data_7L7V # _entry.id 7L7V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.348 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7L7V pdb_00007l7v 10.2210/pdb7l7v/pdb WWPDB D_1000253312 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7L7V _pdbx_database_status.recvd_initial_deposition_date 2020-12-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Walton, W.G.' 1 0000-0001-6745-534X 'Wan, L.' 2 0000-0002-0839-3748 'Lietzan, A.D.' 3 0000-0001-6388-2491 'Redinbo, M.R.' 4 0000-0003-0814-5346 'Dangl, J.L.' 5 0000-0003-3199-8654 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 373 _citation.language ? _citation.page_first 420 _citation.page_last 425 _citation.title ;Plant "helper" immune receptors are Ca 2+ -permeable nonselective cation channels. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.abg7917 _citation.pdbx_database_id_PubMed 34140391 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jacob, P.' 1 ? primary 'Kim, N.H.' 2 ? primary 'Wu, F.' 3 ? primary 'El-Kasmi, F.' 4 ? primary 'Chi, Y.' 5 ? primary 'Walton, W.G.' 6 ? primary 'Furzer, O.J.' 7 ? primary 'Lietzan, A.D.' 8 ? primary 'Sunil, S.' 9 ? primary 'Kempthorn, K.' 10 ? primary 'Redinbo, M.R.' 11 ? primary 'Pei, Z.M.' 12 ? primary 'Wan, L.' 13 ? primary 'Dangl, J.L.' 14 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7L7V _cell.details ? _cell.formula_units_Z ? _cell.length_a 84.332 _cell.length_a_esd ? _cell.length_b 89.656 _cell.length_b_esd ? _cell.length_c 149.398 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7L7V _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Probable disease resistance protein At5g66900' _entity.formula_weight 15861.127 _entity.pdbx_number_of_molecules 6 _entity.pdbx_ec ? _entity.pdbx_mutation 'K94E, K96E, R99E, K100E, R103E, K106E, K110E' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAMNDWASLGIGSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIE RADVAVRKFPRVKWYEESEYTEEIEEINEDMLEFCQIDLQLLQHRNQWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMNDWASLGIGSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIE RADVAVRKFPRVKWYEESEYTEEIEEINEDMLEFCQIDLQLLQHRNQWSHPQFEK ; _entity_poly.pdbx_strand_id A,B,C,D,E,F _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MET n 1 5 ASN n 1 6 ASP n 1 7 TRP n 1 8 ALA n 1 9 SER n 1 10 LEU n 1 11 GLY n 1 12 ILE n 1 13 GLY n 1 14 SER n 1 15 ILE n 1 16 GLY n 1 17 GLU n 1 18 ALA n 1 19 VAL n 1 20 PHE n 1 21 SER n 1 22 LYS n 1 23 LEU n 1 24 LEU n 1 25 LYS n 1 26 VAL n 1 27 VAL n 1 28 ILE n 1 29 ASP n 1 30 GLU n 1 31 ALA n 1 32 LYS n 1 33 LYS n 1 34 PHE n 1 35 LYS n 1 36 ALA n 1 37 PHE n 1 38 LYS n 1 39 PRO n 1 40 LEU n 1 41 SER n 1 42 LYS n 1 43 ASP n 1 44 LEU n 1 45 VAL n 1 46 SER n 1 47 THR n 1 48 MET n 1 49 GLU n 1 50 ILE n 1 51 LEU n 1 52 PHE n 1 53 PRO n 1 54 LEU n 1 55 THR n 1 56 GLN n 1 57 LYS n 1 58 ILE n 1 59 ASP n 1 60 SER n 1 61 MET n 1 62 GLN n 1 63 LYS n 1 64 GLU n 1 65 LEU n 1 66 ASP n 1 67 PHE n 1 68 GLY n 1 69 VAL n 1 70 LYS n 1 71 GLU n 1 72 LEU n 1 73 LYS n 1 74 GLU n 1 75 LEU n 1 76 ARG n 1 77 ASP n 1 78 THR n 1 79 ILE n 1 80 GLU n 1 81 ARG n 1 82 ALA n 1 83 ASP n 1 84 VAL n 1 85 ALA n 1 86 VAL n 1 87 ARG n 1 88 LYS n 1 89 PHE n 1 90 PRO n 1 91 ARG n 1 92 VAL n 1 93 LYS n 1 94 TRP n 1 95 TYR n 1 96 GLU n 1 97 GLU n 1 98 SER n 1 99 GLU n 1 100 TYR n 1 101 THR n 1 102 GLU n 1 103 GLU n 1 104 ILE n 1 105 GLU n 1 106 GLU n 1 107 ILE n 1 108 ASN n 1 109 GLU n 1 110 ASP n 1 111 MET n 1 112 LEU n 1 113 GLU n 1 114 PHE n 1 115 CYS n 1 116 GLN n 1 117 ILE n 1 118 ASP n 1 119 LEU n 1 120 GLN n 1 121 LEU n 1 122 LEU n 1 123 GLN n 1 124 HIS n 1 125 ARG n 1 126 ASN n 1 127 GLN n 1 128 TRP n 1 129 SER n 1 130 HIS n 1 131 PRO n 1 132 GLN n 1 133 PHE n 1 134 GLU n 1 135 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 135 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'At5g66900, MUD21.16' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DRL42_ARATH _struct_ref.pdbx_db_accession Q9FKZ1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNDWASLGIGSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIERAD VAVRKFPRVKWYEKSKYTRKIERINKDMLKFCQIDLQLLQHRNQ ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7L7V A 4 ? 127 ? Q9FKZ1 1 ? 124 ? 4 127 2 1 7L7V B 4 ? 127 ? Q9FKZ1 1 ? 124 ? 4 127 3 1 7L7V C 4 ? 127 ? Q9FKZ1 1 ? 124 ? 4 127 4 1 7L7V D 4 ? 127 ? Q9FKZ1 1 ? 124 ? 4 127 5 1 7L7V E 4 ? 127 ? Q9FKZ1 1 ? 124 ? 4 127 6 1 7L7V F 4 ? 127 ? Q9FKZ1 1 ? 124 ? 4 127 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7L7V SER A 1 ? UNP Q9FKZ1 ? ? 'expression tag' 1 1 1 7L7V ASN A 2 ? UNP Q9FKZ1 ? ? 'expression tag' 2 2 1 7L7V ALA A 3 ? UNP Q9FKZ1 ? ? 'expression tag' 3 3 1 7L7V GLU A 97 ? UNP Q9FKZ1 LYS 94 'engineered mutation' 97 4 1 7L7V GLU A 99 ? UNP Q9FKZ1 LYS 96 'engineered mutation' 99 5 1 7L7V GLU A 102 ? UNP Q9FKZ1 ARG 99 'engineered mutation' 102 6 1 7L7V GLU A 103 ? UNP Q9FKZ1 LYS 100 'engineered mutation' 103 7 1 7L7V GLU A 106 ? UNP Q9FKZ1 ARG 103 'engineered mutation' 106 8 1 7L7V GLU A 109 ? UNP Q9FKZ1 LYS 106 'engineered mutation' 109 9 1 7L7V GLU A 113 ? UNP Q9FKZ1 LYS 110 'engineered mutation' 113 10 1 7L7V TRP A 128 ? UNP Q9FKZ1 ? ? 'expression tag' 128 11 1 7L7V SER A 129 ? UNP Q9FKZ1 ? ? 'expression tag' 129 12 1 7L7V HIS A 130 ? UNP Q9FKZ1 ? ? 'expression tag' 130 13 1 7L7V PRO A 131 ? UNP Q9FKZ1 ? ? 'expression tag' 131 14 1 7L7V GLN A 132 ? UNP Q9FKZ1 ? ? 'expression tag' 132 15 1 7L7V PHE A 133 ? UNP Q9FKZ1 ? ? 'expression tag' 133 16 1 7L7V GLU A 134 ? UNP Q9FKZ1 ? ? 'expression tag' 134 17 1 7L7V LYS A 135 ? UNP Q9FKZ1 ? ? 'expression tag' 135 18 2 7L7V SER B 1 ? UNP Q9FKZ1 ? ? 'expression tag' 1 19 2 7L7V ASN B 2 ? UNP Q9FKZ1 ? ? 'expression tag' 2 20 2 7L7V ALA B 3 ? UNP Q9FKZ1 ? ? 'expression tag' 3 21 2 7L7V GLU B 97 ? UNP Q9FKZ1 LYS 94 'engineered mutation' 97 22 2 7L7V GLU B 99 ? UNP Q9FKZ1 LYS 96 'engineered mutation' 99 23 2 7L7V GLU B 102 ? UNP Q9FKZ1 ARG 99 'engineered mutation' 102 24 2 7L7V GLU B 103 ? UNP Q9FKZ1 LYS 100 'engineered mutation' 103 25 2 7L7V GLU B 106 ? UNP Q9FKZ1 ARG 103 'engineered mutation' 106 26 2 7L7V GLU B 109 ? UNP Q9FKZ1 LYS 106 'engineered mutation' 109 27 2 7L7V GLU B 113 ? UNP Q9FKZ1 LYS 110 'engineered mutation' 113 28 2 7L7V TRP B 128 ? UNP Q9FKZ1 ? ? 'expression tag' 128 29 2 7L7V SER B 129 ? UNP Q9FKZ1 ? ? 'expression tag' 129 30 2 7L7V HIS B 130 ? UNP Q9FKZ1 ? ? 'expression tag' 130 31 2 7L7V PRO B 131 ? UNP Q9FKZ1 ? ? 'expression tag' 131 32 2 7L7V GLN B 132 ? UNP Q9FKZ1 ? ? 'expression tag' 132 33 2 7L7V PHE B 133 ? UNP Q9FKZ1 ? ? 'expression tag' 133 34 2 7L7V GLU B 134 ? UNP Q9FKZ1 ? ? 'expression tag' 134 35 2 7L7V LYS B 135 ? UNP Q9FKZ1 ? ? 'expression tag' 135 36 3 7L7V SER C 1 ? UNP Q9FKZ1 ? ? 'expression tag' 1 37 3 7L7V ASN C 2 ? UNP Q9FKZ1 ? ? 'expression tag' 2 38 3 7L7V ALA C 3 ? UNP Q9FKZ1 ? ? 'expression tag' 3 39 3 7L7V GLU C 97 ? UNP Q9FKZ1 LYS 94 'engineered mutation' 97 40 3 7L7V GLU C 99 ? UNP Q9FKZ1 LYS 96 'engineered mutation' 99 41 3 7L7V GLU C 102 ? UNP Q9FKZ1 ARG 99 'engineered mutation' 102 42 3 7L7V GLU C 103 ? UNP Q9FKZ1 LYS 100 'engineered mutation' 103 43 3 7L7V GLU C 106 ? UNP Q9FKZ1 ARG 103 'engineered mutation' 106 44 3 7L7V GLU C 109 ? UNP Q9FKZ1 LYS 106 'engineered mutation' 109 45 3 7L7V GLU C 113 ? UNP Q9FKZ1 LYS 110 'engineered mutation' 113 46 3 7L7V TRP C 128 ? UNP Q9FKZ1 ? ? 'expression tag' 128 47 3 7L7V SER C 129 ? UNP Q9FKZ1 ? ? 'expression tag' 129 48 3 7L7V HIS C 130 ? UNP Q9FKZ1 ? ? 'expression tag' 130 49 3 7L7V PRO C 131 ? UNP Q9FKZ1 ? ? 'expression tag' 131 50 3 7L7V GLN C 132 ? UNP Q9FKZ1 ? ? 'expression tag' 132 51 3 7L7V PHE C 133 ? UNP Q9FKZ1 ? ? 'expression tag' 133 52 3 7L7V GLU C 134 ? UNP Q9FKZ1 ? ? 'expression tag' 134 53 3 7L7V LYS C 135 ? UNP Q9FKZ1 ? ? 'expression tag' 135 54 4 7L7V SER D 1 ? UNP Q9FKZ1 ? ? 'expression tag' 1 55 4 7L7V ASN D 2 ? UNP Q9FKZ1 ? ? 'expression tag' 2 56 4 7L7V ALA D 3 ? UNP Q9FKZ1 ? ? 