data_7L2G
# 
_entry.id   7L2G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7L2G         pdb_00007l2g 10.2210/pdb7l2g/pdb 
WWPDB D_1000253406 ?            ?                   
BMRB  30826        ?            10.13018/BMR30826   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-10-27 
2 'Structure model' 1 1 2023-06-14 
3 'Structure model' 1 2 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Other                 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
4 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_database_status      
2 3 'Structure model' chem_comp_atom            
3 3 'Structure model' chem_comp_bond            
4 3 'Structure model' database_2                
5 3 'Structure model' pdbx_entry_details        
6 3 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
2 3 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        7L2G 
_pdbx_database_status.recvd_initial_deposition_date   2020-12-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'NMR solution structure of Nak1 from the Necator americanus hookworm' 
_pdbx_database_related.db_id          30826 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Smallwood, T.B.' 1 0000-0002-2211-0265 
'Rosengren, K.J.' 2 0000-0002-5007-8434 
'Clark, R.J.'     3 0000-0002-6807-5426 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            297 
_citation.language                  ? 
_citation.page_first                100834 
_citation.page_last                 100834 
_citation.title                     
;Synthetic hookworm-derived peptides are potent modulators of primary human immune cell function that protect against experimental colitis in vivo.
;
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jbc.2021.100834 
_citation.pdbx_database_id_PubMed   34051231 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Smallwood, T.B.'          1  ? 
primary 'Navarro, S.'              2  ? 
primary 'Cristofori-Armstrong, B.' 3  ? 
primary 'Watkins, T.S.'            4  ? 
primary 'Tungatt, K.'              5  ? 
primary 'Ryan, R.Y.M.'             6  ? 
primary 'Haigh, O.L.'              7  ? 
primary 'Lutzky, V.P.'             8  ? 
primary 'Mulvenna, J.P.'           9  ? 
primary 'Rosengren, K.J.'          10 ? 
primary 'Loukas, A.'               11 ? 
primary 'Miles, J.J.'              12 ? 
primary 'Clark, R.J.'              13 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 syn 
_entity.pdbx_description           'ShTK domain protein' 
_entity.formula_weight             4377.214 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'CRDRIPQNVCEQMKKNGKCGDPRMSTIAELQCPKTCGKC(NH2)' 
_entity_poly.pdbx_seq_one_letter_code_can   CRDRIPQNVCEQMKKNGKCGDPRMSTIAELQCPKTCGKCX 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  CYS n 
1 2  ARG n 
1 3  ASP n 
1 4  ARG n 
1 5  ILE n 
1 6  PRO n 
1 7  GLN n 
1 8  ASN n 
1 9  VAL n 
1 10 CYS n 
1 11 GLU n 
1 12 GLN n 
1 13 MET n 
1 14 LYS n 
1 15 LYS n 
1 16 ASN n 
1 17 GLY n 
1 18 LYS n 
1 19 CYS n 
1 20 GLY n 
1 21 ASP n 
1 22 PRO n 
1 23 ARG n 
1 24 MET n 
1 25 SER n 
1 26 THR n 
1 27 ILE n 
1 28 ALA n 
1 29 GLU n 
1 30 LEU n 
1 31 GLN n 
1 32 CYS n 
1 33 PRO n 
1 34 LYS n 
1 35 THR n 
1 36 CYS n 
1 37 GLY n 
1 38 LYS n 
1 39 CYS n 
1 40 NH2 n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       39 
_pdbx_entity_src_syn.organism_scientific    'Necator americanus' 
_pdbx_entity_src_syn.organism_common_name   'Human hookworm' 
_pdbx_entity_src_syn.ncbi_taxonomy_id       51031 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  CYS 1  1  1  CYS CYS A . n 
A 1 2  ARG 2  2  2  ARG ARG A . n 
A 1 3  ASP 3  3  3  ASP ASP A . n 
A 1 4  ARG 4  4  4  ARG ARG A . n 
A 1 5  ILE 5  5  5  ILE ILE A . n 
A 1 6  PRO 6  6  6  PRO PRO A . n 
A 1 7  GLN 7  7  7  GLN GLN A . n 
A 1 8  ASN 8  8  8  ASN ASN A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 CYS 10 10 10 CYS CYS A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 GLN 12 12 12 GLN GLN A . n 
A 1 13 MET 13 13 13 MET MET A . n 
A 1 14 LYS 14 14 14 LYS LYS A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 ASN 16 16 16 ASN ASN A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 LYS 18 18 18 LYS LYS A . n 
A 1 19 CYS 19 19 19 CYS CYS A . n 
A 1 20 GLY 20 20 20 GLY GLY A . n 
A 1 21 ASP 21 21 21 ASP ASP A . n 
A 1 22 PRO 22 22 22 PRO PRO A . n 
A 1 23 ARG 23 23 23 ARG ARG A . n 
A 1 24 MET 24 24 24 MET MET A . n 
A 1 25 SER 25 25 25 SER SER A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 ILE 27 27 27 ILE ILE A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 GLU 29 29 29 GLU GLU A . n 
A 1 30 LEU 30 30 30 LEU LEU A . n 
A 1 31 GLN 31 31 31 GLN GLN A . n 
A 1 32 CYS 32 32 32 CYS CYS A . n 
A 1 33 PRO 33 33 33 PRO PRO A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 THR 35 35 35 THR THR A . n 
A 1 36 CYS 36 36 36 CYS CYS A . n 
A 1 37 GLY 37 37 37 GLY GLY A . n 
A 1 38 LYS 38 38 38 LYS LYS A . n 
A 1 39 CYS 39 39 39 CYS CYS A . n 
A 1 40 NH2 40 40 39 NH2 CYS A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7L2G 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     7L2G 
_struct.title                        'NMR solution structure of Nak1 from the Necator americanus hookworm' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7L2G 
_struct_keywords.text            'IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    W2TBE5_NECAM 
_struct_ref.pdbx_db_accession          W2TBE5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   CRDRIPQNVCEQMKKNGKCDDPRMSTITELQCPKTCGKC 
_struct_ref.pdbx_align_begin           25 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7L2G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 39 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             W2TBE5 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  63 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       39 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7L2G GLY A 20 ? UNP W2TBE5 ASP 44 conflict 20 1 
1 7L2G ALA A 28 ? UNP W2TBE5 THR 52 conflict 28 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'mass spectrometry' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 6  ? GLY A 17 ? PRO A 6  GLY A 17 1 ? 12 
HELX_P HELX_P2 AA2 THR A 26 ? CYS A 32 ? THR A 26 CYS A 32 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 1  SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 1  A CYS 39 1_555 ? ? ? ? ? ? ? 2.100 ? ? 
disulf2 disulf ?    ? A CYS 10 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 10 A CYS 32 1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf3 disulf ?    ? A CYS 19 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 19 A CYS 36 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
covale1 covale both ? A CYS 39 C  ? ? ? 1_555 A NH2 40 N  ? ? A CYS 39 A NH2 40 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 NH2 A 40 ? CYS A 39 ? NH2 A 40 ? 1_555 CYS A 39 ? 1_555 .  .  CYS 11 NH2 None 'Terminal amidation' 
2 CYS A 1  ? CYS A 39 ? CYS A 1  ? 1_555 CYS A 39 ? 1_555 SG SG .   .  .   None 'Disulfide bridge'   
3 CYS A 10 ? CYS A 32 ? CYS A 10 ? 1_555 CYS A 32 ? 1_555 SG SG .   .  .   None 'Disulfide bridge'   
4 CYS A 19 ? CYS A 36 ? CYS A 19 ? 1_555 CYS A 36 ? 1_555 SG SG .   .  .   None 'Disulfide bridge'   
# 
_pdbx_entry_details.entry_id                   7L2G 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  MET A 24 ? ? -116.33 61.07   
2  1  LYS A 38 ? ? -146.31 36.03   
3  2  LYS A 38 ? ? -145.95 36.03   
4  3  ARG A 2  ? ? -52.94  171.67  
5  4  ARG A 2  ? ? -59.28  -174.98 
6  5  ARG A 2  ? ? -55.90  172.67  
7  5  MET A 24 ? ? -109.34 53.77   
8  5  CYS A 32 ? ? -119.66 67.60   
9  6  MET A 24 ? ? -99.03  42.84   
10 7  ARG A 2  ? ? -57.57  -178.92 
11 9  ARG A 2  ? ? -59.47  175.49  
12 9  CYS A 32 ? ? -119.01 66.68   
13 10 ARG A 2  ? ? -53.14  171.90  
14 10 MET A 24 ? ? -103.34 51.31   
15 12 ARG A 2  ? ? -52.75  172.25  
16 12 LYS A 38 ? ? -144.39 36.61   
17 14 ARG A 2  ? ? -58.14  -178.56 
18 14 LYS A 38 ? ? -148.20 36.87   
19 15 ARG A 2  ? ? -54.17  175.62  
20 15 MET A 24 ? ? -95.08  34.41   
21 15 SER A 25 ? ? -82.17  -76.32  
22 15 LYS A 38 ? ? -144.88 32.99   
23 16 LYS A 38 ? ? -144.04 36.14   
24 17 LYS A 38 ? ? -150.92 36.23   
25 18 MET A 24 ? ? -95.30  33.02   
26 19 ARG A 2  ? ? -52.59  171.21  
27 20 ARG A 2  ? ? -60.25  -175.93 
# 
_pdbx_nmr_ensemble.entry_id                                      7L2G 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             7L2G 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1 mg/mL Nak1, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            Nak1 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          ? 
# 
_pdbx_nmr_exptl_sample.solution_id           1 
_pdbx_nmr_exptl_sample.component             Nak1 
_pdbx_nmr_exptl_sample.concentration         1 
_pdbx_nmr_exptl_sample.concentration_range   ? 
_pdbx_nmr_exptl_sample.concentration_units   mg/mL 
_pdbx_nmr_exptl_sample.isotopic_labeling     'natural abundance' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     3.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  Conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '2D 1H-1H NOESY' 1 isotropic 
2 1 1 '2D 1H-1H TOCSY' 1 isotropic 
3 1 1 '2D 1H-13C HSQC' 1 isotropic 
4 1 1 '2D DQF-COSY'    1 isotropic 
5 1 1 '2D 1H-15N HSQC' 1 isotropic 
# 
_pdbx_nmr_refine.entry_id           7L2G 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 refinement                  CNS     ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 
2 'structure calculation'     CYANA   ? 'Guntert, Mumenthaler and Wuthrich'            
3 'chemical shift assignment' CARA    ? 'Keller and Wuthrich'                          
4 'peak picking'              CARA    ? 'Keller and Wuthrich'                          
5 collection                  TopSpin ? 'Bruker Biospin'                               
6 processing                  TopSpin ? 'Bruker Biospin'                               
7 'data analysis'             TALOS   ? 'Cornilescu, Delaglio and Bax'                 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
ILE N    N N N 137 
ILE CA   C N S 138 
ILE C    C N N 139 
ILE O    O N N 140 
ILE CB   C N S 141 
ILE CG1  C N N 142 
ILE CG2  C N N 143 
ILE CD1  C N N 144 
ILE OXT  O N N 145 
ILE H    H N N 146 
ILE H2   H N N 147 
ILE HA   H N N 148 
ILE HB   H N N 149 
ILE HG12 H N N 150 
ILE HG13 H N N 151 
ILE HG21 H N N 152 
ILE HG22 H N N 153 
ILE HG23 H N N 154 
ILE HD11 H N N 155 
ILE HD12 H N N 156 
ILE HD13 H N N 157 
ILE HXT  H N N 158 
LEU N    N N N 159 
LEU CA   C N S 160 
LEU C    C N N 161 
LEU O    O N N 162 
LEU CB   C N N 163 
LEU CG   C N N 164 
LEU CD1  C N N 165 
LEU CD2  C N N 166 
LEU OXT  O N N 167 
LEU H    H N N 168 
LEU H2   H N N 169 
LEU HA   H N N 170 
LEU HB2  H N N 171 
LEU HB3  H N N 172 
LEU HG   H N N 173 
LEU HD11 H N N 174 
LEU HD12 H N N 175 
LEU HD13 H N N 176 
LEU HD21 H N N 177 
LEU HD22 H N N 178 
LEU HD23 H N N 179 
LEU HXT  H N N 180 
LYS N    N N N 181 
LYS CA   C N S 182 
LYS C    C N N 183 
LYS O    O N N 184 
LYS CB   C N N 185 
LYS CG   C N N 186 
LYS CD   C N N 187 
LYS CE   C N N 188 
LYS NZ   N N N 189 
LYS OXT  O N N 190 
LYS H    H N N 191 
LYS H2   H N N 192 
LYS HA   H N N 193 
LYS HB2  H N N 194 
LYS HB3  H N N 195 
LYS HG2  H N N 196 
LYS HG3  H N N 197 
LYS HD2  H N N 198 
LYS HD3  H N N 199 
LYS HE2  H N N 200 
LYS HE3  H N N 201 
LYS HZ1  H N N 202 
LYS HZ2  H N N 203 
LYS HZ3  H N N 204 
LYS HXT  H N N 205 
MET N    N N N 206 
MET CA   C N S 207 
MET C    C N N 208 
MET O    O N N 209 
MET CB   C N N 210 
MET CG   C N N 211 
MET SD   S N N 212 
MET CE   C N N 213 
MET OXT  O N N 214 
MET H    H N N 215 
MET H2   H N N 216 
MET HA   H N N 217 
MET HB2  H N N 218 
MET HB3  H N N 219 
MET HG2  H N N 220 
MET HG3  H N N 221 
MET HE1  H N N 222 
MET HE2  H N N 223 
MET HE3  H N N 224 
MET HXT  H N N 225 
NH2 N    N N N 226 
NH2 HN1  H N N 227 
NH2 HN2  H N N 228 
PRO N    N N N 229 
PRO CA   C N S 230 
PRO C    C N N 231 
PRO O    O N N 232 
PRO CB   C N N 233 
PRO CG   C N N 234 
PRO CD   C N N 235 
PRO OXT  O N N 236 
PRO H    H N N 237 
PRO HA   H N N 238 
PRO HB2  H N N 239 
PRO HB3  H N N 240 
PRO HG2  H N N 241 
PRO HG3  H N N 242 
PRO HD2  H N N 243 
PRO HD3  H N N 244 
PRO HXT  H N N 245 
SER N    N N N 246 
SER CA   C N S 247 
SER C    C N N 248 
SER O    O N N 249 
SER CB   C N N 250 
SER OG   O N N 251 
SER OXT  O N N 252 
SER H    H N N 253 
SER H2   H N N 254 
SER HA   H N N 255 
SER HB2  H N N 256 
SER HB3  H N N 257 
SER HG   H N N 258 
SER HXT  H N N 259 
THR N    N N N 260 
THR CA   C N S 261 
THR C    C N N 262 
THR O    O N N 263 
THR CB   C N R 264 
THR OG1  O N N 265 
THR CG2  C N N 266 
THR OXT  O N N 267 
THR H    H N N 268 
THR H2   H N N 269 
THR HA   H N N 270 
THR HB   H N N 271 
THR HG1  H N N 272 
THR HG21 H N N 273 
THR HG22 H N N 274 
THR HG23 H N N 275 
THR HXT  H N N 276 
VAL N    N N N 277 
VAL CA   C N S 278 
VAL C    C N N 279 
VAL O    O N N 280 
VAL CB   C N N 281 
VAL CG1  C N N 282 
VAL CG2  C N N 283 
VAL OXT  O N N 284 
VAL H    H N N 285 
VAL H2   H N N 286 
VAL HA   H N N 287 
VAL HB   H N N 288 
VAL HG11 H N N 289 
VAL HG12 H N N 290 
VAL HG13 H N N 291 
VAL HG21 H N N 292 
VAL HG22 H N N 293 
VAL HG23 H N N 294 
VAL HXT  H N N 295 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
ILE N   CA   sing N N 129 
ILE N   H    sing N N 130 
ILE N   H2   sing N N 131 
ILE CA  C    sing N N 132 
ILE CA  CB   sing N N 133 
ILE CA  HA   sing N N 134 
ILE C   O    doub N N 135 
ILE C   OXT  sing N N 136 
ILE CB  CG1  sing N N 137 
ILE CB  CG2  sing N N 138 
ILE CB  HB   sing N N 139 
ILE CG1 CD1  sing N N 140 
ILE CG1 HG12 sing N N 141 
ILE CG1 HG13 sing N N 142 
ILE CG2 HG21 sing N N 143 
ILE CG2 HG22 sing N N 144 
ILE CG2 HG23 sing N N 145 
ILE CD1 HD11 sing N N 146 
ILE CD1 HD12 sing N N 147 
ILE CD1 HD13 sing N N 148 
ILE OXT HXT  sing N N 149 
LEU N   CA   sing N N 150 
LEU N   H    sing N N 151 
LEU N   H2   sing N N 152 
LEU CA  C    sing N N 153 
LEU CA  CB   sing N N 154 
LEU CA  HA   sing N N 155 
LEU C   O    doub N N 156 
LEU C   OXT  sing N N 157 
LEU CB  CG   sing N N 158 
LEU CB  HB2  sing N N 159 
LEU CB  HB3  sing N N 160 
LEU CG  CD1  sing N N 161 
LEU CG  CD2  sing N N 162 
LEU CG  HG   sing N N 163 
LEU CD1 HD11 sing N N 164 
LEU CD1 HD12 sing N N 165 
LEU CD1 HD13 sing N N 166 
LEU CD2 HD21 sing N N 167 
LEU CD2 HD22 sing N N 168 
LEU CD2 HD23 sing N N 169 
LEU OXT HXT  sing N N 170 
LYS N   CA   sing N N 171 
LYS N   H    sing N N 172 
LYS N   H2   sing N N 173 
LYS CA  C    sing N N 174 
LYS CA  CB   sing N N 175 
LYS CA  HA   sing N N 176 
LYS C   O    doub N N 177 
LYS C   OXT  sing N N 178 
LYS CB  CG   sing N N 179 
LYS CB  HB2  sing N N 180 
LYS CB  HB3  sing N N 181 
LYS CG  CD   sing N N 182 
LYS CG  HG2  sing N N 183 
LYS CG  HG3  sing N N 184 
LYS CD  CE   sing N N 185 
LYS CD  HD2  sing N N 186 
LYS CD  HD3  sing N N 187 
LYS CE  NZ   sing N N 188 
LYS CE  HE2  sing N N 189 
LYS CE  HE3  sing N N 190 
LYS NZ  HZ1  sing N N 191 
LYS NZ  HZ2  sing N N 192 
LYS NZ  HZ3  sing N N 193 
LYS OXT HXT  sing N N 194 
MET N   CA   sing N N 195 
MET N   H    sing N N 196 
MET N   H2   sing N N 197 
MET CA  C    sing N N 198 
MET CA  CB   sing N N 199 
MET CA  HA   sing N N 200 
MET C   O    doub N N 201 
MET C   OXT  sing N N 202 
MET CB  CG   sing N N 203 
MET CB  HB2  sing N N 204 
MET CB  HB3  sing N N 205 
MET CG  SD   sing N N 206 
MET CG  HG2  sing N N 207 
MET CG  HG3  sing N N 208 
MET SD  CE   sing N N 209 
MET CE  HE1  sing N N 210 
MET CE  HE2  sing N N 211 
MET CE  HE3  sing N N 212 
MET OXT HXT  sing N N 213 
NH2 N   HN1  sing N N 214 
NH2 N   HN2  sing N N 215 
PRO N   CA   sing N N 216 
PRO N   CD   sing N N 217 
PRO N   H    sing N N 218 
PRO CA  C    sing N N 219 
PRO CA  CB   sing N N 220 
PRO CA  HA   sing N N 221 
PRO C   O    doub N N 222 
PRO C   OXT  sing N N 223 
PRO CB  CG   sing N N 224 
PRO CB  HB2  sing N N 225 
PRO CB  HB3  sing N N 226 
PRO CG  CD   sing N N 227 
PRO CG  HG2  sing N N 228 
PRO CG  HG3  sing N N 229 
PRO CD  HD2  sing N N 230 
PRO CD  HD3  sing N N 231 
PRO OXT HXT  sing N N 232 
SER N   CA   sing N N 233 
SER N   H    sing N N 234 
SER N   H2   sing N N 235 
SER CA  C    sing N N 236 
SER CA  CB   sing N N 237 
SER CA  HA   sing N N 238 
SER C   O    doub N N 239 
SER C   OXT  sing N N 240 
SER CB  OG   sing N N 241 
SER CB  HB2  sing N N 242 
SER CB  HB3  sing N N 243 
SER OG  HG   sing N N 244 
SER OXT HXT  sing N N 245 
THR N   CA   sing N N 246 
THR N   H    sing N N 247 
THR N   H2   sing N N 248 
THR CA  C    sing N N 249 
THR CA  CB   sing N N 250 
THR CA  HA   sing N N 251 
THR C   O    doub N N 252 
THR C   OXT  sing N N 253 
THR CB  OG1  sing N N 254 
THR CB  CG2  sing N N 255 
THR CB  HB   sing N N 256 
THR OG1 HG1  sing N N 257 
THR CG2 HG21 sing N N 258 
THR CG2 HG22 sing N N 259 
THR CG2 HG23 sing N N 260 
THR OXT HXT  sing N N 261 
VAL N   CA   sing N N 262 
VAL N   H    sing N N 263 
VAL N   H2   sing N N 264 
VAL CA  C    sing N N 265 
VAL CA  CB   sing N N 266 
VAL CA  HA   sing N N 267 
VAL C   O    doub N N 268 
VAL C   OXT  sing N N 269 
VAL CB  CG1  sing N N 270 
VAL CB  CG2  sing N N 271 
VAL CB  HB   sing N N 272 
VAL CG1 HG11 sing N N 273 
VAL CG1 HG12 sing N N 274 
VAL CG1 HG13 sing N N 275 
VAL CG2 HG21 sing N N 276 
VAL CG2 HG22 sing N N 277 
VAL CG2 HG23 sing N N 278 
VAL OXT HXT  sing N N 279 
# 
_pdbx_audit_support.funding_organization   'Australian Research Council (ARC)' 
_pdbx_audit_support.country                Australia 
_pdbx_audit_support.grant_number           FT100100476 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.details           ? 
# 
_atom_sites.entry_id                    7L2G 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_