N N 161 IAC H4 H N N 162 IAC H5 H N N 163 IAC H8 H N N 164 IAC H171 H N N 165 IAC H172 H N N 166 IAC HN H N N 167 IAC HO2 H N N 168 ILE N N N N 169 ILE CA C N S 170 ILE C C N N 171 ILE O O N N 172 ILE CB C N S 173 ILE CG1 C N N 174 ILE CG2 C N N 175 ILE CD1 C N N 176 ILE OXT O N N 177 ILE H H N N 178 ILE H2 H N N 179 ILE HA H N N 180 ILE HB H N N 181 ILE HG12 H N N 182 ILE HG13 H N N 183 ILE HG21 H N N 184 ILE HG22 H N N 185 ILE HG23 H N N 186 ILE HD11 H N N 187 ILE HD12 H N N 188 ILE HD13 H N N 189 ILE HXT H N N 190 LEU N N N N 191 LEU CA C N S 192 LEU C C N N 193 LEU O O N N 194 LEU CB C N N 195 LEU CG C N N 196 LEU CD1 C N N 197 LEU CD2 C N N 198 LEU OXT O N N 199 LEU H H N N 200 LEU H2 H N N 201 LEU HA H N N 202 LEU HB2 H N N 203 LEU HB3 H N N 204 LEU HG H N N 205 LEU HD11 H N N 206 LEU HD12 H N N 207 LEU HD13 H N N 208 LEU HD21 H N N 209 LEU HD22 H N N 210 LEU HD23 H N N 211 LEU HXT H N N 212 LYS N N N N 213 LYS CA C N S 214 LYS C C N N 215 LYS O O N N 216 LYS CB C N N 217 LYS CG C N N 218 LYS CD C N N 219 LYS CE C N N 220 LYS NZ N N N 221 LYS OXT O N N 222 LYS H H N N 223 LYS H2 H N N 224 LYS HA H N N 225 LYS HB2 H N N 226 LYS HB3 H N N 227 LYS HG2 H N N 228 LYS HG3 H N N 229 LYS HD2 H N N 230 LYS HD3 H N N 231 LYS HE2 H N N 232 LYS HE3 H N N 233 LYS HZ1 H N N 234 LYS HZ2 H N N 235 LYS HZ3 H N N 236 LYS HXT H N N 237 MET N N N N 238 MET CA C N S 239 MET C C N N 240 MET O O N N 241 MET CB C N N 242 MET CG C N N 243 MET SD S N N 244 MET CE C N N 245 MET OXT O N N 246 MET H H N N 247 MET H2 H N N 248 MET HA H N N 249 MET HB2 H N N 250 MET HB3 H N N 251 MET HG2 H N N 252 MET HG3 H N N 253 MET HE1 H N N 254 MET HE2 H N N 255 MET HE3 H N N 256 MET HXT H N N 257 NI NI NI N N 258 PHE N N N N 259 PHE CA C N S 260 PHE C C N N 261 PHE O O N N 262 PHE CB C N N 263 PHE CG C Y N 264 PHE CD1 C Y N 265 PHE CD2 C Y N 266 PHE CE1 C Y N 267 PHE CE2 C Y N 268 PHE CZ C Y N 269 PHE OXT O N N 270 PHE H H N N 271 PHE H2 H N N 272 PHE HA H N N 273 PHE HB2 H N N 274 PHE HB3 H N N 275 PHE HD1 H N N 276 PHE HD2 H N N 277 PHE HE1 H N N 278 PHE HE2 H N N 279 PHE HZ H N N 280 PHE HXT H N N 281 PRO N N N N 282 PRO CA C N S 283 PRO C C N N 284 PRO O O N N 285 PRO CB C N N 286 PRO CG C N N 287 PRO CD C N N 288 PRO OXT O N N 289 PRO H H N N 290 PRO HA H N N 291 PRO HB2 H N N 292 PRO HB3 H N N 293 PRO HG2 H N N 294 PRO HG3 H N N 295 PRO HD2 H N N 296 PRO HD3 H N N 297 PRO HXT H N N 298 SER N N N N 299 SER CA C N S 300 SER C C N N 301 SER O