'expression tag' 3 57 4 7L7V GLU D 97 ? UNP Q9FKZ1 LYS 94 'engineered mutation' 97 58 4 7L7V GLU D 99 ? UNP Q9FKZ1 LYS 96 'engineered mutation' 99 59 4 7L7V GLU D 102 ? UNP Q9FKZ1 ARG 99 'engineered mutation' 102 60 4 7L7V GLU D 103 ? UNP Q9FKZ1 LYS 100 'engineered mutation' 103 61 4 7L7V GLU D 106 ? UNP Q9FKZ1 ARG 103 'engineered mutation' 106 62 4 7L7V GLU D 109 ? UNP Q9FKZ1 LYS 106 'engineered mutation' 109 63 4 7L7V GLU D 113 ? UNP Q9FKZ1 LYS 110 'engineered mutation' 113 64 4 7L7V TRP D 128 ? UNP Q9FKZ1 ? ? 'expression tag' 128 65 4 7L7V SER D 129 ? UNP Q9FKZ1 ? ? 'expression tag' 129 66 4 7L7V HIS D 130 ? UNP Q9FKZ1 ? ? 'expression tag' 130 67 4 7L7V PRO D 131 ? UNP Q9FKZ1 ? ? 'expression tag' 131 68 4 7L7V GLN D 132 ? UNP Q9FKZ1 ? ? 'expression tag' 132 69 4 7L7V PHE D 133 ? UNP Q9FKZ1 ? ? 'expression tag' 133 70 4 7L7V GLU D 134 ? UNP Q9FKZ1 ? ? 'expression tag' 134 71 4 7L7V LYS D 135 ? UNP Q9FKZ1 ? ? 'expression tag' 135 72 5 7L7V SER E 1 ? UNP Q9FKZ1 ? ? 'expression tag' 1 73 5 7L7V ASN E 2 ? UNP Q9FKZ1 ? ? 'expression tag' 2 74 5 7L7V ALA E 3 ? UNP Q9FKZ1 ? ? 'expression tag' 3 75 5 7L7V GLU E 97 ? UNP Q9FKZ1 LYS 94 'engineered mutation' 97 76 5 7L7V GLU E 99 ? UNP Q9FKZ1 LYS 96 'engineered mutation' 99 77 5 7L7V GLU E 102 ? UNP Q9FKZ1 ARG 99 'engineered mutation' 102 78 5 7L7V GLU E 103 ? UNP Q9FKZ1 LYS 100 'engineered mutation' 103 79 5 7L7V GLU E 106 ? UNP Q9FKZ1 ARG 103 'engineered mutation' 106 80 5 7L7V GLU E 109 ? UNP Q9FKZ1 LYS 106 'engineered mutation' 109 81 5 7L7V GLU E 113 ? UNP Q9FKZ1 LYS 110 'engineered mutation' 113 82 5 7L7V TRP E 128 ? UNP Q9FKZ1 ? ? 'expression tag' 128 83 5 7L7V SER E 129 ? UNP Q9FKZ1 ? ? 'expression tag' 129 84 5 7L7V HIS E 130 ? UNP Q9FKZ1 ? ? 'expression tag' 130 85 5 7L7V PRO E 131 ? UNP Q9FKZ1 ? ? 'expression tag' 131 86 5 7L7V GLN E 132 ? UNP Q9FKZ1 ? ? 'expression tag' 132 87 5 7L7V PHE E 133 ? UNP Q9FKZ1 ? ? 'expression tag' 133 88 5 7L7V GLU E 134 ? UNP Q9FKZ1 ? ? 'expression tag' 134 89 5 7L7V LYS E 135 ? UNP Q9FKZ1 ? ? 'expression tag' 135 90 6 7L7V SER F 1 ? UNP Q9FKZ1 ? ? 'expression tag' 1 91 6 7L7V ASN F 2 ? UNP Q9FKZ1 ? ? 'expression tag' 2 92 6 7L7V ALA F 3 ? UNP Q9FKZ1 ? ? 'expression tag' 3 93 6 7L7V GLU F 97 ? UNP Q9FKZ1 LYS 94 'engineered mutation' 97 94 6 7L7V GLU F 99 ? UNP Q9FKZ1 LYS 96 'engineered mutation' 99 95 6 7L7V GLU F 102 ? UNP Q9FKZ1 ARG 99 'engineered mutation' 102 96 6 7L7V GLU F 103 ? UNP Q9FKZ1 LYS 100 'engineered mutation' 103 97 6 7L7V GLU F 106 ? UNP Q9FKZ1 ARG 103 'engineered mutation' 106 98 6 7L7V GLU F 109 ? UNP Q9FKZ1 LYS 106 'engineered mutation' 109 99 6 7L7V GLU F 113 ? UNP Q9FKZ1 LYS 110 'engineered mutation' 113 100 6 7L7V TRP F 128 ? UNP Q9FKZ1 ? ? 'expression tag' 128 101 6 7L7V SER F 129 ? UNP Q9FKZ1 ? ? 'expression tag' 129 102 6 7L7V HIS F 130 ? UNP Q9FKZ1 ? ? 'expression tag' 130 103 6 7L7V PRO F 131 ? UNP Q9FKZ1 ? ? 'expression tag' 131 104 6 7L7V GLN F 132 ? UNP Q9FKZ1 ? ? 'expression tag' 132 105 6 7L7V PHE F 133 ? UNP Q9FKZ1 ? ? 'expression tag' 133 106 6 7L7V GLU F 134 ? UNP Q9FKZ1 ? ? 'expression tag' 134 107 6 7L7V LYS F 135 ? UNP Q9FKZ1 ? ? 'expression tag' 135 108 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7L7V _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M MES (pH 5.5), 1 M Potassium Sodium Tartrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-04-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03317 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03317 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7L7V _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.950 _reflns.d_resolution_low 40.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24727 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.700 _reflns.pdbx_Rmerge_I_obs 0.130 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.727 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.135 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 289192 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.950 3.000 ? ? ? ? ? ? 1218 100.000 ? ? ? ? 1.687 ? ? ? ? ? ? ? ? 8.500 ? 0.412 ? ? 1.793 0.594 ? 1 1 0.506 ? ? 3.000 3.060 ? ? ? ? ? ? 1200 99.100 ? ? ? ? 1.591 ? ? ? ? ? ? ? ? 9.700 ? 0.428 ? ? 1.677 0.522 ? 2 1 0.612 ? ? 3.060 3.110 ? ? ? ? ? ? 1227 100.000 ? ? ? ? 1.281 ? ? ? ? ? ? ? ? 10.300 ? 0.422 ? ? 1.347 0.408 ? 3 1 0.727 ? ? 3.110 3.180 ? ? ? ? ? ? 1200 98.800 ? ? ? ? 1.108 ? ? ? ? ? ? ? ? 10.600 ? 0.416 ? ? 1.163 0.347 ? 4 1 0.796 ? ? 3.180 3.250 ? ? ? ? ? ? 1209 100.000 ? ? ? ? 0.978 ? ? ? ? ? ? ? ? 11.700 ? 0.419 ? ? 1.021 0.290 ? 5 1 0.848 ? ? 3.250 3.320 ? ? ? ? ? ? 1222 99.400 ? ? ? ? 0.751 ? ? ? ? ? ? ? ? 11.500 ? 0.440 ? ? 0.785 0.224 ? 6 1 0.896 ? ? 3.320 3.410 ? ? ? ? ? ? 1205 99.700 ? ? ? ? 0.609 ? ? ? ? ? ? ? ? 11.700 ? 0.457 ? ? 0.636 0.181 ? 7 1 0.927 ? ? 3.410 3.500 ? ? ? ? ? ? 1217 99.800 ? ? ? ? 0.499 ? ? ? ? ? ? ? ? 12.300 ? 0.463 ? ? 0.520 0.144 ? 8 1 0.954 ? ? 3.500 3.600 ? ? ? ? ? ? 1220 99.600 ? ? ? ? 0.367 ? ? ? ? ? ? ? ? 12.300 ? 0.484 ? ? 0.382 0.107 ? 9 1 0.974 ? ? 3.600 3.720 ? ? ? ? ? ? 1231 99.700 ? ? ? ? 0.299 ? ? ? ? ? ? ? ? 12.100 ? 0.544 ? ? 0.312 0.088 ? 10 1 0.982 ? ? 3.720 3.850 ? ? ? ? ? ? 1228 100.000 ? ? ? ? 0.208 ? ? ? ? ? ? ? ? 11.600 ? 0.578 ? ? 0.218 0.064 ? 11 1 0.989 ? ? 3.850 4.000 ? ? ? ? ? ? 1214 99.800 ? ? ? ? 0.169 ? ? ? ? ? ? ? ? 12.300 ? 0.650 ? ? 0.176 0.050 ? 12 1 0.994 ? ? 4.000 4.180 ? ? ? ? ? ? 1240 99.800 ? ? ? ? 0.129 ? ? ? ? ? ? ? ? 12.000 ? 0.727 ? ? 0.135 0.039 ? 13 1 0.996 ? ? 4.180 4.410 ? ? ? ? ? ? 1232 99.800 ? ? ? ? 0.108 ? ? ? ? ? ? ? ? 12.900 ? 0.847 ? ? 0.113 0.031 ? 14 1 0.996 ? ? 4.410 4.680 ? ? ? ? ? ? 1242 99.900 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 13.000 ? 0.901 ? ? 0.095 0.026 ? 15 1 0.998 ? ? 4.680 5.040 ? ? ? ? ? ? 1245 99.800 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 12.200 ? 0.985 ? ? 0.090 0.026 ? 16 1 0.998 ? ? 5.040 5.550 ? ? ? ? ? ? 1257 100.000 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 12.600 ? 0.933 ? ? 0.096 0.027 ? 17 1 0.997 ? ? 5.550 6.350 ? ? ? ? ? ? 1257 99.900 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 13.000 ? 0.966 ? ? 0.090 0.025 ? 18 1 0.998 ? ? 6.350 7.990 ? ? ? ? ? ? 1292 100.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 12.100 ? 1.231 ? ? 0.065 0.019 ? 19 1 0.999 ? ? 7.990 40.000 ? ? ? ? ? ? 1371 99.900 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 11.400 ? 1.766 ? ? 0.047 0.014 ? 20 1 0.999 ? ? # _refine.aniso_B[1][1] -1.4300 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -1.7100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 3.1400 _refine.B_iso_max 227.150 _refine.B_iso_mean 84.5910 _refine.B_iso_min 43.140 _refine.correlation_coeff_Fo_to_Fc 0.9430 _refine.correlation_coeff_Fo_to_Fc_free 0.9280 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7L7V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9500 _refine.ls_d_res_low 39.6100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23168 _refine.ls_number_reflns_R_free 1285 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6300 _refine.ls_percent_reflns_R_free 5.3000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2205 _refine.ls_R_factor_R_free 0.2403 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2194 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.0150 _refine.pdbx_overall_ESU_R_Free 0.3440 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 37.2140 _refine.overall_SU_ML 0.2940 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.9500 _refine_hist.d_res_low 39.6100 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 5239 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 665 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 5239 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.013 5321 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 4988 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.628 1.636 7198 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.651 1.577 11480 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.337 5.000 658 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.260 24.449 272 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.674 15.000 955 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.730 15.000 22 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.092 0.200 722 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 5937 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1123 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.9500 _refine_ls_shell.d_res_low 3.0270 _refine_ls_shell.number_reflns_all 1753 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 83 _refine_ls_shell.number_reflns_R_work 1670 _refine_ls_shell.percent_reflns_obs 98.2100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3620 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3400 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7L7V _struct.title 'Crystal structure of Arabidopsis NRG1.1 CC-R domain K94E/K96E/R99E/K100E/R103E/K106E/K110E mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7L7V _struct_keywords.text '4-helix bundle, cell death, membrane pore, calcium channel, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 2 ? LEU A 10 ? ASN A 2 LEU A 10 1 ? 9 HELX_P HELX_P2 AA2 VAL A 19 ? PHE A 34 ? VAL A 19 PHE A 34 1 ? 16 HELX_P HELX_P3 AA3 PHE A 37 ? LYS A 42 ? PHE A 37 LYS A 42 1 ? 6 HELX_P HELX_P4 AA4 LYS A 42 ? MET A 61 ? LYS A 42 MET A 61 1 ? 20 HELX_P HELX_P5 AA5 GLN A 62 ? LEU A 65 ? GLN A 62 LEU A 65 5 ? 4 HELX_P HELX_P6 AA6 VAL A 69 ? LYS A 88 ? VAL A 69 LYS A 88 1 ? 20 HELX_P HELX_P7 AA7 PHE A 89 ? VAL A 92 ? PHE A 89 VAL A 92 5 ? 4 HELX_P HELX_P8 AA8 LYS A 93 ? TYR A 95 ? LYS A 93 TYR A 95 5 ? 3 HELX_P HELX_P9 AA9 GLU A 96 ? CYS A 115 ? GLU A 96 CYS A 115 1 ? 20 HELX_P HELX_P10 AB1 VAL B 19 ? LYS B 32 ? VAL B 19 LYS B 32 1 ? 14 HELX_P HELX_P11 AB2 LYS B 33 ? LYS B 35 ? LYS B 33 LYS B 35 5 ? 3 HELX_P HELX_P12 AB3 PHE B 37 ? LYS B 42 ? PHE B 37 LYS B 42 1 ? 6 HELX_P HELX_P13 AB4 LYS B 42 ? MET B 61 ? LYS B 42 MET B 61 1 ? 20 HELX_P HELX_P14 AB5 GLY B 68 ? PHE B 89 ? GLY B 68 PHE B 89 1 ? 22 HELX_P HELX_P15 AB6 PRO B 90 ? VAL B 92 ? PRO B 90 VAL B 92 5 ? 3 HELX_P HELX_P16 AB7 LYS B 93 ? TYR B 95 ? LYS B 93 TYR B 95 5 ? 3 HELX_P HELX_P17 AB8 GLU B 96 ? ILE B 117 ? GLU B 96 ILE B 117 1 ? 22 HELX_P HELX_P18 AB9 LEU B 119 ? ARG B 125 ? LEU B 119 ARG B 125 1 ? 7 HELX_P HELX_P19 AC1 PHE C 20 ? LYS C 32 ? PHE C 20 LYS C 32 1 ? 13 HELX_P HELX_P20 AC2 PHE C 37 ? LYS C 42 ? PHE C 37 LYS C 42 1 ? 6 HELX_P HELX_P21 AC3 LYS C 42 ? MET C 61 ? LYS C 42 MET C 61 1 ? 20 HELX_P HELX_P22 AC4 VAL C 69 ? LYS C 88 ? VAL C 69 LYS C 88 1 ? 20 HELX_P HELX_P23 AC5 PHE C 89 ? VAL C 92 ? PHE C 89 VAL C 92 5 ? 4 HELX_P HELX_P24 AC6 LYS C 93 ? TYR C 95 ? LYS C 93 TYR C 95 5 ? 3 HELX_P HELX_P25 AC7 GLU C 96 ? CYS C 115 ? GLU C 96 CYS C 115 1 ? 20 HELX_P HELX_P26 AC8 ASP C 118 ? GLN C 127 ? ASP C 118 GLN C 127 1 ? 10 HELX_P HELX_P27 AC9 VAL D 19 ? LYS D 33 ? VAL D 19 LYS D 33 1 ? 15 HELX_P HELX_P28 AD1 PHE D 37 ? LYS D 42 ? PHE D 37 LYS D 42 1 ? 6 HELX_P HELX_P29 AD2 LYS D 42 ? MET D 61 ? LYS D 42 MET D 61 1 ? 20 HELX_P HELX_P30 AD3 VAL D 69 ? LYS D 88 ? VAL D 69 LYS D 88 1 ? 20 HELX_P HELX_P31 AD4 PHE D 89 ? VAL D 92 ? PHE D 89 VAL D 92 5 ? 4 HELX_P HELX_P32 AD5 LYS D 93 ? TYR D 95 ? LYS D 93 TYR D 95 5 ? 3 HELX_P HELX_P33 AD6 GLU D 96 ? GLN D 116 ? GLU D 96 GLN D 116 1 ? 21 HELX_P HELX_P34 AD7 PHE E 20 ? PHE E 34 ? PHE E 20 PHE E 34 1 ? 15 HELX_P HELX_P35 AD8 PHE E 37 ? LYS E 42 ? PHE E 37 LYS E 42 1 ? 6 HELX_P HELX_P36 AD9 ASP E 43 ? MET E 61 ? ASP E 43 MET E 61 1 ? 19 HELX_P HELX_P37 AE1 VAL E 69 ? LYS E 88 ? VAL E 69 LYS E 88 1 ? 20 HELX_P HELX_P38 AE2 PHE E 89 ? VAL E 92 ? PHE E 89 VAL E 92 5 ? 4 HELX_P HELX_P39 AE3 LYS E 93 ? TYR E 95 ? LYS E 93 TYR E 95 5 ? 3 HELX_P HELX_P40 AE4 GLU E 96 ? CYS E 115 ? GLU E 96 CYS E 115 1 ? 20 HELX_P HELX_P41 AE5 ASP E 118 ? ARG E 125 ? ASP E 118 ARG E 125 1 ? 8 HELX_P HELX_P42 AE6 ALA F 3 ? LEU F 10 ? ALA F 3 LEU F 10 1 ? 8 HELX_P HELX_P43 AE7 VAL F 19 ? PHE F 34 ? VAL F 19 PHE F 34 1 ? 16 HELX_P HELX_P44 AE8 PHE F 37 ? LYS F 42 ? PHE F 37 LYS F 42 1 ? 6 HELX_P HELX_P45 AE9 LYS F 42 ? MET F 61 ? LYS F 42 MET F 61 1 ? 20 HELX_P HELX_P46 AF1 VAL F 69 ? LYS F 88 ? VAL F 69 LYS F 88 1 ? 20 HELX_P HELX_P47 AF2 PHE F 89 ? VAL F 92 ? PHE F 89 VAL F 92 5 ? 4 HELX_P HELX_P48 AF3 LYS F 93 ? TYR F 95 ? LYS F 93 TYR F 95 5 ? 3 HELX_P HELX_P49 AF4 GLU F 96 ? PHE F 114 ? GLU F 96 PHE F 114 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7L7V _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011858 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011154 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006694 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLN 123 123 ? ? ? A . n A 1 124 HIS 124 124 ? ? ? A . n A 1 125 ARG 125 125 ? ? ? A . n A 1 126 ASN 126 126 ? ? ? A . n A 1 127 GLN 127 127 ? ? ? A . n A 1 128 TRP 128 128 ? ? ? A . n A 1 129 SER 129 129 ? ? ? A . n A 1 130 HIS 130 130 ? ? ? A . n A 1 131 PRO 131 131 ? ? ? A . n A 1 132 GLN 132 132 ? ? ? A . n A 1 133 PHE 133 133 ? ? ? A . n A 1 134 GLU 134 134 ? ? ? A . n A 1 135 LYS 135 135 ? ? ? A . n B 1 1 SER 1 1 ? ? ? B . n B 1 2 ASN 2 2 ? ? ? B . n B 1 3 ALA 3 3 ? ? ? B . n B 1 4 MET 4 4 ? ? ? B . n B 1 5 ASN 5 5 ? ? ? B . n B 1 6 ASP 6 6 ? ? ? B . n B 1 7 TRP 7 7 ? ? ? B . n B 1 8 ALA 8 8 ? ? ? B . n B 1 9 SER 9 9 ? ? ? B . n B 1 10 LEU 10 10 ? ? ? B . n B 1 11 GLY 11 11 ? ? ? B . n B 1 12 ILE 12 12 ? ? ? B . n B 1 13 GLY 13 13 ? ? ? B . n B 1 14 SER 14 14 ? ? ? B . n B 1 15 ILE 15 15 ? ? ? B . n B 1 16 GLY 16 16 ? ? ? B . n B 1 17 GLU 17 17 ? ? ? B . n B 1 18 ALA 18 18 18 ALA ALA B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 PHE 20 20 20 PHE PHE B . n B 1 21 SER 21 21 21 SER SER B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 VAL 27 27 27 VAL VAL B . n B 1 28 ILE 28 28 28 ILE ILE B . n B 1 29 ASP 29 29 29 ASP ASP B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 ALA 31 31 31 ALA ALA B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 PHE 37 37 37 PHE PHE B . n B 1 38 LYS 38 38 38 LYS LYS B . n B 1 39 PRO 39 39 39 PRO PRO B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 SER 41 41 41 SER SER B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 ASP 43 43 43 ASP ASP B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 SER 46 46 46 SER SER B . n B 1 47 THR 47 47 47 THR THR B . n B 1 48 MET 48 48 48 MET MET B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 ILE 50 50 50 ILE ILE B . n B 1 51 LEU 51 51 51 LEU LEU B . n B 1 52 PHE 52 52 52 PHE PHE B . n B 1 53 PRO 53 53 53 PRO PRO B . n B 1 54 LEU 54 54 54 LEU LEU B . n B 1 55 THR 55 55 55 THR THR B . n B 1 56 GLN 56 56 56 GLN GLN B . n B 1 57 LYS 57 57 57 LYS LYS B . n B 1 58 ILE 58 58 58 ILE ILE B . n B 1 59 ASP 59 59 59 ASP ASP B . n B 1 60 SER 60 60 60 SER SER B . n B 1 61 MET 61 61 61 MET MET B . n B 1 62 GLN 62 62 62 GLN GLN B . n B 1 63 LYS 63 63 63 LYS LYS B . n B 1 64 GLU 64 64 64 GLU GLU B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 ASP 66 66 66 ASP ASP B . n B 1 67 PHE 67 67 67 PHE PHE B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 VAL 69 69 69 VAL VAL B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 GLU 71 71 71 GLU GLU B . n B 1 72 LEU 72 72 72 LEU LEU B . n B 1 73 LYS 73 73 73 LYS LYS B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 LEU 75 75 75 LEU LEU B . n B 1 76 ARG 76 76 76 ARG ARG B . n B 1 77 ASP 77 77 77 ASP ASP B . n B 1 78 THR 78 78 78 THR THR B . n B 1 79 ILE 79 79 79 ILE ILE B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 ARG 81 81 81 ARG ARG B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 ASP 83 83 83 ASP ASP B . n B 1 84 VAL 84 84 84 VAL VAL B . n B 1 85 ALA 85 85 85 ALA ALA B . n B 1 86 VAL 86 86 86 VAL VAL B . n B 1 87 ARG 87 87 87 ARG ARG B . n B 1 88 LYS 88 88 88 LYS LYS B . n B 1 89 PHE 89 89 89 PHE PHE B . n B 1 90 PRO 90 90 90 PRO PRO B . n B 1 91 ARG 91 91 91 ARG ARG B . n B 1 92 VAL 92 92 92 VAL VAL B . n B 1 93 LYS 93 93 93 LYS LYS B . n B 1 94 TRP 94 94 94 TRP TRP B . n B 1 95 TYR 95 95 95 TYR TYR B . n B 1 96 GLU 96 96 96 GLU GLU B . n B 1 97 GLU 97 97 97 GLU GLU B . n B 1 98 SER 98 98 98 SER SER B . n B 1 99 GLU 99 99 99 GLU GLU B . n B 1 100 TYR 100 100 100 TYR TYR B . n B 1 101 THR 101 101 101 THR THR B . n B 1 102 GLU 102 102 102 GLU GLU B . n B 1 103 GLU 103 103 103 GLU GLU B . n B 1 104 ILE 104 104 104 ILE ILE B . n B 1 105 GLU 105 105 105 GLU GLU B . n B 1 106 GLU 106 106 106 GLU GLU B . n B 1 107 ILE 107 107 107 ILE ILE B . n B 1 108 ASN 108 108 108 ASN ASN B . n B 1 109 GLU 109 109 109 GLU GLU B . n B 1 110 ASP 110 110 110 ASP ASP B . n B 1 111 MET 111 111 111 MET MET B . n B 1 112 LEU 112 112 112 LEU LEU B . n B 1 113 GLU 113 113 113 GLU GLU B . n B 1 114 PHE 114 114 114 PHE PHE B . n B 1 115 CYS 115 115 115 CYS CYS B . n B 1 116 GLN 116 116 116 GLN GLN B . n B 1 117 ILE 117 117 117 ILE ILE B . n B 1 118 ASP 118 118 118 ASP ASP B . n B 1 119 LEU 119 119 119 LEU LEU B . n B 1 120 GLN 120 120 120 GLN GLN B . n B 1 121 LEU 121 121 121 LEU LEU B . n B 1 122 LEU 122 122 122 LEU LEU B . n B 1 123 GLN 123 123 123 GLN GLN B . n B 1 124 HIS 124 124 124 HIS HIS B . n B 1 125 ARG 125 125 125 ARG ARG B . n B 1 126 ASN 126 126 126 ASN ASN B . n B 1 127 GLN 127 127 ? ? ? B . n B 1 128 TRP 128 128 ? ? ? B . n B 1 129 SER 129 129 ? ? ? B . n B 1 130 HIS 130 130 ? ? ? B . n B 1 131 PRO 131 131 ? ? ? B . n B 1 132 GLN 132 132 ? ? ? B . n B 1 133 PHE 133 133 ? ? ? B . n B 1 134 GLU 134 134 ? ? ? B . n B 1 135 LYS 135 135 ? ? ? B . n C 1 1 SER 1 1 ? ? ? C . n C 1 2 ASN 2 2 ? ? ? C . n C 1 3 ALA 3 3 ? ? ? C . n C 1 4 MET 4 4 ? ? ? C . n C 1 5 ASN 5 5 ? ? ? C . n C 1 6 ASP 6 6 ? ? ? C . n C 1 7 TRP 7 7 ? ? ? C . n C 1 8 ALA 8 8 ? ? ? C . n C 1 9 SER 9 9 ? ? ? C . n C 1 10 LEU 10 10 ? ? ? C . n C 1 11 GLY 11 11 ? ? ? C . n C 1 12 ILE 12 12 ? ? ? C . n C 1 13 GLY 13 13 ? ? ? C . n C 1 14 SER 14 14 ? ? ? C . n C 1 15 ILE 15 15 ? ? ? C . n C 1 16 GLY 16 16 ? ? ? C . n C 1 17 GLU 17 17 ? ? ? C . n C 1 18 ALA 18 18 ? ? ? C . n C 1 19 VAL 19 19 19 VAL VAL C . n C 1 20 PHE 20 20 20 PHE PHE C . n C 1 21 SER 21 21 21 SER SER C . n C 1 22 LYS 22 22 22 LYS LYS C . n C 1 23 LEU 23 23 23 LEU LEU C . n C 1 24 LEU 24 24 24 LEU LEU C . n C 1 25 LYS 25 25 25 LYS LYS C . n C 1 26 VAL 26 26 26 VAL VAL C . n C 1 27 VAL 27 27 27 VAL VAL C . n C 1 28 ILE 28 28 28 ILE ILE C . n C 1 29 ASP 29 29 29 ASP ASP C . n C 1 30 GLU 30 30 30 GLU GLU C . n C 1 31 ALA 31 31 31 ALA ALA C . n C 1 32 LYS 32 32 32 LYS LYS C . n C 1 33 LYS 33 33 33 LYS LYS C . n C 1 34 PHE 34 34 34 PHE PHE C . n C 1 35 LYS 35 35 35 LYS LYS C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 PHE 37 37 37 PHE PHE C . n C 1 38 LYS 38 38 38 LYS LYS C . n C 1 39 PRO 39 39 39 PRO PRO C . n C 1 40 LEU 40 40 40 LEU LEU C . n C 1 41 SER 41 41 41 SER SER C . n C 1 42 LYS 42 42 42 LYS LYS C . n C 1 43 ASP 43 43 43 ASP ASP C . n C 1 44 LEU 44 44 44 LEU LEU C . n C 1 45 VAL 45 45 45 VAL VAL C . n C 1 46 SER 46 46 46 SER SER C . n C 1 47 THR 47 47 47 THR THR C . n C 1 48 MET 48 48 48 MET MET C . n C 1 49 GLU 49 49 49 GLU GLU C . n C 1 50 ILE 50 50 50 ILE ILE C . n C 1 51 LEU 51 51 51 LEU LEU C . n C 1 52 PHE 52 52 52 PHE PHE C . n C 1 53 PRO 53 53 53 PRO PRO C . n C 1 54 LEU 54 54 54 LEU LEU C . n C 1 55 THR 55 55 55 THR THR C . n C 1 56 GLN 56 56 56 GLN GLN C . n C 1 57 LYS 57 57 57 LYS LYS C . n C 1 58 ILE 58 58 58 ILE ILE C . n C 1 59 ASP 59 59 59 ASP ASP C . n C 1 60 SER 60 60 60 SER SER C . n C 1 61 MET 61 61 61 MET MET C . n C 1 62 GLN 62 62 62 GLN GLN C . n C 1 63 LYS 63 63 63 LYS LYS C . n C 1 64 GLU 64 64 64 GLU GLU C . n C 1 65 LEU 65 65 65 LEU LEU C . n C 1 66 ASP 66 66 66 ASP ASP C . n C 1 67 PHE 67 67 67 PHE PHE C . n C 1 68 GLY 68 68 68 GLY GLY C . n C 1 69 VAL 69 69 69 VAL VAL C . n C 1 70 LYS 70 70 70 LYS LYS C . n C 1 71 GLU 71 71 71 GLU GLU C . n C 1 72 LEU 72 72 72 LEU LEU C . n C 1 73 LYS 73 73 73 LYS LYS C . n C 1 74 GLU 74 74 74 GLU GLU C . n C 1 75 LEU 75 75 75 LEU LEU C . n C 1 76 ARG 76 76 76 ARG ARG C . n C 1 77 ASP 77 77 77 ASP ASP C . n C 1 78 THR 78 78 78 THR THR C . n C 1 79 ILE 79 79 79 ILE ILE C . n C 1 80 GLU 80 80 80 GLU GLU C . n C 1 81 ARG 81 81 81 ARG ARG C . n C 1 82 ALA 82 82 82 ALA ALA C . n C 1 83 ASP 83 83 83 ASP ASP C . n C 1 84 VAL 84 84 84 VAL VAL C . n C 1 85 ALA 85 85 85 ALA ALA C . n C 1 86 VAL 86 86 86 VAL VAL C . n C 1 87 ARG 87 87 87 ARG ARG C . n C 1 88 LYS 88 88 88 LYS LYS C . n C 1 89 PHE 89 89 89 PHE PHE C . n C 1 90 PRO 90 90 90 PRO PRO C . n C 1 91 ARG 91 91 91 ARG ARG C . n C 1 92 VAL 92 92 92 VAL VAL C . n C 1 93 LYS 93 93 93 LYS LYS C . n C 1 94 TRP 94 94 94 TRP TRP C . n C 1 95 TYR 95 95 95 TYR TYR C . n C 1 96 GLU 96 96 96 GLU GLU C . n C 1 97 GLU 97 97 97 GLU GLU C . n C 1 98 SER 98 98 98 SER SER C . n C 1 99 GLU 99 99 99 GLU GLU C . n C 1 100 TYR 100 100 100 TYR TYR C . n C 1 101 THR 101 101 101 THR THR C . n C 1 102 GLU 102 102 102 GLU GLU C . n C 1 103 GLU 103 103 103 GLU GLU C . n C 1 104 ILE 104 104 104 ILE ILE C . n C 1 105 GLU 105 105 105 GLU GLU C . n C 1 106 GLU 106 106 106 GLU GLU C . n C 1 107 ILE 107 107 107 ILE ILE C . n C 1 108 ASN 108 108 108 ASN ASN C . n C 1 109 GLU 109 109 109 GLU GLU C . n C 1 110 ASP 110 110 110 ASP ASP C . n C 1 111 MET 111 111 111 MET MET C . n C 1 112 LEU 112 112 112 LEU LEU C . n C 1 113 GLU 113 113 113 GLU GLU C . n C 1 114 PHE 114 114 114 PHE PHE C . n C 1 115 CYS 115 115 115 CYS CYS C . n C 1 116 GLN 116 116 116 GLN GLN C . n C 1 117 ILE 117 117 117 ILE ILE C . n C 1 118 ASP 118 118 118 ASP ASP C . n C 1 119 LEU 119 119 119 LEU LEU C . n C 1 120 GLN 120 120 120 GLN GLN C . n C 1 121 LEU 121 121 121 LEU LEU C . n C 1 122 LEU 122 122 122 LEU LEU C . n C 1 123 GLN 123 123 123 GLN GLN C . n C 1 124 HIS 124 124 124 HIS HIS C . n C 1 125 ARG 125 125 125 ARG ARG C . n C 1 126 ASN 126 126 126 ASN ASN C . n C 1 127 GLN 127 127 127 GLN GLN C . n C 1 128 TRP 128 128 ? ? ? C . n C 1 129 SER 129 129 ? ? ? C . n C 1 130 HIS 130 130 ? ? ? C . n C 1 131 PRO 131 131 ? ? ? C . n C 1 132 GLN 132 132 ? ? ? C . n C 1 133 PHE 133 133 ? ? ? C . n C 1 134 GLU 134 134 ? ? ? C . n C 1 135 LYS 135 135 ? ? ? C . n D 1 1 SER 1 1 ? ? ? D . n D 1 2 ASN 2 2 ? ? ? D . n D 1 3 ALA 3 3 ? ? ? D . n D 1 4 MET 4 4 ? ? ? D . n D 1 5 ASN 5 5 ? ? ? D . n D 1 6 ASP 6 6 ? ? ? D . n D 1 7 TRP 7 7 ? ? ? D . n D 1 8 ALA 8 8 ? ? ? D . n D 1 9 SER 9 9 ? ? ? D . n D 1 10 LEU 10 10 ? ? ? D . n D 1 11 GLY 11 11 ? ? ? D . n D 1 12 ILE 12 12 ? ? ? D . n D 1 13 GLY 13 13 ? ? ? D . n D 1 14 SER 14 14 ? ? ? D . n D 1 15 ILE 15 15 ? ? ? D . n D 1 16 GLY 16 16 ? ? ? D . n D 1 17 GLU 17 17 17 GLU GLU D . n D 1 18 ALA 18 18 18 ALA ALA D . n D 1 19 VAL 19 19 19 VAL VAL D . n D 1 20 PHE 20 20 20 PHE PHE D . n D 1 21 SER 21 21 21 SER SER D . n D 1 22 LYS 22 22 22 LYS LYS D . n D 1 23 LEU 23 23 23 LEU LEU D . n D 1 24 LEU 24 24 24 LEU LEU D . n D 1 25 LYS 25 25 25 LYS LYS D . n D 1 26 VAL 26 26 26 VAL VAL D . n D 1 27 VAL 27 27 27 VAL VAL D . n D 1 28 ILE 28 28 28 ILE ILE D . n D 1 29 ASP 29 29 29 ASP ASP D . n D 1 30 GLU 30 30 30 GLU GLU D . n D 1 31 ALA 31 31 31 ALA ALA D . n D 1 32 LYS 32 32 32 LYS LYS D . n D 1 33 LYS 33 33 33 LYS LYS D . n D 1 34 PHE 34 34 34 PHE PHE D . n D 1 35 LYS 35 35 35 LYS LYS D . n D 1 36 ALA 36 36 36 ALA ALA D . n D 1 37 PHE 37 37 37 PHE PHE D . n D 1 38 LYS 38 38 38 LYS LYS D . n D 1 39 PRO 39 39 39 PRO PRO D . n D 1 40 LEU 40 40 40 LEU LEU D . n D 1 41 SER 41 41 41 SER SER D . n D 1 42 LYS 42 42 42 LYS LYS D . n D 1 43 ASP 43 43 43 ASP ASP D . n D 1 44 LEU 44 44 44 LEU LEU D . n D 1 45 VAL 45 45 45 VAL VAL D . n D 1 46 SER 46 46 46 SER SER D . n D 1 47 THR 47 47 47 THR THR D . n D 1 48 MET 48 48 48 MET MET D . n D 1 49 GLU 49 49 49 GLU GLU D . n D 1 50 ILE 50 50 50 ILE ILE D . n D 1 51 LEU 51 51 51 LEU LEU D . n D 1 52 PHE 52 52 52 PHE PHE D . n D 1 53 PRO 53 53 53 PRO PRO D . n D 1 54 LEU 54 54 54 LEU LEU D . n D 1 55 THR 55 55 55 THR THR D . n D 1 56 GLN 56 56 56 GLN GLN D . n D 1 57 LYS 57 57 57 LYS LYS D . n D 1 58 ILE 58 58 58 ILE ILE D . n D 1 59 ASP 59 59 59 ASP ASP D . n D 1 60 SER 60 60 60 SER SER D . n D 1 61 MET 61 61 61 MET MET D . n D 1 62 GLN 62 62 62 GLN GLN D . n D 1 63 LYS 63 63 63 LYS LYS D . n D 1 64 GLU 64 64 64 GLU GLU D . n D 1 65 LEU 65 65 ? ? ? D . n D 1 66 ASP 66 66 ? ? ? D . n D 1 67 PHE 67 67 ? ? ? D . n D 1 68 GLY 68 68 68 GLY GLY D . n D 1 69 VAL 69 69 69 VAL VAL D . n D 1 70 LYS 70 70 70 LYS LYS D . n D 1 71 GLU 71 71 71 GLU GLU D . n D 1 72 LEU 72 72 72 LEU LEU D . n D 1 73 LYS 73 73 73 LYS LYS D . n D 1 74 GLU 74 74 74 GLU GLU D . n D 1 75 LEU 75 75 75 LEU LEU D . n D 1 76 ARG 76 76 76 ARG ARG D . n D 1 77 ASP 77 77 77 ASP ASP D . n D 1 78 THR 78 78 78 THR THR D . n D 1 79 ILE 79 79 79 ILE ILE D . n D 1 80 GLU 80 80 80 GLU GLU D . n D 1 81 ARG 81 81 81 ARG ARG D . n D 1 82 ALA 82 82 82 ALA ALA D . n D 1 83 ASP 83 83 83 ASP ASP D . n D 1 84 VAL 84 84 84 VAL VAL D . n D 1 85 ALA 85 85 85 ALA ALA D . n D 1 86 VAL 86 86 86 VAL VAL D . n D 1 87 ARG 87 87 87 ARG ARG D . n D 1 88 LYS 88 88 88 LYS LYS D . n D 1 89 PHE 89 89 89 PHE PHE D . n D 1 90 PRO 90 90 90 PRO PRO D . n D 1 91 ARG 91 91 91 ARG ARG D . n D 1 92 VAL 92 92 92 VAL VAL D . n D 1 93 LYS 93 93 93 LYS LYS D . n D 1 94 TRP 94 94 94 TRP TRP D . n D 1 95 TYR 95 95 95 TYR TYR D . n D 1 96 GLU 96 96 96 GLU GLU D . n D 1 97 GLU 97 97 97 GLU GLU D . n D 1 98 SER 98 98 98 SER SER D . n D 1 99 GLU 99 99 99 GLU GLU D . n D 1 100 TYR 100 100 100 TYR TYR D . n D 1 101 THR 101 101 101 THR THR D . n D 1 102 GLU 102 102 102 GLU GLU D . n D 1 103 GLU 103 103 103 GLU GLU D . n D 1 104 ILE 104 104 104 ILE ILE D . n D 1 105 GLU 105 105 105 GLU GLU D . n D 1 106 GLU 106 106 106 GLU GLU D . n D 1 107 ILE 107 107 107 ILE ILE D . n D 1 108 ASN 108 108 108 ASN ASN D . n D 1 109 GLU 109 109 109 GLU GLU D . n D 1 110 ASP 110 110 110 ASP ASP D . n D 1 111 MET 111 111 111 MET MET D . n D 1 112 LEU 112 112 112 LEU LEU D . n D 1 113 GLU 113 113 113 GLU GLU D . n D 1 114 PHE 114 114 114 PHE PHE D . n D 1 115 CYS 115 115 115 CYS CYS D . n D 1 116 GLN 116 116 116 GLN GLN D . n D 1 117 ILE 117 117 117 ILE ILE D . n D 1 118 ASP 118 118 118 ASP ASP D . n D 1 119 LEU 119 119 119 LEU LEU D . n D 1 120 GLN 120 120 120 GLN GLN D . n D 1 121 LEU 121 121 121 LEU LEU D . n D 1 122 LEU 122 122 ? ? ? D . n D 1 123 GLN 123 123 ? ? ? D . n D 1 124 HIS 124 124 ? ? ? D . n D 1 125 ARG 125 125 ? ? ? D . n D 1 126 ASN 126 126 ? ? ? D . n D 1 127 GLN 127 127 ? ? ? D . n D 1 128 TRP 128 128 ? ? ? D . n D 1 129 SER 129 129 ? ? ? D . n D 1 130 HIS 130 130 ? ? ? D . n D 1 131 PRO 131 131 ? ? ? D . n D 1 132 GLN 132 132 ? ? ? D . n D 1 133 PHE 133 133 ? ? ? D . n D 1 134 GLU 134 134 ? ? ? D . n D 1 135 LYS 135 135 ? ? ? D . n E 1 1 SER 1 1 ? ? ? E . n E 1 2 ASN 2 2 ? ? ? E . n E 1 3 ALA 3 3 ? ? ? E . n E 1 4 MET 4 4 ? ? ? E . n E 1 5 ASN 5 5 ? ? ? E . n E 1 6 ASP 6 6 ? ? ? E . n E 1 7 TRP 7 7 ? ? ? E . n E 1 8 ALA 8 8 ? ? ? E . n E 1 9 SER 9 9 ? ? ? E . n E 1 10 LEU 10 10 ? ? ? E . n E 1 11 GLY 11 11 ? ? ? E . n E 1 12 ILE 12 12 ? ? ? E . n E 1 13 GLY 13 13 ? ? ? E . n E 1 14 SER 14 14 ? ? ? E . n E 1 15 ILE 15 15 ? ? ? E . n E 1 16 GLY 16 16 ? ? ? E . n E 1 17 GLU 17 17 ? ? ? E . n E 1 18 ALA 18 18 ? ? ? E . n E 1 19 VAL 19 19 19 VAL VAL E . n E 1 20 PHE 20 20 20 PHE PHE E . n E 1 21 SER 21 21 21 SER SER E . n E 1 22 LYS 22 22 22 LYS LYS E . n E 1 23 LEU 23 23 23 LEU LEU E . n E 1 24 LEU 24 24 24 LEU LEU E . n E 1 25 LYS 25 25 25 LYS LYS E . n E 1 26 VAL 26 26 26 VAL VAL E . n E 1 27 VAL 27 27 27 VAL VAL E . n E 1 28 ILE 28 28 28 ILE ILE E . n E 1 29 ASP 29 29 29 ASP ASP E . n E 1 30 GLU 30 30 30 GLU GLU E . n E 1 31 ALA 31 31 31 ALA ALA E . n E 1 32 LYS 32 32 32 LYS LYS E . n E 1 33 LYS 33 33 33 LYS LYS E . n E 1 34 PHE 34 34 34 PHE PHE E . n E 1 35 LYS 35 35 35 LYS LYS E . n E 1 36 ALA 36 36 36 ALA ALA E . n E 1 37 PHE 37 37 37 PHE PHE E . n E 1 38 LYS 38 38 38 LYS LYS E . n E 1 39 PRO 39 39 39 PRO PRO E . n E 1 40 LEU 40 40 40 LEU LEU E . n E 1 41 SER 41 41 41 SER SER E . n E 1 42 LYS 42 42 42 LYS LYS E . n E 1 43 ASP 43 43 43 ASP ASP E . n E 1 44 LEU 44 44 44 LEU LEU E . n E 1 45 VAL 45 45 45 VAL VAL E . n E 1 46 SER 46 46 46 SER SER E . n E 1 47 THR 47 47 47 THR THR E . n E 1 48 MET 48 48 48 MET MET E . n E 1 49 GLU 49 49 49 GLU GLU E . n E 1 50 ILE 50 50 50 ILE ILE E . n E 1 51 LEU 51 51 51 LEU LEU E . n E 1 52 PHE 52 52 52 PHE PHE E . n E 1 53 PRO 53 53 53 PRO PRO E . n E 1 54 LEU 54 54 54 LEU LEU E . n E 1 55 THR 55 55 55 THR THR E . n E 1 56 GLN 56 56 56 GLN GLN E . n E 1 57 LYS 57 57 57 LYS LYS E . n E 1 58 ILE 58 58 58 ILE ILE E . n E 1 59 ASP 59 59 59 ASP ASP E . n E 1 60 SER 60 60 60 SER SER E . n E 1 61 MET 61 61 61 MET MET E . n E 1 62 GLN 62 62 62 GLN GLN E . n E 1 63 LYS 63 63 63 LYS LYS E . n E 1 64 GLU 64 64 64 GLU GLU E . n E 1 65 LEU 65 65 65 LEU LEU E . n E 1 66 ASP 66 66 66 ASP ASP E . n E 1 67 PHE 67 67 67 PHE PHE E . n E 1 68 GLY 68 68 68 GLY GLY E . n E 1 69 VAL 69 69 69 VAL VAL E . n E 1 70 LYS 70 70 70 LYS LYS E . n E 1 71 GLU 71 71 71 GLU GLU E . n E 1 72 LEU 72 72 72 LEU LEU E . n E 1 73 LYS 73 73 73 LYS LYS E . n E 1 74 GLU 74 74 74 GLU GLU E . n E 1 75 LEU 75 75 75 LEU LEU E . n E 1 76 ARG 76 76 76 ARG ARG E . n E 1 77 ASP 77 77 77 ASP ASP E . n E 1 78 THR 78 78 78 THR THR E . n E 1 79 ILE 79 79 79 ILE ILE E . n E 1 80 GLU 80 80 80 GLU GLU E . n E 1 81 ARG 81 81 81 ARG ARG E . n E 1 82 ALA 82 82 82 ALA ALA E . n E 1 83 ASP 83 83 83 ASP ASP E . n E 1 84 VAL 84 84 84 VAL VAL E . n E 1 85 ALA 85 85 85 ALA ALA E . n E 1 86 VAL 86 86 86 VAL VAL E . n E 1 87 ARG 87 87 87 ARG ARG E . n E 1 88 LYS 88 88 88 LYS LYS E . n E 1 89 PHE 89 89 89 PHE PHE E . n E 1 90 PRO 90 90 90 PRO PRO E . n E 1 91 ARG 91 91 91 ARG ARG E . n E 1 92 VAL 92 92 92 VAL VAL E . n E 1 93 LYS 93 93 93 LYS LYS E . n E 1 94 TRP 94 94 94 TRP TRP E . n E 1 95 TYR 95 95 95 TYR TYR E . n E 1 96 GLU 96 96 96 GLU GLU E . n E 1 97 GLU 97 97 97 GLU GLU E . n E 1 98 SER 98 98 98 SER SER E . n E 1 99 GLU 99 99 99 GLU GLU E . n E 1 100 TYR 100 100 100 TYR TYR E . n E 1 101 THR 101 101 101 THR THR E . n E 1 102 GLU 102 102 102 GLU GLU E . n E 1 103 GLU 103 103 103 GLU GLU E . n E 1 104 ILE 104 104 104 ILE ILE E . n E 1 105 GLU 105 105 105 GLU GLU E . n E 1 106 GLU 106 106 106 GLU GLU E . n E 1 107 ILE 107 107 107 ILE ILE E . n E 1 108 ASN 108 108 108 ASN ASN E . n E 1 109 GLU 109 109 109 GLU GLU E . n E 1 110 ASP 110 110 110 ASP ASP E . n E 1 111 MET 111 111 111 MET MET E . n E 1 112 LEU 112 112 112 LEU LEU E . n E 1 113 GLU 113 113 113 GLU GLU E . n E 1 114 PHE 114 114 114 PHE PHE E . n E 1 115 CYS 115 115 115 CYS CYS E . n E 1 116 GLN 116 116 116 GLN GLN E . n E 1 117 ILE 117 117 117 ILE ILE E . n E 1 118 ASP 118 118 118 ASP ASP E . n E 1 119 LEU 119 119 119 LEU LEU E . n E 1 120 GLN 120 120 120 GLN GLN E . n E 1 121 LEU 121 121 121 LEU LEU E . n E 1 122 LEU 122 122 122 LEU LEU E . n E 1 123 GLN 123 123 123 GLN GLN E . n E 1 124 HIS 124 124 124 HIS HIS E . n E 1 125 ARG 125 125 125 ARG ARG E . n E 1 126 ASN 126 126 126 ASN ASN E . n E 1 127 GLN 127 127 ? ? ? E . n E 1 128 TRP 128 128 ? ? ? E . n E 1 129 SER 129 129 ? ? ? E . n E 1 130 HIS 130 130 ? ? ? E . n E 1 131 PRO 131 131 ? ? ? E . n E 1 132 GLN 132 132 ? ? ? E . n E 1 133 PHE 133 133 ? ? ? E . n E 1 134 GLU 134 134 ? ? ? E . n E 1 135 LYS 135 135 ? ? ? E . n F 1 1 SER 1 1 ? ? ? F . n F 1 2 ASN 2 2 2 ASN ASN F . n F 1 3 ALA 3 3 3 ALA ALA F . n F 1 4 MET 4 4 4 MET MET F . n F 1 5 ASN 5 5 5 ASN ASN F . n F 1 6 ASP 6 6 6 ASP ASP F . n F 1 7 TRP 7 7 7 TRP TRP F . n F 1 8 ALA 8 8 8 ALA ALA F . n F 1 9 SER 9 9 9 SER SER F . n F 1 10 LEU 10 10 10 LEU LEU F . n F 1 11 GLY 11 11 11 GLY GLY F . n F 1 12 ILE 12 12 12 ILE ILE F . n F 1 13 GLY 13 13 13 GLY GLY F . n F 1 14 SER 14 14 14 SER SER F . n F 1 15 ILE 15 15 15 ILE ILE F . n F 1 16 GLY 16 16 16 GLY GLY F . n F 1 17 GLU 17 17 17 GLU GLU F . n F 1 18 ALA 18 18 18 ALA ALA F . n F 1 19 VAL 19 19 19 VAL VAL F . n F 1 20 PHE 20 20 20 PHE PHE F . n F 1 21 SER 21 21 21 SER SER F . n F 1 22 LYS 22 22 22 LYS LYS F . n F 1 23 LEU 23 23 23 LEU LEU F . n F 1 24 LEU 24 24 24 LEU LEU F . n F 1 25 LYS 25 25 25 LYS LYS F . n F 1 26 VAL 26 26 26 VAL VAL F . n F 1 27 VAL 27 27 27 VAL VAL F . n F 1 28 ILE 28 28 28 ILE ILE F . n F 1 29 ASP 29 29 29 ASP ASP F . n F 1 30 GLU 30 30 30 GLU GLU F . n F 1 31 ALA 31 31 31 ALA ALA F . n F 1 32 LYS 32 32 32 LYS LYS F . n F 1 33 LYS 33 33 33 LYS LYS F . n F 1 34 PHE 34 34 34 PHE PHE F . n F 1 35 LYS 35 35 35 LYS LYS F . n F 1 36 ALA 36 36 36 ALA ALA F . n F 1 37 PHE 37 37 37 PHE PHE F . n F 1 38 LYS 38 38 38 LYS LYS F . n F 1 39 PRO 39 39 39 PRO PRO F . n F 1 40 LEU 40 40 40 LEU LEU F . n F 1 41 SER 41 41 41 SER SER F . n F 1 42 LYS 42 42 42 LYS LYS F . n F 1 43 ASP 43 43 43 ASP ASP F . n F 1 44 LEU 44 44 44 LEU LEU F . n F 1 45 VAL 45 45 45 VAL VAL F . n F 1 46 SER 46 46 46 SER SER F . n F 1 47 THR 47 47 47 THR THR F . n F 1 48 MET 48 48 48 MET MET F . n F 1 49 GLU 49 49 49 GLU GLU F . n F 1 50 ILE 50 50 50 ILE ILE F . n F 1 51 LEU 51 51 51 LEU LEU F . n F 1 52 PHE 52 52 52 PHE PHE F . n F 1 53 PRO 53 53 53 PRO PRO F . n F 1 54 LEU 54 54 54 LEU LEU F . n F 1 55 THR 55 55 55 THR THR F . n F 1 56 GLN 56 56 56 GLN GLN F . n F 1 57 LYS 57 57 57 LYS LYS F . n F 1 58 ILE 58 58 58 ILE ILE F . n F 1 59 ASP 59 59 59 ASP ASP F . n F 1 60 SER 60 60 60 SER SER F . n F 1 61 MET 61 61 61 MET MET F . n F 1 62 GLN 62 62 62 GLN GLN F . n F 1 63 LYS 63 63 63 LYS LYS F . n F 1 64 GLU 64 64 64 GLU GLU F . n F 1 65 LEU 65 65 65 LEU LEU F . n F 1 66 ASP 66 66 66 ASP ASP F . n F 1 67 PHE 67 67 67 PHE PHE F . n F 1 68 GLY 68 68 68 GLY GLY F . n F 1 69 VAL 69 69 69 VAL VAL F . n F 1 70 LYS 70 70 70 LYS LYS F . n F 1 71 GLU 71 71 71 GLU GLU F . n F 1 72 LEU 72 72 72 LEU LEU F . n F 1 73 LYS 73 73 73 LYS LYS F . n F 1 74 GLU 74 74 74 GLU GLU F . n F 1 75 LEU 75 75 75 LEU LEU F . n F 1 76 ARG 76 76 76 ARG ARG F . n F 1 77 ASP 77 77 77 ASP ASP F . n F 1 78 THR 78 78 78 THR THR F . n F 1 79 ILE 79 79 79 ILE ILE F . n F 1 80 GLU 80 80 80 GLU GLU F . n F 1 81 ARG 81 81 81 ARG ARG F . n F 1 82 ALA 82 82 82 ALA ALA F . n F 1 83 ASP 83 83 83 ASP ASP F . n F 1 84 VAL 84 84 84 VAL VAL F . n F 1 85 ALA 85 85 85 ALA ALA F . n F 1 86 VAL 86 86 86 VAL VAL F . n F 1 87 ARG 87 87 87 ARG ARG F . n F 1 88 LYS 88 88 88 LYS LYS F . n F 1 89 PHE 89 89 89 PHE PHE F . n F 1 90 PRO 90 90 90 PRO PRO F . n F 1 91 ARG 91 91 91 ARG ARG F . n F 1 92 VAL 92 92 92 VAL VAL F . n F 1 93 LYS 93 93 93 LYS LYS F . n F 1 94 TRP 94 94 94 TRP TRP F . n F 1 95 TYR 95 95 95 TYR TYR F . n F 1 96 GLU 96 96 96 GLU GLU F . n F 1 97 GLU 97 97 97 GLU GLU F . n F 1 98 SER 98 98 98 SER SER F . n F 1 99 GLU 99 99 99 GLU GLU F . n F 1 100 TYR 100 100 100 TYR TYR F . n F 1 101 THR 101 101 101 THR THR F . n F 1 102 GLU 102 102 102 GLU GLU F . n F 1 103 GLU 103 103 103 GLU GLU F . n F 1 104 ILE 104 104 104 ILE ILE F . n F 1 105 GLU 105 105 105 GLU GLU F . n F 1 106 GLU 106 106 106 GLU GLU F . n F 1 107 ILE 107 107 107 ILE ILE F . n F 1 108 ASN 108 108 108 ASN ASN F . n F 1 109 GLU 109 109 109 GLU GLU F . n F 1 110 ASP 110 110 110 ASP ASP F . n F 1 111 MET 111 111 111 MET MET F . n F 1 112 LEU 112 112 112 LEU LEU F . n F 1 113 GLU 113 113 113 GLU GLU F . n F 1 114 PHE 114 114 114 PHE PHE F . n F 1 115 CYS 115 115 115 CYS CYS F . n F 1 116 GLN 116 116 116 GLN GLN F . n F 1 117 ILE 117 117 117 ILE ILE F . n F 1 118 ASP 118 118 ? ? ? F . n F 1 119 LEU 119 119 ? ? ? F . n F 1 120 GLN 120 120 ? ? ? F . n F 1 121 LEU 121 121 ? ? ? F . n F 1 122 LEU 122 122 ? ? ? F . n F 1 123 GLN 123 123 ? ? ? F . n F 1 124 HIS 124 124 ? ? ? F . n F 1 125 ARG 125 125 ? ? ? F . n F 1 126 ASN 126 126 ? ? ? F . n F 1 127 GLN 127 127 ? ? ? F . n F 1 128 TRP 128 128 ? ? ? F . n F 1 129 SER 129 129 ? ? ? F . n F 1 130 HIS 130 130 ? ? ? F . n F 1 131 PRO 131 131 ? ? ? F . n F 1 132 GLN 132 132 ? ? ? F . n F 1 133 PHE 133 133 ? ? ? F . n F 1 134 GLU 134 134 ? ? ? F . n F 1 135 LYS 135 135 ? ? ? F . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? trimeric 3 2 author_defined_assembly ? trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E,F 2 1 B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-16 2 'Structure model' 1 1 2021-07-14 3 'Structure model' 1 2 2021-07-28 4 'Structure model' 1 3 2021-09-01 5 'Structure model' 1 4 2021-09-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation_author 4 4 'Structure model' database_2 5 5 'Structure model' citation 6 5 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_citation_author.identifier_ORCID' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 5 'Structure model' '_citation.journal_volume' 8 5 'Structure model' '_citation.page_first' 9 5 'Structure model' '_citation.page_last' 10 5 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y,-z+1/2 3 -x,y,-z 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 17.4044 -27.8633 -11.8637 0.0578 ? -0.0247 ? 0.0365 ? 0.1752 ? -0.0155 ? 0.1209 ? 6.4390 ? -2.4896 ? 3.0672 ? 3.6111 ? -1.0600 ? 6.1138 ? 0.2307 ? -0.1071 ? -0.2413 ? 0.0005 ? -0.1441 ? -0.1586 ? 0.3536 ? 0.4719 ? -0.0866 ? 2 'X-RAY DIFFRACTION' ? refined 27.2054 -32.0908 -38.0538 0.2301 ? 0.0144 ? 0.0423 ? 0.2605 ? 0.0487 ? 0.1219 ? 4.6924 ? 1.6615 ? 2.8756 ? 6.0015 ? 3.7224 ? 5.4587 ? -0.1021 ? 0.4708 ? -0.1694 ? -0.7358 ? 0.0135 ? 0.0555 ? 0.0407 ? -0.1083 ? 0.0886 ? 3 'X-RAY DIFFRACTION' ? refined 33.6441 5.8475 -14.4545 1.0187 ? 0.1850 ? 0.0254 ? 0.4753 ? 0.0173 ? 0.4315 ? 1.2348 ? -3.1195 ? -0.3196 ? 13.8374 ? 2.2451 ? 0.6213 ? -0.2458 ? -0.1351 ? 0.2956 ? 0.3944 ? 0.0647 ? 0.6354 ? -0.4013 ? -0.1792 ? 0.1811 ? 4 'X-RAY DIFFRACTION' ? refined 61.8281 -27.8257 -13.9145 0.0661 ? -0.0465 ? 0.0411 ? 0.2593 ? -0.0968 ? 0.1033 ? 9.8776 ? -2.9996 ? 3.2724 ? 3.1294 ? -1.2233 ? 3.7648 ? 0.0883 ? -0.0402 ? -0.1845 ? -0.0344 ? 0.0039 ? -0.2744 ? 0.0496 ? 0.4498 ? -0.0922 ? 5 'X-RAY DIFFRACTION' ? refined -11.9443 5.4023 -17.8162 0.7951 ? 0.1622 ? 0.0163 ? 0.4078 ? 0.0339 ? 0.3151 ? 2.9743 ? -3.7161 ? -0.0024 ? 14.0226 ? 1.9895 ? 0.5881 ? -0.2598 ? -0.1765 ? 0.6266 ? 0.3512 ? 0.0473 ? 0.4389 ? -0.3347 ? -0.1820 ? 0.2124 ? 6 'X-RAY DIFFRACTION' ? refined -14.4337 -32.3260 -40.0175 0.9427 ? -0.2634 ? 0.0239 ? 0.4517 ? 0.0209 ? 0.1432 ? 4.4911 ? 1.8691 ? 2.8077 ? 7.8552 ? 2.1813 ? 4.6613 ? -0.4974 ? 0.5756 ? -0.2966 ? -1.8076 ? 0.3799 ? 0.4619 ? 0.6143 ? -0.2496 ? 0.1175 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 2 ? ? ? A 122 ? ? ? 2 'X-RAY DIFFRACTION' 2 ? ? B 18 ? ? ? B 126 ? ? ? 3 'X-RAY DIFFRACTION' 3 ? ? C 19 ? ? ? C 127 ? ? ? 4 'X-RAY DIFFRACTION' 4 ? ? D 17 ? ? ? D 121 ? ? ? 5 'X-RAY DIFFRACTION' 5 ? ? E 19 ? ? ? E 126 ? ? ? 6 'X-RAY DIFFRACTION' 6 ? ? F 2 ? ? ? F 117 ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 D _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 81 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 D _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 106 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.87 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OD2 D ASP 110 ? ? 1_555 NH1 E ARG 91 ? ? 1_655 1.83 2 1 O A ILE 15 ? ? 1_555 OE2 D GLU 80 ? ? 2_655 1.96 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 105 ? ? OE1 A GLU 105 ? ? 1.326 1.252 0.074 0.011 N 2 1 CD D GLU 113 ? ? OE1 D GLU 113 ? ? 1.324 1.252 0.072 0.011 N 3 1 CD F GLU 103 ? ? OE1 F GLU 103 ? ? 1.320 1.252 0.068 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE B ARG 91 ? ? CZ B ARG 91 ? ? NH2 B ARG 91 ? ? 117.24 120.30 -3.06 0.50 N 2 1 NE E ARG 91 ? ? CZ E ARG 91 ? ? NH1 E ARG 91 ? ? 116.46 120.30 -3.84 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 15 ? ? -102.05 -107.67 2 1 LYS A 42 ? ? -110.17 -75.87 3 1 PHE B 34 ? ? -109.40 56.99 4 1 LYS B 42 ? ? -97.95 -69.16 5 1 LEU B 119 ? ? 89.86 -6.97 6 1 GLU C 64 ? ? -97.90 43.60 7 1 LEU C 65 ? ? -176.11 139.62 8 1 PHE C 67 ? ? -58.53 -8.95 9 1 PRO C 90 ? ? -48.29 -19.08 10 1 VAL D 19 ? ? -130.99 -70.56 11 1 PHE D 34 ? ? -118.69 58.00 12 1 LYS D 42 ? ? -108.71 -60.07 13 1 PRO D 90 ? ? -53.29 -8.75 14 1 PHE E 20 ? ? -150.45 4.94 15 1 PRO E 90 ? ? -48.06 -16.68 16 1 GLN E 116 ? ? -112.64 64.30 17 1 LEU F 40 ? ? -93.70 -77.16 18 1 LYS F 42 ? ? -107.88 -77.49 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 5 ? CG ? A ASN 5 CG 2 1 Y 1 A ASN 5 ? OD1 ? A ASN 5 OD1 3 1 Y 1 A ASN 5 ? ND2 ? A ASN 5 ND2 4 1 Y 1 A LYS 22 ? CD ? A LYS 22 CD 5 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 6 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 7 1 Y 1 A LYS 33 ? CE ? A LYS 33 CE 8 1 Y 1 A LYS 33 ? NZ ? A LYS 33 NZ 9 1 Y 1 A LYS 35 ? CD ? A LYS 35 CD 10 1 Y 1 A LYS 35 ? CE ? A LYS 35 CE 11 1 Y 1 A LYS 35 ? NZ ? A LYS 35 NZ 12 1 Y 1 A LYS 57 ? CG ? A LYS 57 CG 13 1 Y 1 A LYS 57 ? CD ? A LYS 57 CD 14 1 Y 1 A LYS 57 ? CE ? A LYS 57 CE 15 1 Y 1 A LYS 57 ? NZ ? A LYS 57 NZ 16 1 Y 1 A LYS 63 ? CG ? A LYS 63 CG 17 1 Y 1 A LYS 63 ? CD ? A LYS 63 CD 18 1 Y 1 A LYS 63 ? CE ? A LYS 63 CE 19 1 Y 1 A LYS 63 ? NZ ? A LYS 63 NZ 20 1 Y 1 A LYS 70 ? CG ? A LYS 70 CG 21 1 Y 1 A LYS 70 ? CD ? A LYS 70 CD 22 1 Y 1 A LYS 70 ? CE ? A LYS 70 CE 23 1 Y 1 A LYS 70 ? NZ ? A LYS 70 NZ 24 1 Y 1 A LYS 73 ? CE ? A LYS 73 CE 25 1 Y 1 A LYS 73 ? NZ ? A LYS 73 NZ 26 1 Y 1 A ARG 91 ? CG ? A ARG 91 CG 27 1 Y 1 A ARG 91 ? CD ? A ARG 91 CD 28 1 Y 1 A ARG 91 ? NE ? A ARG 91 NE 29 1 Y 1 A ARG 91 ? CZ ? A ARG 91 CZ 30 1 Y 1 A ARG 91 ? NH1 ? A ARG 91 NH1 31 1 Y 1 A ARG 91 ? NH2 ? A ARG 91 NH2 32 1 Y 1 A LEU 119 ? CG ? A LEU 119 CG 33 1 Y 1 A LEU 119 ? CD1 ? A LEU 119 CD1 34 1 Y 1 A LEU 119 ? CD2 ? A LEU 119 CD2 35 1 Y 1 A GLN 120 ? CG ? A GLN 120 CG 36 1 Y 1 A GLN 120 ? CD ? A GLN 120 CD 37 1 Y 1 A GLN 120 ? OE1 ? A GLN 120 OE1 38 1 Y 1 A GLN 120 ? NE2 ? A GLN 120 NE2 39 1 Y 1 B LYS 22 ? CG ? B LYS 22 CG 40 1 Y 1 B LYS 22 ? CD ? B LYS 22 CD 41 1 Y 1 B LYS 22 ? CE ? B LYS 22 CE 42 1 Y 1 B LYS 22 ? NZ ? B LYS 22 NZ 43 1 Y 1 B LYS 25 ? CG ? B LYS 25 CG 44 1 Y 1 B LYS 25 ? CD ? B LYS 25 CD 45 1 Y 1 B LYS 25 ? CE ? B LYS 25 CE 46 1 Y 1 B LYS 25 ? NZ ? B LYS 25 NZ 47 1 Y 1 B LYS 35 ? CE ? B LYS 35 CE 48 1 Y 1 B LYS 35 ? NZ ? B LYS 35 NZ 49 1 Y 1 B LYS 38 ? CE ? B LYS 38 CE 50 1 Y 1 B LYS 38 ? NZ ? B LYS 38 NZ 51 1 Y 1 B LYS 42 ? CG ? B LYS 42 CG 52 1 Y 1 B LYS 42 ? CD ? B LYS 42 CD 53 1 Y 1 B LYS 42 ? CE ? B LYS 42 CE 54 1 Y 1 B LYS 42 ? NZ ? B LYS 42 NZ 55 1 Y 1 B LYS 57 ? CG ? B LYS 57 CG 56 1 Y 1 B LYS 57 ? CD ? B LYS 57 CD 57 1 Y 1 B LYS 57 ? CE ? B LYS 57 CE 58 1 Y 1 B LYS 57 ? NZ ? B LYS 57 NZ 59 1 Y 1 B LYS 63 ? CG ? B LYS 63 CG 60 1 Y 1 B LYS 63 ? CD ? B LYS 63 CD 61 1 Y 1 B LYS 63 ? CE ? B LYS 63 CE 62 1 Y 1 B LYS 63 ? NZ ? B LYS 63 NZ 63 1 Y 1 B GLU 64 ? CG ? B GLU 64 CG 64 1 Y 1 B GLU 64 ? CD ? B GLU 64 CD 65 1 Y 1 B GLU 64 ? OE1 ? B GLU 64 OE1 66 1 Y 1 B GLU 64 ? OE2 ? B GLU 64 OE2 67 1 Y 1 B GLN 120 ? CG ? B GLN 120 CG 68 1 Y 1 B GLN 120 ? CD ? B GLN 120 CD 69 1 Y 1 B GLN 120 ? OE1 ? B GLN 120 OE1 70 1 Y 1 B GLN 120 ? NE2 ? B GLN 120 NE2 71 1 Y 1 B LEU 121 ? CG ? B LEU 121 CG 72 1 Y 1 B LEU 121 ? CD1 ? B LEU 121 CD1 73 1 Y 1 B LEU 121 ? CD2 ? B LEU 121 CD2 74 1 Y 1 B GLN 123 ? CG ? B GLN 123 CG 75 1 Y 1 B GLN 123 ? CD ? B GLN 123 CD 76 1 Y 1 B GLN 123 ? OE1 ? B GLN 123 OE1 77 1 Y 1 B GLN 123 ? NE2 ? B GLN 123 NE2 78 1 Y 1 B HIS 124 ? CG ? B HIS 124 CG 79 1 Y 1 B HIS 124 ? ND1 ? B HIS 124 ND1 80 1 Y 1 B HIS 124 ? CD2 ? B HIS 124 CD2 81 1 Y 1 B HIS 124 ? CE1 ? B HIS 124 CE1 82 1 Y 1 B HIS 124 ? NE2 ? B HIS 124 NE2 83 1 Y 1 C LYS 22 ? CE ? C LYS 22 CE 84 1 Y 1 C LYS 22 ? NZ ? C LYS 22 NZ 85 1 Y 1 C LYS 25 ? CE ? C LYS 25 CE 86 1 Y 1 C LYS 25 ? NZ ? C LYS 25 NZ 87 1 Y 1 C GLU 30 ? CG ? C GLU 30 CG 88 1 Y 1 C GLU 30 ? CD ? C GLU 30 CD 89 1 Y 1 C GLU 30 ? OE1 ? C GLU 30 OE1 90 1 Y 1 C GLU 30 ? OE2 ? C GLU 30 OE2 91 1 Y 1 C LYS 32 ? CE ? C LYS 32 CE 92 1 Y 1 C LYS 32 ? NZ ? C LYS 32 NZ 93 1 Y 1 C LYS 33 ? CE ? C LYS 33 CE 94 1 Y 1 C LYS 33 ? NZ ? C LYS 33 NZ 95 1 Y 1 C LYS 35 ? CE ? C LYS 35 CE 96 1 Y 1 C LYS 35 ? NZ ? C LYS 35 NZ 97 1 Y 1 C LYS 38 ? CE ? C LYS 38 CE 98 1 Y 1 C LYS 38 ? NZ ? C LYS 38 NZ 99 1 Y 1 C LYS 42 ? CG ? C LYS 42 CG 100 1 Y 1 C LYS 42 ? CD ? C LYS 42 CD 101 1 Y 1 C LYS 42 ? CE ? C LYS 42 CE 102 1 Y 1 C LYS 42 ? NZ ? C LYS 42 NZ 103 1 Y 1 C LYS 57 ? CG ? C LYS 57 CG 104 1 Y 1 C LYS 57 ? CD ? C LYS 57 CD 105 1 Y 1 C LYS 57 ? CE ? C LYS 57 CE 106 1 Y 1 C LYS 57 ? NZ ? C LYS 57 NZ 107 1 Y 1 C LYS 63 ? CG ? C LYS 63 CG 108 1 Y 1 C LYS 63 ? CD ? C LYS 63 CD 109 1 Y 1 C LYS 63 ? CE ? C LYS 63 CE 110 1 Y 1 C LYS 63 ? NZ ? C LYS 63 NZ 111 1 Y 1 C LYS 70 ? CG ? C LYS 70 CG 112 1 Y 1 C LYS 70 ? CD ? C LYS 70 CD 113 1 Y 1 C LYS 70 ? CE ? C LYS 70 CE 114 1 Y 1 C LYS 70 ? NZ ? C LYS 70 NZ 115 1 Y 1 C LYS 73 ? CG ? C LYS 73 CG 116 1 Y 1 C LYS 73 ? CD ? C LYS 73 CD 117 1 Y 1 C LYS 73 ? CE ? C LYS 73 CE 118 1 Y 1 C LYS 73 ? NZ ? C LYS 73 NZ 119 1 Y 1 C GLU 74 ? CG ? C GLU 74 CG 120 1 Y 1 C GLU 74 ? CD ? C GLU 74 CD 121 1 Y 1 C GLU 74 ? OE1 ? C GLU 74 OE1 122 1 Y 1 C GLU 74 ? OE2 ? C GLU 74 OE2 123 1 Y 1 C ARG 76 ? NE ? C ARG 76 NE 124 1 Y 1 C ARG 76 ? CZ ? C ARG 76 CZ 125 1 Y 1 C ARG 76 ? NH1 ? C ARG 76 NH1 126 1 Y 1 C ARG 76 ? NH2 ? C ARG 76 NH2 127 1 Y 1 C GLU 80 ? CG ? C GLU 80 CG 128 1 Y 1 C GLU 80 ? CD ? C GLU 80 CD 129 1 Y 1 C GLU 80 ? OE1 ? C GLU 80 OE1 130 1 Y 1 C GLU 80 ? OE2 ? C GLU 80 OE2 131 1 Y 1 C LEU 121 ? CG ? C LEU 121 CG 132 1 Y 1 C LEU 121 ? CD1 ? C LEU 121 CD1 133 1 Y 1 C LEU 121 ? CD2 ? C LEU 121 CD2 134 1 Y 1 C ASN 126 ? CG ? C ASN 126 CG 135 1 Y 1 C ASN 126 ? OD1 ? C ASN 126 OD1 136 1 Y 1 C ASN 126 ? ND2 ? C ASN 126 ND2 137 1 Y 1 D GLU 17 ? CG ? D GLU 17 CG 138 1 Y 1 D GLU 17 ? CD ? D GLU 17 CD 139 1 Y 1 D GLU 17 ? OE1 ? D GLU 17 OE1 140 1 Y 1 D GLU 17 ? OE2 ? D GLU 17 OE2 141 1 Y 1 D LYS 25 ? CE ? D LYS 25 CE 142 1 Y 1 D LYS 25 ? NZ ? D LYS 25 NZ 143 1 Y 1 D LYS 35 ? CD ? D LYS 35 CD 144 1 Y 1 D LYS 35 ? CE ? D LYS 35 CE 145 1 Y 1 D LYS 35 ? NZ ? D LYS 35 NZ 146 1 Y 1 D LYS 42 ? CG ? D LYS 42 CG 147 1 Y 1 D LYS 42 ? CD ? D LYS 42 CD 148 1 Y 1 D LYS 42 ? CE ? D LYS 42 CE 149 1 Y 1 D LYS 42 ? NZ ? D LYS 42 NZ 150 1 Y 1 D LYS 57 ? CD ? D LYS 57 CD 151 1 Y 1 D LYS 57 ? CE ? D LYS 57 CE 152 1 Y 1 D LYS 57 ? NZ ? D LYS 57 NZ 153 1 Y 1 D LYS 63 ? CG ? D LYS 63 CG 154 1 Y 1 D LYS 63 ? CD ? D LYS 63 CD 155 1 Y 1 D LYS 63 ? CE ? D LYS 63 CE 156 1 Y 1 D LYS 63 ? NZ ? D LYS 63 NZ 157 1 Y 1 D LYS 70 ? CE ? D LYS 70 CE 158 1 Y 1 D LYS 70 ? NZ ? D LYS 70 NZ 159 1 Y 1 E LYS 22 ? CG ? E LYS 22 CG 160 1 Y 1 E LYS 22 ? CD ? E LYS 22 CD 161 1 Y 1 E LYS 22 ? CE ? E LYS 22 CE 162 1 Y 1 E LYS 22 ? NZ ? E LYS 22 NZ 163 1 Y 1 E LYS 32 ? CG ? E LYS 32 CG 164 1 Y 1 E LYS 32 ? CD ? E LYS 32 CD 165 1 Y 1 E LYS 32 ? CE ? E LYS 32 CE 166 1 Y 1 E LYS 32 ? NZ ? E LYS 32 NZ 167 1 Y 1 E LYS 33 ? CE ? E LYS 33 CE 168 1 Y 1 E LYS 33 ? NZ ? E LYS 33 NZ 169 1 Y 1 E LYS 35 ? CG ? E LYS 35 CG 170 1 Y 1 E LYS 35 ? CD ? E LYS 35 CD 171 1 Y 1 E LYS 35 ? CE ? E LYS 35 CE 172 1 Y 1 E LYS 35 ? NZ ? E LYS 35 NZ 173 1 Y 1 E LYS 38 ? CG ? E LYS 38 CG 174 1 Y 1 E LYS 38 ? CD ? E LYS 38 CD 175 1 Y 1 E LYS 38 ? CE ? E LYS 38 CE 176 1 Y 1 E LYS 38 ? NZ ? E LYS 38 NZ 177 1 Y 1 E LYS 42 ? CE ? E LYS 42 CE 178 1 Y 1 E LYS 42 ? NZ ? E LYS 42 NZ 179 1 Y 1 E LYS 57 ? CG ? E LYS 57 CG 180 1 Y 1 E LYS 57 ? CD ? E LYS 57 CD 181 1 Y 1 E LYS 57 ? CE ? E LYS 57 CE 182 1 Y 1 E LYS 57 ? NZ ? E LYS 57 NZ 183 1 Y 1 E GLN 62 ? CG ? E GLN 62 CG 184 1 Y 1 E GLN 62 ? CD ? E GLN 62 CD 185 1 Y 1 E GLN 62 ? OE1 ? E GLN 62 OE1 186 1 Y 1 E GLN 62 ? NE2 ? E GLN 62 NE2 187 1 Y 1 E LYS 63 ? CG ? E LYS 63 CG 188 1 Y 1 E LYS 63 ? CD ? E LYS 63 CD 189 1 Y 1 E LYS 63 ? CE ? E LYS 63 CE 190 1 Y 1 E LYS 63 ? NZ ? E LYS 63 NZ 191 1 Y 1 E VAL 69 ? CG1 ? E VAL 69 CG1 192 1 Y 1 E VAL 69 ? CG2 ? E VAL 69 CG2 193 1 Y 1 E LYS 70 ? CG ? E LYS 70 CG 194 1 Y 1 E LYS 70 ? CD ? E LYS 70 CD 195 1 Y 1 E LYS 70 ? CE ? E LYS 70 CE 196 1 Y 1 E LYS 70 ? NZ ? E LYS 70 NZ 197 1 Y 1 E GLU 71 ? CG ? E GLU 71 CG 198 1 Y 1 E GLU 71 ? CD ? E GLU 71 CD 199 1 Y 1 E GLU 71 ? OE1 ? E GLU 71 OE1 200 1 Y 1 E GLU 71 ? OE2 ? E GLU 71 OE2 201 1 Y 1 E LYS 73 ? CG ? E LYS 73 CG 202 1 Y 1 E LYS 73 ? CD ? E LYS 73 CD 203 1 Y 1 E LYS 73 ? CE ? E LYS 73 CE 204 1 Y 1 E LYS 73 ? NZ ? E LYS 73 NZ 205 1 Y 1 E ARG 76 ? CG ? E ARG 76 CG 206 1 Y 1 E ARG 76 ? CD ? E ARG 76 CD 207 1 Y 1 E ARG 76 ? NE ? E ARG 76 NE 208 1 Y 1 E ARG 76 ? CZ ? E ARG 76 CZ 209 1 Y 1 E ARG 76 ? NH1 ? E ARG 76 NH1 210 1 Y 1 E ARG 76 ? NH2 ? E ARG 76 NH2 211 1 Y 1 E ARG 87 ? CG ? E ARG 87 CG 212 1 Y 1 E ARG 87 ? CD ? E ARG 87 CD 213 1 Y 1 E ARG 87 ? NE ? E ARG 87 NE 214 1 Y 1 E ARG 87 ? CZ ? E ARG 87 CZ 215 1 Y 1 E ARG 87 ? NH1 ? E ARG 87 NH1 216 1 Y 1 E ARG 87 ? NH2 ? E ARG 87 NH2 217 1 Y 1 E ARG 125 ? CG ? E ARG 125 CG 218 1 Y 1 E ARG 125 ? CD ? E ARG 125 CD 219 1 Y 1 E ARG 125 ? NE ? E ARG 125 NE 220 1 Y 1 E ARG 125 ? CZ ? E ARG 125 CZ 221 1 Y 1 E ARG 125 ? NH1 ? E ARG 125 NH1 222 1 Y 1 E ARG 125 ? NH2 ? E ARG 125 NH2 223 1 Y 1 F GLU 17 ? CG ? F GLU 17 CG 224 1 Y 1 F GLU 17 ? CD ? F GLU 17 CD 225 1 Y 1 F GLU 17 ? OE1 ? F GLU 17 OE1 226 1 Y 1 F GLU 17 ? OE2 ? F GLU 17 OE2 227 1 Y 1 F LYS 22 ? CG ? F LYS 22 CG 228 1 Y 1 F LYS 22 ? CD ? F LYS 22 CD 229 1 Y 1 F LYS 22 ? CE ? F LYS 22 CE 230 1 Y 1 F LYS 22 ? NZ ? F LYS 22 NZ 231 1 Y 1 F LYS 25 ? CG ? F LYS 25 CG 232 1 Y 1 F LYS 25 ? CD ? F LYS 25 CD 233 1 Y 1 F LYS 25 ? CE ? F LYS 25 CE 234 1 Y 1 F LYS 25 ? NZ ? F LYS 25 NZ 235 1 Y 1 F LYS 32 ? CD ? F LYS 32 CD 236 1 Y 1 F LYS 32 ? CE ? F LYS 32 CE 237 1 Y 1 F LYS 32 ? NZ ? F LYS 32 NZ 238 1 Y 1 F LYS 33 ? CD ? F LYS 33 CD 239 1 Y 1 F LYS 33 ? CE ? F LYS 33 CE 240 1 Y 1 F LYS 33 ? NZ ? F LYS 33 NZ 241 1 Y 1 F LYS 35 ? CD ? F LYS 35 CD 242 1 Y 1 F LYS 35 ? CE ? F LYS 35 CE 243 1 Y 1 F LYS 35 ? NZ ? F LYS 35 NZ 244 1 Y 1 F LYS 57 ? CG ? F LYS 57 CG 245 1 Y 1 F LYS 57 ? CD ? F LYS 57 CD 246 1 Y 1 F LYS 57 ? CE ? F LYS 57 CE 247 1 Y 1 F LYS 57 ? NZ ? F LYS 57 NZ 248 1 Y 1 F ILE 58 ? CG1 ? F ILE 58 CG1 249 1 Y 1 F ILE 58 ? CG2 ? F ILE 58 CG2 250 1 Y 1 F ILE 58 ? CD1 ? F ILE 58 CD1 251 1 Y 1 F ASP 59 ? CG ? F ASP 59 CG 252 1 Y 1 F ASP 59 ? OD1 ? F ASP 59 OD1 253 1 Y 1 F ASP 59 ? OD2 ? F ASP 59 OD2 254 1 Y 1 F MET 61 ? CG ? F MET 61 CG 255 1 Y 1 F MET 61 ? SD ? F MET 61 SD 256 1 Y 1 F MET 61 ? CE ? F MET 61 CE 257 1 Y 1 F LYS 63 ? CD ? F LYS 63 CD 258 1 Y 1 F LYS 63 ? CE ? F LYS 63 CE 259 1 Y 1 F LYS 63 ? NZ ? F LYS 63 NZ 260 1 Y 1 F LYS 70 ? CG ? F LYS 70 CG 261 1 Y 1 F LYS 70 ? CD ? F LYS 70 CD 262 1 Y 1 F LYS 70 ? CE ? F LYS 70 CE 263 1 Y 1 F LYS 70 ? NZ ? F LYS 70 NZ 264 1 Y 1 F GLU 74 ? CG ? F GLU 74 CG 265 1 Y 1 F GLU 74 ? CD ? F GLU 74 CD 266 1 Y 1 F GLU 74 ? OE1 ? F GLU 74 OE1 267 1 Y 1 F GLU 74 ? OE2 ? F GLU 74 OE2 268 1 Y 1 F GLU 109 ? CG ? F GLU 109 CG 269 1 Y 1 F GLU 109 ? CD ? F GLU 109 CD 270 1 Y 1 F GLU 109 ? OE1 ? F GLU 109 OE1 271 1 Y 1 F GLU 109 ? OE2 ? F GLU 109 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A GLN 123 ? A GLN 123 3 1 Y 1 A HIS 124 ? A HIS 124 4 1 Y 1 A ARG 125 ? A ARG 125 5 1 Y 1 A ASN 126 ? A ASN 126 6 1 Y 1 A GLN 127 ? A GLN 127 7 1 Y 1 A TRP 128 ? A TRP 128 8 1 Y 1 A SER 129 ? A SER 129 9 1 Y 1 A HIS 130 ? A HIS 130 10 1 Y 1 A PRO 131 ? A PRO 131 11 1 Y 1 A GLN 132 ? A GLN 132 12 1 Y 1 A PHE 133 ? A PHE 133 13 1 Y 1 A GLU 134 ? A GLU 134 14 1 Y 1 A LYS 135 ? A LYS 135 15 1 Y 1 B SER 1 ? B SER 1 16 1 Y 1 B ASN 2 ? B ASN 2 17 1 Y 1 B ALA 3 ? B ALA 3 18 1 Y 1 B MET 4 ? B MET 4 19 1 Y 1 B ASN 5 ? B ASN 5 20 1 Y 1 B ASP 6 ? B ASP 6 21 1 Y 1 B TRP 7 ? B TRP 7 22 1 Y 1 B ALA 8 ? B ALA 8 23 1 Y 1 B SER 9 ? B SER 9 24 1 Y 1 B LEU 10 ? B LEU 10 25 1 Y 1 B GLY 11 ? B GLY 11 26 1 Y 1 B ILE 12 ? B ILE 12 27 1 Y 1 B GLY 13 ? B GLY 13 28 1 Y 1 B SER 14 ? B SER 14 29 1 Y 1 B ILE 15 ? B ILE 15 30 1 Y 1 B GLY 16 ? B GLY 16 31 1 Y 1 B GLU 17 ? B GLU 17 32 1 Y 1 B GLN 127 ? B GLN 127 33 1 Y 1 B TRP 128 ? B TRP 128 34 1 Y 1 B SER 129 ? B SER 129 35 1 Y 1 B HIS 130 ? B HIS 130 36 1 Y 1 B PRO 131 ? B PRO 131 37 1 Y 1 B GLN 132 ? B GLN 132 38 1 Y 1 B PHE 133 ? B PHE 133 39 1 Y 1 B GLU 134 ? B GLU 134 40 1 Y 1 B LYS 135 ? B LYS 135 41 1 Y 1 C SER 1 ? C SER 1 42 1 Y 1 C ASN 2 ? C ASN 2 43 1 Y 1 C ALA 3 ? C ALA 3 44 1 Y 1 C MET 4 ? C MET 4 45 1 Y 1 C ASN 5 ? C ASN 5 46 1 Y 1 C ASP 6 ? C ASP 6 47 1 Y 1 C TRP 7 ? C TRP 7 48 1 Y 1 C ALA 8 ? C ALA 8 49 1 Y 1 C SER 9 ? C SER 9 50 1 Y 1 C LEU 10 ? C LEU 10 51 1 Y 1 C GLY 11 ? C GLY 11 52 1 Y 1 C ILE 12 ? C ILE 12 53 1 Y 1 C GLY 13 ? C GLY 13 54 1 Y 1 C SER 14 ? C SER 14 55 1 Y 1 C ILE 15 ? C ILE 15 56 1 Y 1 C GLY 16 ? C GLY 16 57 1 Y 1 C GLU 17 ? C GLU 17 58 1 Y 1 C ALA 18 ? C ALA 18 59 1 Y 1 C TRP 128 ? C TRP 128 60 1 Y 1 C SER 129 ? C SER 129 61 1 Y 1 C HIS 130 ? C HIS 130 62 1 Y 1 C PRO 131 ? C PRO 131 63 1 Y 1 C GLN 132 ? C GLN 132 64 1 Y 1 C PHE 133 ? C PHE 133 65 1 Y 1 C GLU 134 ? C GLU 134 66 1 Y 1 C LYS 135 ? C LYS 135 67 1 Y 1 D SER 1 ? D SER 1 68 1 Y 1 D ASN 2 ? D ASN 2 69 1 Y 1 D ALA 3 ? D ALA 3 70 1 Y 1 D MET 4 ? D MET 4 71 1 Y 1 D ASN 5 ? D ASN 5 72 1 Y 1 D ASP 6 ? D ASP 6 73 1 Y 1 D TRP 7 ? D TRP 7 74 1 Y 1 D ALA 8 ? D ALA 8 75 1 Y 1 D SER 9 ? D SER 9 76 1 Y 1 D LEU 10 ? D LEU 10 77 1 Y 1 D GLY 11 ? D GLY 11 78 1 Y 1 D ILE 12 ? D ILE 12 79 1 Y 1 D GLY 13 ? D GLY 13 80 1 Y 1 D SER 14 ? D SER 14 81 1 Y 1 D ILE 15 ? D ILE 15 82 1 Y 1 D GLY 16 ? D GLY 16 83 1 Y 1 D LEU 65 ? D LEU 65 84 1 Y 1 D ASP 66 ? D ASP 66 85 1 Y 1 D PHE 67 ? D PHE 67 86 1 Y 1 D LEU 122 ? D LEU 122 87 1 Y 1 D GLN 123 ? D GLN 123 88 1 Y 1 D HIS 124 ? D HIS 124 89 1 Y 1 D ARG 125 ? D ARG 125 90 1 Y 1 D ASN 126 ? D ASN 126 91 1 Y 1 D GLN 127 ? D GLN 127 92 1 Y 1 D TRP 128 ? D TRP 128 93 1 Y 1 D SER 129 ? D SER 129 94 1 Y 1 D HIS 130 ? D HIS 130 95 1 Y 1 D PRO 131 ? D PRO 131 96 1 Y 1 D GLN 132 ? D GLN 132 97 1 Y 1 D PHE 133 ? D PHE 133 98 1 Y 1 D GLU 134 ? D GLU 134 99 1 Y 1 D LYS 135 ? D LYS 135 100 1 Y 1 E SER 1 ? E SER 1 101 1 Y 1 E ASN 2 ? E ASN 2 102 1 Y 1 E ALA 3 ? E ALA 3 103 1 Y 1 E MET 4 ? E MET 4 104 1 Y 1 E ASN 5 ? E ASN 5 105 1 Y 1 E ASP 6 ? E ASP 6 106 1 Y 1 E TRP 7 ? E TRP 7 107 1 Y 1 E ALA 8 ? E ALA 8 108 1 Y 1 E SER 9 ? E SER 9 109 1 Y 1 E LEU 10 ? E LEU 10 110 1 Y 1 E GLY 11 ? E GLY 11 111 1 Y 1 E ILE 12 ? E ILE 12 112 1 Y 1 E GLY 13 ? E GLY 13 113 1 Y 1 E SER 14 ? E SER 14 114 1 Y 1 E ILE 15 ? E ILE 15 115 1 Y 1 E GLY 16 ? E GLY 16 116 1 Y 1 E GLU 17 ? E GLU 17 117 1 Y 1 E ALA 18 ? E ALA 18 118 1 Y 1 E GLN 127 ? E GLN 127 119 1 Y 1 E TRP 128 ? E TRP 128 120 1 Y 1 E SER 129 ? E SER 129 121 1 Y 1 E HIS 130 ? E HIS 130 122 1 Y 1 E PRO 131 ? E PRO 131 123 1 Y 1 E GLN 132 ? E GLN 132 124 1 Y 1 E PHE 133 ? E PHE 133 125 1 Y 1 E GLU 134 ? E GLU 134 126 1 Y 1 E LYS 135 ? E LYS 135 127 1 Y 1 F SER 1 ? F SER 1 128 1 Y 1 F ASP 118 ? F ASP 118 129 1 Y 1 F LEU 119 ? F LEU 119 130 1 Y 1 F GLN 120 ? F GLN 120 131 1 Y 1 F LEU 121 ? F LEU 121 132 1 Y 1 F LEU 122 ? F LEU 122 133 1 Y 1 F GLN 123 ? F GLN 123 134 1 Y 1 F HIS 124 ? F HIS 124 135 1 Y 1 F ARG 125 ? F ARG 125 136 1 Y 1 F ASN 126 ? F ASN 126 137 1 Y 1 F GLN 127 ? F GLN 127 138 1 Y 1 F TRP 128 ? F TRP 128 139 1 Y 1 F SER 129 ? F SER 129 140 1 Y 1 F HIS 130 ? F HIS 130 141 1 Y 1 F PRO 131 ? F PRO 131 142 1 Y 1 F GLN 132 ? F GLN 132 143 1 Y 1 F PHE 133 ? F PHE 133 144 1 Y 1 F GLU 134 ? F GLU 134 145 1 Y 1 F LYS 135 ? F LYS 135 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' IOS-1758400 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' RO1GM107444 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.crystal_system orthorhombic _space_group.name_H-M_alt 'P 21 2 21' _space_group.IT_number 18 _space_group.name_Hall 'P 2 2ab (y,z,x)' _space_group.id 1 #