O N N 302 SER CB C N N 303 SER OG O N N 304 SER OXT O N N 305 SER H H N N 306 SER H2 H N N 307 SER HA H N N 308 SER HB2 H N N 309 SER HB3 H N N 310 SER HG H N N 311 SER HXT H N N 312 THR N N N N 313 THR CA C N S 314 THR C C N N 315 THR O O N N 316 THR CB C N R 317 THR OG1 O N N 318 THR CG2 C N N 319 THR OXT O N N 320 THR H H N N 321 THR H2 H N N 322 THR HA H N N 323 THR HB H N N 324 THR HG1 H N N 325 THR HG21 H N N 326 THR HG22 H N N 327 THR HG23 H N N 328 THR HXT H N N 329 TRP N N N N 330 TRP CA C N S 331 TRP C C N N 332 TRP O O N N 333 TRP CB C N N 334 TRP CG C Y N 335 TRP CD1 C Y N 336 TRP CD2 C Y N 337 TRP NE1 N Y N 338 TRP CE2 C Y N 339 TRP CE3 C Y N 340 TRP CZ2 C Y N 341 TRP CZ3 C Y N 342 TRP CH2 C Y N 343 TRP OXT O N N 344 TRP H H N N 345 TRP H2 H N N 346 TRP HA H N N 347 TRP HB2 H N N 348 TRP HB3 H N N 349 TRP HD1 H N N 350 TRP HE1 H N N 351 TRP HE3 H N N 352 TRP HZ2 H N N 353 TRP HZ3 H N N 354 TRP HH2 H N N 355 TRP HXT H N N 356 TYR N N N N 357 TYR CA C N S 358 TYR C C N N 359 TYR O O N N 360 TYR CB C N N 361 TYR CG C Y N 362 TYR CD1 C Y N 363 TYR CD2 C Y N 364 TYR CE1 C Y N 365 TYR CE2 C Y N 366 TYR CZ C Y N 367 TYR OH O N N 368 TYR OXT O N N 369 TYR H H N N 370 TYR H2 H N N 371 TYR HA H N N 372 TYR HB2 H N N 373 TYR HB3 H N N 374 TYR HD1 H N N 375 TYR HD2 H N N 376 TYR HE1 H N N 377 TYR HE2 H N N 378 TYR HH H N N 379 TYR HXT H N N 380 VAL N N N N 381 VAL CA C N S 382 VAL C C N N 383 VAL O O N N 384 VAL CB C N N 385 VAL CG1 C N N 386 VAL CG2 C N N 387 VAL OXT O N N 388 VAL H H N N 389 VAL H2 H N N 390 VAL HA H N N 391 VAL HB H N N 392 VAL HG11 H N N 393 VAL HG12 H N N 394 VAL HG13 H N N 395 VAL HG21 H N N 396 VAL HG22 H N N 397 VAL HG23 H N N 398 VAL HXT H N N 399 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 IAC C N sing Y N 139 IAC C C1 doub Y N 140 IAC C C5 sing Y N 141 IAC C1 C7 sing Y N 142 IAC C1 C2 sing Y N 143 IAC C2 C3 doub Y N 144 IAC C2 H2 sing N N 145 IAC C3 C4 sing Y N 146 IAC C3 H3 sing N N 147 IAC C4 C5 doub Y N 148 IAC C4 H4 sing N N 149 IAC C5 H5 sing N N 150 IAC C7 C17 sing N N 151 IAC C7 C8 doub Y N 152 IAC C8 N sing Y N 153 IAC C8 H8 sing N N 154 IAC C17 C18 sing N N 155 IAC C17 H171 sing N N 156 IAC C17 H172 sing N N 157 IAC C18 O3 doub N N 158 IAC C18 O2 sing N N 159 IAC N HN sing N N 160 IAC O2 HO2 sing N N 161 ILE N CA sing N N 162 ILE N H sing N N 163 ILE N H2 sing N N 164 ILE CA C sing N N 165 ILE CA CB sing N N 166 ILE CA HA sing N N 167 ILE C O doub N N 168 ILE C OXT sing N N 169 ILE CB CG1 sing N N 170 ILE CB CG2 sing N N 171 ILE CB HB sing N N 172 ILE CG1 CD1 sing N N 173 ILE CG1 HG12 sing N N 174 ILE CG1 HG13 sing N N 175 ILE CG2 HG21 sing N N 176 ILE CG2 HG22 sing N N 177 ILE CG2 HG23 sing N N 178 ILE CD1 HD11 sing N N 179 ILE CD1 HD12 sing N N 180 ILE CD1 HD13 sing N N 181 ILE OXT HXT sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TRP N CA sing N N 316 TRP N H sing N N 317 TRP N H2 sing N N 318 TRP CA C sing N N 319 TRP CA CB sing N N 320 TRP CA HA sing N N 321 TRP C O doub N N 322 TRP C OXT sing N N 323 TRP CB CG sing N N 324 TRP CB HB2 sing N N 325 TRP CB HB3 sing N N 326 TRP CG CD1 doub Y N 327 TRP CG CD2 sing Y N 328 TRP CD1 NE1 sing Y N 329 TRP CD1 HD1 sing N N 330 TRP CD2 CE2 doub Y N 331 TRP CD2 CE3 sing Y N 332 TRP NE1 CE2 sing Y N 333 TRP NE1 HE1 sing N N 334 TRP CE2 CZ2 sing Y N 335 TRP CE3 CZ3 doub Y N 336 TRP CE3 HE3 sing N N 337 TRP CZ2 CH2 doub Y N 338 TRP CZ2 HZ2 sing N N 339 TRP CZ3 CH2 sing Y N 340 TRP CZ3 HZ3 sing N N 341 TRP CH2 HH2 sing N N 342 TRP OXT HXT sing N N 343 TYR N CA sing N N 344 TYR N H sing N N 345 TYR N H2 sing N N 346 TYR CA C sing N N 347 TYR CA CB sing N N 348 TYR CA HA sing N N 349 TYR C O doub N N 350 TYR C OXT sing N N 351 TYR CB CG sing N N 352 TYR CB HB2 sing N N 353 TYR CB HB3 sing N N 354 TYR CG CD1 doub Y N 355 TYR CG CD2 sing Y N 356 TYR CD1 CE1 sing Y N 357 TYR CD1 HD1 sing N N 358 TYR CD2 CE2 doub Y N 359 TYR CD2 HD2 sing N N 360 TYR CE1 CZ doub Y N 361 TYR CE1 HE1 sing N N 362 TYR CE2 CZ sing Y N 363 TYR CE2 HE2 sing N N 364 TYR CZ OH sing N N 365 TYR OH HH sing N N 366 TYR OXT HXT sing N N 367 VAL N CA sing N N 368 VAL N H sing N N 369 VAL N H2 sing N N 370 VAL CA C sing N N 371 VAL CA CB sing N N 372 VAL CA HA sing N N 373 VAL C O doub N N 374 VAL C OXT sing N N 375 VAL CB CG1 sing N N 376 VAL CB CG2 sing N N 377 VAL CB HB sing N N 378 VAL CG1 HG11 sing N N 379 VAL CG1 HG12 sing N N 380 VAL CG1 HG13 sing N N 381 VAL CG2 HG21 sing N N 382 VAL CG2 HG22 sing N N 383 VAL CG2 HG23 sing N N 384 VAL OXT HXT sing N N 385 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number IOS-1917270 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IAC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IAC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1H-INDOL-3-YLACETIC ACID' IAC 3 'NICKEL (II) ION' NI 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7KUA _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #