data_7LEK # _entry.id 7LEK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7LEK pdb_00007lek 10.2210/pdb7lek/pdb WWPDB D_1000253742 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7LEK _pdbx_database_status.recvd_initial_deposition_date 2021-01-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chan, A.' 1 ? 'Karim, M.R.' 2 0000-0002-0424-127X 'Schonbrunn, E.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 15772 _citation.page_last 15786 _citation.title 'Differential BET Bromodomain Inhibition by Dihydropteridinone and Pyrimidodiazepinone Kinase Inhibitors.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c01096 _citation.pdbx_database_id_PubMed 34710325 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karim, R.M.' 1 ? primary 'Bikowitz, M.J.' 2 ? primary 'Chan, A.' 3 ? primary 'Zhu, J.Y.' 4 ? primary 'Grassie, D.' 5 ? primary 'Becker, A.' 6 ? primary 'Berndt, N.' 7 ? primary 'Gunawan, S.' 8 ? primary 'Lawrence, N.J.' 9 ? primary 'Schonbrunn, E.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 108.390 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7LEK _cell.details ? _cell.formula_units_Z ? _cell.length_a 110.610 _cell.length_a_esd ? _cell.length_b 99.320 _cell.length_b_esd ? _cell.length_c 60.400 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7LEK _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain testis-specific protein' 13704.791 4 ? ? ? ? 2 non-polymer syn ;11-cyclopentyl-2-({2-ethoxy-4-[4-(4-methylpiperazin-1-yl)piperidine-1-carbonyl]phenyl}amino)-5-methyl-5,11-dihydro-6H-pyrimido[4,5-b][1,4]benzodiazepin-6-one ; 638.802 4 ? ? ? ? 3 non-polymer nat 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 5 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cancer/testis antigen 9,CT9,RING3-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAASTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADV RLMFMNCYKYNPPDHEVVTMARMLQDVFETHFSKIPI ; _entity_poly.pdbx_seq_one_letter_code_can ;GAASTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADV RLMFMNCYKYNPPDHEVVTMARMLQDVFETHFSKIPI ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ALA n 1 4 SER n 1 5 THR n 1 6 VAL n 1 7 LYS n 1 8 VAL n 1 9 THR n 1 10 GLU n 1 11 GLN n 1 12 LEU n 1 13 ARG n 1 14 HIS n 1 15 CYS n 1 16 SER n 1 17 GLU n 1 18 ILE n 1 19 LEU n 1 20 LYS n 1 21 GLU n 1 22 MET n 1 23 LEU n 1 24 ALA n 1 25 LYS n 1 26 LYS n 1 27 HIS n 1 28 PHE n 1 29 SER n 1 30 TYR n 1 31 ALA n 1 32 TRP n 1 33 PRO n 1 34 PHE n 1 35 TYR n 1 36 ASN n 1 37 PRO n 1 38 VAL n 1 39 ASP n 1 40 VAL n 1 41 ASN n 1 42 ALA n 1 43 LEU n 1 44 GLY n 1 45 LEU n 1 46 HIS n 1 47 ASN n 1 48 TYR n 1 49 TYR n 1 50 ASP n 1 51 VAL n 1 52 VAL n 1 53 LYS n 1 54 ASN n 1 55 PRO n 1 56 MET n 1 57 ASP n 1 58 LEU n 1 59 GLY n 1 60 THR n 1 61 ILE n 1 62 LYS n 1 63 GLU n 1 64 LYS n 1 65 MET n 1 66 ASP n 1 67 ASN n 1 68 GLN n 1 69 GLU n 1 70 TYR n 1 71 LYS n 1 72 ASP n 1 73 ALA n 1 74 TYR n 1 75 LYS n 1 76 PHE n 1 77 ALA n 1 78 ALA n 1 79 ASP n 1 80 VAL n 1 81 ARG n 1 82 LEU n 1 83 MET n 1 84 PHE n 1 85 MET n 1 86 ASN n 1 87 CYS n 1 88 TYR n 1 89 LYS n 1 90 TYR n 1 91 ASN n 1 92 PRO n 1 93 PRO n 1 94 ASP n 1 95 HIS n 1 96 GLU n 1 97 VAL n 1 98 VAL n 1 99 THR n 1 100 MET n 1 101 ALA n 1 102 ARG n 1 103 MET n 1 104 LEU n 1 105 GLN n 1 106 ASP n 1 107 VAL n 1 108 PHE n 1 109 GLU n 1 110 THR n 1 111 HIS n 1 112 PHE n 1 113 SER n 1 114 LYS n 1 115 ILE n 1 116 PRO n 1 117 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 117 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BRDT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRDT_HUMAN _struct_ref.pdbx_db_accession Q58F21 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMF MNCYKYNPPDHEVVTMARMLQDVFETHFSKIPI ; _struct_ref.pdbx_align_begin 266 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7LEK A 5 ? 117 ? Q58F21 266 ? 378 ? 266 378 2 1 7LEK B 5 ? 117 ? Q58F21 266 ? 378 ? 266 378 3 1 7LEK C 5 ? 117 ? Q58F21 266 ? 378 ? 266 378 4 1 7LEK D 5 ? 117 ? Q58F21 266 ? 378 ? 266 378 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7LEK GLY A 1 ? UNP Q58F21 ? ? 'expression tag' 262 1 1 7LEK ALA A 2 ? UNP Q58F21 ? ? 'expression tag' 263 2 1 7LEK ALA A 3 ? UNP Q58F21 ? ? 'expression tag' 264 3 1 7LEK SER A 4 ? UNP Q58F21 ? ? 'expression tag' 265 4 2 7LEK GLY B 1 ? UNP Q58F21 ? ? 'expression tag' 262 5 2 7LEK ALA B 2 ? UNP Q58F21 ? ? 'expression tag' 263 6 2 7LEK ALA B 3 ? UNP Q58F21 ? ? 'expression tag' 264 7 2 7LEK SER B 4 ? UNP Q58F21 ? ? 'expression tag' 265 8 3 7LEK GLY C 1 ? UNP Q58F21 ? ? 'expression tag' 262 9 3 7LEK ALA C 2 ? UNP Q58F21 ? ? 'expression tag' 263 10 3 7LEK ALA C 3 ? UNP Q58F21 ? ? 'expression tag' 264 11 3 7LEK SER C 4 ? UNP Q58F21 ? ? 'expression tag' 265 12 4 7LEK GLY D 1 ? UNP Q58F21 ? ? 'expression tag' 262 13 4 7LEK ALA D 2 ? UNP Q58F21 ? ? 'expression tag' 263 14 4 7LEK ALA D 3 ? UNP Q58F21 ? ? 'expression tag' 264 15 4 7LEK SER D 4 ? UNP Q58F21 ? ? 'expression tag' 265 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VYJ non-polymer . ;11-cyclopentyl-2-({2-ethoxy-4-[4-(4-methylpiperazin-1-yl)piperidine-1-carbonyl]phenyl}amino)-5-methyl-5,11-dihydro-6H-pyrimido[4,5-b][1,4]benzodiazepin-6-one ; ? 'C36 H46 N8 O3' 638.802 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7LEK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.5 M Sodium formate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 44.56 _reflns.entry_id 7LEK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.750 _reflns.d_resolution_low 52.481 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16151 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.743 _reflns.pdbx_Rmerge_I_obs 0.108 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.620 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.943 _reflns.pdbx_scaling_rejects 13 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.127 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 60455 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.750 2.820 ? 2.560 ? ? ? ? 1175 100.0 ? ? ? ? 0.528 ? ? ? ? ? ? ? ? 3.759 ? ? ? ? 0.617 ? ? 1 1 0.815 ? ? 2.820 2.900 ? 2.920 ? ? ? ? 1168 99.700 ? ? ? ? 0.460 ? ? ? ? ? ? ? ? 3.760 ? ? ? ? 0.537 ? ? 2 1 0.845 ? ? 2.900 2.980 ? 3.340 ? ? ? ? 1141 99.400 ? ? ? ? 0.410 ? ? ? ? ? ? ? ? 3.762 ? ? ? ? 0.479 ? ? 3 1 0.866 ? ? 2.980 3.070 ? 4.140 ? ? ? ? 1074 99.600 ? ? ? ? 0.328 ? ? ? ? ? ? ? ? 3.768 ? ? ? ? 0.383 ? ? 4 1 0.916 ? ? 3.070 3.180 ? 4.740 ? ? ? ? 1056 100.0 ? ? ? ? 0.282 ? ? ? ? ? ? ? ? 3.795 ? ? ? ? 0.328 ? ? 5 1 0.925 ? ? 3.180 3.290 ? 6.270 ? ? ? ? 1013 100.0 ? ? ? ? 0.211 ? ? ? ? ? ? ? ? 3.775 ? ? ? ? 0.246 ? ? 6 1 0.959 ? ? 3.290 3.410 ? 7.890 ? ? ? ? 1015 99.000 ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 3.788 ? ? ? ? 0.196 ? ? 7 1 0.974 ? ? 3.410 3.550 ? 9.400 ? ? ? ? 971 99.500 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 3.782 ? ? ? ? 0.162 ? ? 8 1 0.982 ? ? 3.550 3.710 ? 12.310 ? ? ? ? 904 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 3.756 ? ? ? ? 0.122 ? ? 9 1 0.987 ? ? 3.710 3.890 ? 14.030 ? ? ? ? 873 100.0 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 3.735 ? ? ? ? 0.099 ? ? 10 1 0.992 ? ? 3.890 4.100 ? 13.970 ? ? ? ? 837 99.600 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 3.743 ? ? ? ? 0.102 ? ? 11 1 0.992 ? ? 4.100 4.350 ? 17.270 ? ? ? ? 799 99.500 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 3.690 ? ? ? ? 0.080 ? ? 12 1 0.994 ? ? 4.350 4.650 ? 17.930 ? ? ? ? 748 99.200 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 3.662 ? ? ? ? 0.076 ? ? 13 1 0.995 ? ? 4.650 5.020 ? 17.680 ? ? ? ? 690 99.900 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 3.767 ? ? ? ? 0.076 ? ? 14 1 0.996 ? ? 5.020 5.500 ? 17.470 ? ? ? ? 630 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 3.717 ? ? ? ? 0.077 ? ? 15 1 0.994 ? ? 5.500 6.150 ? 15.810 ? ? ? ? 586 99.700 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 3.761 ? ? ? ? 0.085 ? ? 16 1 0.994 ? ? 6.150 7.100 ? 18.030 ? ? ? ? 508 99.800 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 3.730 ? ? ? ? 0.074 ? ? 17 1 0.994 ? ? 7.100 8.700 ? 24.040 ? ? ? ? 439 99.500 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 3.711 ? ? ? ? 0.052 ? ? 18 1 0.997 ? ? 8.700 12.300 ? 28.020 ? ? ? ? 341 99.400 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 3.639 ? ? ? ? 0.038 ? ? 19 1 0.999 ? ? 12.300 52.481 ? 23.720 ? ? ? ? 183 93.400 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 3.126 ? ? ? ? 0.039 ? ? 20 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 125.400 _refine.B_iso_mean 49.9431 _refine.B_iso_min 13.580 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7LEK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7500 _refine.ls_d_res_low 52.4800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16145 _refine.ls_number_reflns_R_free 808 _refine.ls_number_reflns_R_work 15337 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7800 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2159 _refine.ls_R_factor_R_free 0.2643 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2133 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3VBQ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.0100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7500 _refine_hist.d_res_low 52.4800 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 3997 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 454 _refine_hist.pdbx_B_iso_mean_ligand 41.71 _refine_hist.pdbx_B_iso_mean_solvent 35.29 _refine_hist.pdbx_number_atoms_protein 3748 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 193 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1108 6.931 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1108 6.931 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 1108 6.931 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 1108 6.931 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7500 2.9200 2664 . 133 2531 100.0000 . . . 0.4304 0.0000 0.3171 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.9200 3.1500 2683 . 134 2549 100.0000 . . . 0.3667 0.0000 0.2781 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.1500 3.4600 2671 . 134 2537 100.0000 . . . 0.3031 0.0000 0.2407 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.4600 3.9600 2706 . 135 2571 100.0000 . . . 0.2396 0.0000 0.1960 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.9700 5.0000 2689 . 135 2554 100.0000 . . . 0.2357 0.0000 0.1733 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 5.0000 52.4800 2732 . 137 2595 99.0000 . . . 0.2083 0.0000 0.1927 . . . . . . . 6 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; 1 2 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; 1 3 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; 1 4 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? A 267 A 267 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 2 ? A 269 A 270 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 3 ? A 272 A 273 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 4 ? A 2 A 2 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 5 ? A 0 A 0 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 6 ? A 323 A 323 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 7 ? A 266 A 377 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 8 ? A 266 A 377 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 9 ? A 266 A 377 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 10 ? A 266 A 377 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 11 ? A 266 A 377 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 1 12 ? A 266 A 377 ;(chain A and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 1 ? B 267 B 267 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 2 ? B 269 B 270 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 3 ? B 272 B 273 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 4 ? B 2 B 2 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 5 ? B 0 B 0 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 6 ? B 323 B 323 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 7 ? B 263 B 378 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 8 ? B 263 B 378 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 9 ? B 263 B 378 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 10 ? B 263 B 378 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 11 ? B 263 B 378 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 2 12 ? B 263 B 378 ;(chain B and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 1 ? C 267 C 267 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 2 ? C 269 C 270 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 3 ? C 272 C 273 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 4 ? C 267 C 378 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 5 ? C 279 C 285 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 6 ? C 288 C 313 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 7 ? C 315 C 322 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 8 ? C 323 C 323 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 9 ? C 267 C 378 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 10 ? C 267 C 378 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 11 ? C 267 C 378 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 3 12 ? C 267 C 378 ;(chain C and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 331 or resid 333 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 1 ? D 267 D 267 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 2 ? D 269 D 270 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 3 ? D 272 D 273 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 4 ? D 2 D 2 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 5 ? D 0 D 0 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 6 ? D 333 D 335 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 7 ? D 265 D 378 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 8 ? D 265 D 378 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 9 ? D 265 D 378 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 10 ? D 265 D 378 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 11 ? D 265 D 378 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 12 ? D 265 D 378 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? 1 4 13 ? D 265 D 378 ;(chain D and (resid 267 or resid 269 through 270 or resid 272 through 273 or resid 276 through 277 or resid 279 through 285 or resid 288 through 313 or resid 315 through 331 or resid 333 through 335 or (resid 336 and (name N or name CA or name C or name O or name CB )) or resid 337 through 362 or resid 364 through 377)) ; ? ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7LEK _struct.title 'Crystal structure of the second bromodomain (BD2) of human BRDT bound to ERK5-IN-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7LEK _struct_keywords.text 'BRDT, BET, PLK1, testis specific, Bromodomain, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 2 ? I N N 4 ? J N N 2 ? K N N 5 ? L N N 5 ? M N N 5 ? N N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 6 ? ALA A 24 ? VAL A 267 ALA A 285 1 ? 19 HELX_P HELX_P2 AA2 HIS A 27 ? TRP A 32 ? HIS A 288 TRP A 293 1 ? 6 HELX_P HELX_P3 AA3 PRO A 33 ? TYR A 35 ? PRO A 294 TYR A 296 5 ? 3 HELX_P HELX_P4 AA4 ASP A 39 ? GLY A 44 ? ASP A 300 GLY A 305 1 ? 6 HELX_P HELX_P5 AA5 ASN A 47 ? VAL A 52 ? ASN A 308 VAL A 313 1 ? 6 HELX_P HELX_P6 AA6 ASP A 57 ? ASN A 67 ? ASP A 318 ASN A 328 1 ? 11 HELX_P HELX_P7 AA7 ASP A 72 ? ASN A 91 ? ASP A 333 ASN A 352 1 ? 20 HELX_P HELX_P8 AA8 HIS A 95 ? SER A 113 ? HIS A 356 SER A 374 1 ? 19 HELX_P HELX_P9 AA9 ALA B 3 ? ALA B 24 ? ALA B 264 ALA B 285 1 ? 22 HELX_P HELX_P10 AB1 HIS B 27 ? TRP B 32 ? HIS B 288 TRP B 293 1 ? 6 HELX_P HELX_P11 AB2 PRO B 33 ? TYR B 35 ? PRO B 294 TYR B 296 5 ? 3 HELX_P HELX_P12 AB3 ASP B 39 ? GLY B 44 ? ASP B 300 GLY B 305 1 ? 6 HELX_P HELX_P13 AB4 ASN B 47 ? VAL B 52 ? ASN B 308 VAL B 313 1 ? 6 HELX_P HELX_P14 AB5 ASP B 57 ? ASN B 67 ? ASP B 318 ASN B 328 1 ? 11 HELX_P HELX_P15 AB6 ASP B 72 ? ASN B 91 ? ASP B 333 ASN B 352 1 ? 20 HELX_P HELX_P16 AB7 HIS B 95 ? LYS B 114 ? HIS B 356 LYS B 375 1 ? 20 HELX_P HELX_P17 AB8 LYS C 7 ? ALA C 24 ? LYS C 268 ALA C 285 1 ? 18 HELX_P HELX_P18 AB9 HIS C 27 ? TRP C 32 ? HIS C 288 TRP C 293 1 ? 6 HELX_P HELX_P19 AC1 PRO C 33 ? TYR C 35 ? PRO C 294 TYR C 296 5 ? 3 HELX_P HELX_P20 AC2 ASP C 39 ? GLY C 44 ? ASP C 300 GLY C 305 1 ? 6 HELX_P HELX_P21 AC3 ASN C 47 ? VAL C 52 ? ASN C 308 VAL C 313 1 ? 6 HELX_P HELX_P22 AC4 ASP C 57 ? ASN C 67 ? ASP C 318 ASN C 328 1 ? 11 HELX_P HELX_P23 AC5 ASP C 72 ? ASN C 91 ? ASP C 333 ASN C 352 1 ? 20 HELX_P HELX_P24 AC6 HIS C 95 ? LYS C 114 ? HIS C 356 LYS C 375 1 ? 20 HELX_P HELX_P25 AC7 THR D 5 ? ALA D 24 ? THR D 266 ALA D 285 1 ? 20 HELX_P HELX_P26 AC8 HIS D 27 ? TRP D 32 ? HIS D 288 TRP D 293 1 ? 6 HELX_P HELX_P27 AC9 PRO D 33 ? TYR D 35 ? PRO D 294 TYR D 296 5 ? 3 HELX_P HELX_P28 AD1 ASP D 39 ? GLY D 44 ? ASP D 300 GLY D 305 1 ? 6 HELX_P HELX_P29 AD2 ASN D 47 ? VAL D 52 ? ASN D 308 VAL D 313 1 ? 6 HELX_P HELX_P30 AD3 ASP D 57 ? ASN D 67 ? ASP D 318 ASN D 328 1 ? 11 HELX_P HELX_P31 AD4 ASP D 72 ? ASN D 91 ? ASP D 333 ASN D 352 1 ? 20 HELX_P HELX_P32 AD5 HIS D 95 ? LYS D 114 ? HIS D 356 LYS D 375 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A VYJ 401 ? 15 'binding site for residue VYJ A 401' AC2 Software B VYJ 401 ? 13 'binding site for residue VYJ B 401' AC3 Software C VYJ 401 ? 15 'binding site for residue VYJ C 401' AC4 Software C EDO 402 ? 7 'binding site for residue EDO C 402' AC5 Software D VYJ 401 ? 13 'binding site for residue VYJ D 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 TRP A 32 ? TRP A 293 . ? 1_555 ? 2 AC1 15 PRO A 33 ? PRO A 294 . ? 1_555 ? 3 AC1 15 LEU A 43 ? LEU A 304 . ? 1_555 ? 4 AC1 15 LEU A 45 ? LEU A 306 . ? 1_555 ? 5 AC1 15 TYR A 90 ? TYR A 351 . ? 1_555 ? 6 AC1 15 ASN A 91 ? ASN A 352 . ? 1_555 ? 7 AC1 15 HIS A 95 ? HIS A 356 . ? 1_555 ? 8 AC1 15 VAL A 97 ? VAL A 358 . ? 1_555 ? 9 AC1 15 MET A 100 ? MET A 361 . ? 1_555 ? 10 AC1 15 HOH K . ? HOH A 502 . ? 1_555 ? 11 AC1 15 HOH K . ? HOH A 511 . ? 1_555 ? 12 AC1 15 GLU C 69 ? GLU C 330 . ? 1_555 ? 13 AC1 15 TRP D 32 ? TRP D 293 . ? 1_555 ? 14 AC1 15 LEU D 43 ? LEU D 304 . ? 1_555 ? 15 AC1 15 VYJ J . ? VYJ D 401 . ? 1_555 ? 16 AC2 13 PRO B 33 ? PRO B 294 . ? 1_555 ? 17 AC2 13 ASP B 39 ? ASP B 300 . ? 1_555 ? 18 AC2 13 ALA B 42 ? ALA B 303 . ? 1_555 ? 19 AC2 13 LEU B 43 ? LEU B 304 . ? 1_555 ? 20 AC2 13 LEU B 45 ? LEU B 306 . ? 1_555 ? 21 AC2 13 TYR B 90 ? TYR B 351 . ? 1_555 ? 22 AC2 13 ASN B 91 ? ASN B 352 . ? 1_555 ? 23 AC2 13 HIS B 95 ? HIS B 356 . ? 1_555 ? 24 AC2 13 VAL B 97 ? VAL B 358 . ? 1_555 ? 25 AC2 13 HOH L . ? HOH B 508 . ? 1_555 ? 26 AC2 13 LEU C 43 ? LEU C 304 . ? 4_546 ? 27 AC2 13 GLY C 44 ? GLY C 305 . ? 4_546 ? 28 AC2 13 VYJ H . ? VYJ C 401 . ? 4_546 ? 29 AC3 15 ASN A 67 ? ASN A 328 . ? 1_555 ? 30 AC3 15 TRP B 32 ? TRP B 293 . ? 4_556 ? 31 AC3 15 LEU B 43 ? LEU B 304 . ? 4_556 ? 32 AC3 15 GLU B 96 ? GLU B 357 . ? 4_556 ? 33 AC3 15 VYJ F . ? VYJ B 401 . ? 4_556 ? 34 AC3 15 TRP C 32 ? TRP C 293 . ? 1_555 ? 35 AC3 15 PRO C 33 ? PRO C 294 . ? 1_555 ? 36 AC3 15 ALA C 42 ? ALA C 303 . ? 1_555 ? 37 AC3 15 LEU C 43 ? LEU C 304 . ? 1_555 ? 38 AC3 15 LEU C 45 ? LEU C 306 . ? 1_555 ? 39 AC3 15 TYR C 90 ? TYR C 351 . ? 1_555 ? 40 AC3 15 ASN C 91 ? ASN C 352 . ? 1_555 ? 41 AC3 15 VAL C 97 ? VAL C 358 . ? 1_555 ? 42 AC3 15 HOH M . ? HOH C 504 . ? 1_555 ? 43 AC3 15 HOH M . ? HOH C 507 . ? 1_555 ? 44 AC4 7 PRO A 37 ? PRO A 298 . ? 1_555 ? 45 AC4 7 PRO A 55 ? PRO A 316 . ? 1_555 ? 46 AC4 7 HOH K . ? HOH A 508 . ? 1_555 ? 47 AC4 7 VAL C 38 ? VAL C 299 . ? 1_555 ? 48 AC4 7 VAL C 40 ? VAL C 301 . ? 1_555 ? 49 AC4 7 ASN C 41 ? ASN C 302 . ? 1_555 ? 50 AC4 7 TYR C 49 ? TYR C 310 . ? 1_555 ? 51 AC5 13 TRP A 32 ? TRP A 293 . ? 1_555 ? 52 AC5 13 LEU A 43 ? LEU A 304 . ? 1_555 ? 53 AC5 13 GLY A 44 ? GLY A 305 . ? 1_555 ? 54 AC5 13 LEU A 45 ? LEU A 306 . ? 1_555 ? 55 AC5 13 VYJ E . ? VYJ A 401 . ? 1_555 ? 56 AC5 13 TRP D 32 ? TRP D 293 . ? 1_555 ? 57 AC5 13 PRO D 33 ? PRO D 294 . ? 1_555 ? 58 AC5 13 LEU D 43 ? LEU D 304 . ? 1_555 ? 59 AC5 13 LEU D 45 ? LEU D 306 . ? 1_555 ? 60 AC5 13 TYR D 90 ? TYR D 351 . ? 1_555 ? 61 AC5 13 ASN D 91 ? ASN D 352 . ? 1_555 ? 62 AC5 13 HIS D 95 ? HIS D 356 . ? 1_555 ? 63 AC5 13 VAL D 97 ? VAL D 358 . ? 1_555 ? # _atom_sites.entry_id 7LEK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009041 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003006 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010068 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017447 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 262 ? ? ? A . n A 1 2 ALA 2 263 ? ? ? A . n A 1 3 ALA 3 264 ? ? ? A . n A 1 4 SER 4 265 ? ? ? A . n A 1 5 THR 5 266 266 THR THR A . n A 1 6 VAL 6 267 267 VAL VAL A . n A 1 7 LYS 7 268 268 LYS LYS A . n A 1 8 VAL 8 269 269 VAL VAL A . n A 1 9 THR 9 270 270 THR THR A . n A 1 10 GLU 10 271 271 GLU GLU A . n A 1 11 GLN 11 272 272 GLN GLN A . n A 1 12 LEU 12 273 273 LEU LEU A . n A 1 13 ARG 13 274 274 ARG ARG A . n A 1 14 HIS 14 275 275 HIS HIS A . n A 1 15 CYS 15 276 276 CYS CYS A . n A 1 16 SER 16 277 277 SER SER A . n A 1 17 GLU 17 278 278 GLU GLU A . n A 1 18 ILE 18 279 279 ILE ILE A . n A 1 19 LEU 19 280 280 LEU LEU A . n A 1 20 LYS 20 281 281 LYS LYS A . n A 1 21 GLU 21 282 282 GLU GLU A . n A 1 22 MET 22 283 283 MET MET A . n A 1 23 LEU 23 284 284 LEU LEU A . n A 1 24 ALA 24 285 285 ALA ALA A . n A 1 25 LYS 25 286 286 LYS LYS A . n A 1 26 LYS 26 287 287 LYS LYS A . n A 1 27 HIS 27 288 288 HIS HIS A . n A 1 28 PHE 28 289 289 PHE PHE A . n A 1 29 SER 29 290 290 SER SER A . n A 1 30 TYR 30 291 291 TYR TYR A . n A 1 31 ALA 31 292 292 ALA ALA A . n A 1 32 TRP 32 293 293 TRP TRP A . n A 1 33 PRO 33 294 294 PRO PRO A . n A 1 34 PHE 34 295 295 PHE PHE A . n A 1 35 TYR 35 296 296 TYR TYR A . n A 1 36 ASN 36 297 297 ASN ASN A . n A 1 37 PRO 37 298 298 PRO PRO A . n A 1 38 VAL 38 299 299 VAL VAL A . n A 1 39 ASP 39 300 300 ASP ASP A . n A 1 40 VAL 40 301 301 VAL VAL A . n A 1 41 ASN 41 302 302 ASN ASN A . n A 1 42 ALA 42 303 303 ALA ALA A . n A 1 43 LEU 43 304 304 LEU LEU A . n A 1 44 GLY 44 305 305 GLY GLY A . n A 1 45 LEU 45 306 306 LEU LEU A . n A 1 46 HIS 46 307 307 HIS HIS A . n A 1 47 ASN 47 308 308 ASN ASN A . n A 1 48 TYR 48 309 309 TYR TYR A . n A 1 49 TYR 49 310 310 TYR TYR A . n A 1 50 ASP 50 311 311 ASP ASP A . n A 1 51 VAL 51 312 312 VAL VAL A . n A 1 52 VAL 52 313 313 VAL VAL A . n A 1 53 LYS 53 314 314 LYS LYS A . n A 1 54 ASN 54 315 315 ASN ASN A . n A 1 55 PRO 55 316 316 PRO PRO A . n A 1 56 MET 56 317 317 MET MET A . n A 1 57 ASP 57 318 318 ASP ASP A . n A 1 58 LEU 58 319 319 LEU LEU A . n A 1 59 GLY 59 320 320 GLY GLY A . n A 1 60 THR 60 321 321 THR THR A . n A 1 61 ILE 61 322 322 ILE ILE A . n A 1 62 LYS 62 323 323 LYS LYS A . n A 1 63 GLU 63 324 324 GLU GLU A . n A 1 64 LYS 64 325 325 LYS LYS A . n A 1 65 MET 65 326 326 MET MET A . n A 1 66 ASP 66 327 327 ASP ASP A . n A 1 67 ASN 67 328 328 ASN ASN A . n A 1 68 GLN 68 329 329 GLN GLN A . n A 1 69 GLU 69 330 330 GLU GLU A . n A 1 70 TYR 70 331 331 TYR TYR A . n A 1 71 LYS 71 332 332 LYS LYS A . n A 1 72 ASP 72 333 333 ASP ASP A . n A 1 73 ALA 73 334 334 ALA ALA A . n A 1 74 TYR 74 335 335 TYR TYR A . n A 1 75 LYS 75 336 336 LYS LYS A . n A 1 76 PHE 76 337 337 PHE PHE A . n A 1 77 ALA 77 338 338 ALA ALA A . n A 1 78 ALA 78 339 339 ALA ALA A . n A 1 79 ASP 79 340 340 ASP ASP A . n A 1 80 VAL 80 341 341 VAL VAL A . n A 1 81 ARG 81 342 342 ARG ARG A . n A 1 82 LEU 82 343 343 LEU LEU A . n A 1 83 MET 83 344 344 MET MET A . n A 1 84 PHE 84 345 345 PHE PHE A . n A 1 85 MET 85 346 346 MET MET A . n A 1 86 ASN 86 347 347 ASN ASN A . n A 1 87 CYS 87 348 348 CYS CYS A . n A 1 88 TYR 88 349 349 TYR TYR A . n A 1 89 LYS 89 350 350 LYS LYS A . n A 1 90 TYR 90 351 351 TYR TYR A . n A 1 91 ASN 91 352 352 ASN ASN A . n A 1 92 PRO 92 353 353 PRO PRO A . n A 1 93 PRO 93 354 354 PRO PRO A . n A 1 94 ASP 94 355 355 ASP ASP A . n A 1 95 HIS 95 356 356 HIS HIS A . n A 1 96 GLU 96 357 357 GLU GLU A . n A 1 97 VAL 97 358 358 VAL VAL A . n A 1 98 VAL 98 359 359 VAL VAL A . n A 1 99 THR 99 360 360 THR THR A . n A 1 100 MET 100 361 361 MET MET A . n A 1 101 ALA 101 362 362 ALA ALA A . n A 1 102 ARG 102 363 363 ARG ARG A . n A 1 103 MET 103 364 364 MET MET A . n A 1 104 LEU 104 365 365 LEU LEU A . n A 1 105 GLN 105 366 366 GLN GLN A . n A 1 106 ASP 106 367 367 ASP ASP A . n A 1 107 VAL 107 368 368 VAL VAL A . n A 1 108 PHE 108 369 369 PHE PHE A . n A 1 109 GLU 109 370 370 GLU GLU A . n A 1 110 THR 110 371 371 THR THR A . n A 1 111 HIS 111 372 372 HIS HIS A . n A 1 112 PHE 112 373 373 PHE PHE A . n A 1 113 SER 113 374 374 SER SER A . n A 1 114 LYS 114 375 375 LYS LYS A . n A 1 115 ILE 115 376 376 ILE ILE A . n A 1 116 PRO 116 377 377 PRO PRO A . n A 1 117 ILE 117 378 ? ? ? A . n B 1 1 GLY 1 262 ? ? ? B . n B 1 2 ALA 2 263 263 ALA ALA B . n B 1 3 ALA 3 264 264 ALA ALA B . n B 1 4 SER 4 265 265 SER SER B . n B 1 5 THR 5 266 266 THR THR B . n B 1 6 VAL 6 267 267 VAL VAL B . n B 1 7 LYS 7 268 268 LYS LYS B . n B 1 8 VAL 8 269 269 VAL VAL B . n B 1 9 THR 9 270 270 THR THR B . n B 1 10 GLU 10 271 271 GLU GLU B . n B 1 11 GLN 11 272 272 GLN GLN B . n B 1 12 LEU 12 273 273 LEU LEU B . n B 1 13 ARG 13 274 274 ARG ARG B . n B 1 14 HIS 14 275 275 HIS HIS B . n B 1 15 CYS 15 276 276 CYS CYS B . n B 1 16 SER 16 277 277 SER SER B . n B 1 17 GLU 17 278 278 GLU GLU B . n B 1 18 ILE 18 279 279 ILE ILE B . n B 1 19 LEU 19 280 280 LEU LEU B . n B 1 20 LYS 20 281 281 LYS LYS B . n B 1 21 GLU 21 282 282 GLU GLU B . n B 1 22 MET 22 283 283 MET MET B . n B 1 23 LEU 23 284 284 LEU LEU B . n B 1 24 ALA 24 285 285 ALA ALA B . n B 1 25 LYS 25 286 286 LYS LYS B . n B 1 26 LYS 26 287 287 LYS LYS B . n B 1 27 HIS 27 288 288 HIS HIS B . n B 1 28 PHE 28 289 289 PHE PHE B . n B 1 29 SER 29 290 290 SER SER B . n B 1 30 TYR 30 291 291 TYR TYR B . n B 1 31 ALA 31 292 292 ALA ALA B . n B 1 32 TRP 32 293 293 TRP TRP B . n B 1 33 PRO 33 294 294 PRO PRO B . n B 1 34 PHE 34 295 295 PHE PHE B . n B 1 35 TYR 35 296 296 TYR TYR B . n B 1 36 ASN 36 297 297 ASN ASN B . n B 1 37 PRO 37 298 298 PRO PRO B . n B 1 38 VAL 38 299 299 VAL VAL B . n B 1 39 ASP 39 300 300 ASP ASP B . n B 1 40 VAL 40 301 301 VAL VAL B . n B 1 41 ASN 41 302 302 ASN ASN B . n B 1 42 ALA 42 303 303 ALA ALA B . n B 1 43 LEU 43 304 304 LEU LEU B . n B 1 44 GLY 44 305 305 GLY GLY B . n B 1 45 LEU 45 306 306 LEU LEU B . n B 1 46 HIS 46 307 307 HIS HIS B . n B 1 47 ASN 47 308 308 ASN ASN B . n B 1 48 TYR 48 309 309 TYR TYR B . n B 1 49 TYR 49 310 310 TYR TYR B . n B 1 50 ASP 50 311 311 ASP ASP B . n B 1 51 VAL 51 312 312 VAL VAL B . n B 1 52 VAL 52 313 313 VAL VAL B . n B 1 53 LYS 53 314 314 LYS LYS B . n B 1 54 ASN 54 315 315 ASN ASN B . n B 1 55 PRO 55 316 316 PRO PRO B . n B 1 56 MET 56 317 317 MET MET B . n B 1 57 ASP 57 318 318 ASP ASP B . n B 1 58 LEU 58 319 319 LEU LEU B . n B 1 59 GLY 59 320 320 GLY GLY B . n B 1 60 THR 60 321 321 THR THR B . n B 1 61 ILE 61 322 322 ILE ILE B . n B 1 62 LYS 62 323 323 LYS LYS B . n B 1 63 GLU 63 324 324 GLU GLU B . n B 1 64 LYS 64 325 325 LYS LYS B . n B 1 65 MET 65 326 326 MET MET B . n B 1 66 ASP 66 327 327 ASP ASP B . n B 1 67 ASN 67 328 328 ASN ASN B . n B 1 68 GLN 68 329 329 GLN GLN B . n B 1 69 GLU 69 330 330 GLU GLU B . n B 1 70 TYR 70 331 331 TYR TYR B . n B 1 71 LYS 71 332 332 LYS LYS B . n B 1 72 ASP 72 333 333 ASP ASP B . n B 1 73 ALA 73 334 334 ALA ALA B . n B 1 74 TYR 74 335 335 TYR TYR B . n B 1 75 LYS 75 336 336 LYS LYS B . n B 1 76 PHE 76 337 337 PHE PHE B . n B 1 77 ALA 77 338 338 ALA ALA B . n B 1 78 ALA 78 339 339 ALA ALA B . n B 1 79 ASP 79 340 340 ASP ASP B . n B 1 80 VAL 80 341 341 VAL VAL B . n B 1 81 ARG 81 342 342 ARG ARG B . n B 1 82 LEU 82 343 343 LEU LEU B . n B 1 83 MET 83 344 344 MET MET B . n B 1 84 PHE 84 345 345 PHE PHE B . n B 1 85 MET 85 346 346 MET MET B . n B 1 86 ASN 86 347 347 ASN ASN B . n B 1 87 CYS 87 348 348 CYS CYS B . n B 1 88 TYR 88 349 349 TYR TYR B . n B 1 89 LYS 89 350 350 LYS LYS B . n B 1 90 TYR 90 351 351 TYR TYR B . n B 1 91 ASN 91 352 352 ASN ASN B . n B 1 92 PRO 92 353 353 PRO PRO B . n B 1 93 PRO 93 354 354 PRO PRO B . n B 1 94 ASP 94 355 355 ASP ASP B . n B 1 95 HIS 95 356 356 HIS HIS B . n B 1 96 GLU 96 357 357 GLU GLU B . n B 1 97 VAL 97 358 358 VAL VAL B . n B 1 98 VAL 98 359 359 VAL VAL B . n B 1 99 THR 99 360 360 THR THR B . n B 1 100 MET 100 361 361 MET MET B . n B 1 101 ALA 101 362 362 ALA ALA B . n B 1 102 ARG 102 363 363 ARG ARG B . n B 1 103 MET 103 364 364 MET MET B . n B 1 104 LEU 104 365 365 LEU LEU B . n B 1 105 GLN 105 366 366 GLN GLN B . n B 1 106 ASP 106 367 367 ASP ASP B . n B 1 107 VAL 107 368 368 VAL VAL B . n B 1 108 PHE 108 369 369 PHE PHE B . n B 1 109 GLU 109 370 370 GLU GLU B . n B 1 110 THR 110 371 371 THR THR B . n B 1 111 HIS 111 372 372 HIS HIS B . n B 1 112 PHE 112 373 373 PHE PHE B . n B 1 113 SER 113 374 374 SER SER B . n B 1 114 LYS 114 375 375 LYS LYS B . n B 1 115 ILE 115 376 376 ILE ILE B . n B 1 116 PRO 116 377 377 PRO PRO B . n B 1 117 ILE 117 378 378 ILE ILE B . n C 1 1 GLY 1 262 ? ? ? C . n C 1 2 ALA 2 263 ? ? ? C . n C 1 3 ALA 3 264 ? ? ? C . n C 1 4 SER 4 265 ? ? ? C . n C 1 5 THR 5 266 ? ? ? C . n C 1 6 VAL 6 267 267 VAL VAL C . n C 1 7 LYS 7 268 268 LYS LYS C . n C 1 8 VAL 8 269 269 VAL VAL C . n C 1 9 THR 9 270 270 THR THR C . n C 1 10 GLU 10 271 271 GLU GLU C . n C 1 11 GLN 11 272 272 GLN GLN C . n C 1 12 LEU 12 273 273 LEU LEU C . n C 1 13 ARG 13 274 274 ARG ARG C . n C 1 14 HIS 14 275 275 HIS HIS C . n C 1 15 CYS 15 276 276 CYS CYS C . n C 1 16 SER 16 277 277 SER SER C . n C 1 17 GLU 17 278 278 GLU GLU C . n C 1 18 ILE 18 279 279 ILE ILE C . n C 1 19 LEU 19 280 280 LEU LEU C . n C 1 20 LYS 20 281 281 LYS LYS C . n C 1 21 GLU 21 282 282 GLU GLU C . n C 1 22 MET 22 283 283 MET MET C . n C 1 23 LEU 23 284 284 LEU LEU C . n C 1 24 ALA 24 285 285 ALA ALA C . n C 1 25 LYS 25 286 286 LYS LYS C . n C 1 26 LYS 26 287 287 LYS LYS C . n C 1 27 HIS 27 288 288 HIS HIS C . n C 1 28 PHE 28 289 289 PHE PHE C . n C 1 29 SER 29 290 290 SER SER C . n C 1 30 TYR 30 291 291 TYR TYR C . n C 1 31 ALA 31 292 292 ALA ALA C . n C 1 32 TRP 32 293 293 TRP TRP C . n C 1 33 PRO 33 294 294 PRO PRO C . n C 1 34 PHE 34 295 295 PHE PHE C . n C 1 35 TYR 35 296 296 TYR TYR C . n C 1 36 ASN 36 297 297 ASN ASN C . n C 1 37 PRO 37 298 298 PRO PRO C . n C 1 38 VAL 38 299 299 VAL VAL C . n C 1 39 ASP 39 300 300 ASP ASP C . n C 1 40 VAL 40 301 301 VAL VAL C . n C 1 41 ASN 41 302 302 ASN ASN C . n C 1 42 ALA 42 303 303 ALA ALA C . n C 1 43 LEU 43 304 304 LEU LEU C . n C 1 44 GLY 44 305 305 GLY GLY C . n C 1 45 LEU 45 306 306 LEU LEU C . n C 1 46 HIS 46 307 307 HIS HIS C . n C 1 47 ASN 47 308 308 ASN ASN C . n C 1 48 TYR 48 309 309 TYR TYR C . n C 1 49 TYR 49 310 310 TYR TYR C . n C 1 50 ASP 50 311 311 ASP ASP C . n C 1 51 VAL 51 312 312 VAL VAL C . n C 1 52 VAL 52 313 313 VAL VAL C . n C 1 53 LYS 53 314 314 LYS LYS C . n C 1 54 ASN 54 315 315 ASN ASN C . n C 1 55 PRO 55 316 316 PRO PRO C . n C 1 56 MET 56 317 317 MET MET C . n C 1 57 ASP 57 318 318 ASP ASP C . n C 1 58 LEU 58 319 319 LEU LEU C . n C 1 59 GLY 59 320 320 GLY GLY C . n C 1 60 THR 60 321 321 THR THR C . n C 1 61 ILE 61 322 322 ILE ILE C . n C 1 62 LYS 62 323 323 LYS LYS C . n C 1 63 GLU 63 324 324 GLU GLU C . n C 1 64 LYS 64 325 325 LYS LYS C . n C 1 65 MET 65 326 326 MET MET C . n C 1 66 ASP 66 327 327 ASP ASP C . n C 1 67 ASN 67 328 328 ASN ASN C . n C 1 68 GLN 68 329 329 GLN GLN C . n C 1 69 GLU 69 330 330 GLU GLU C . n C 1 70 TYR 70 331 331 TYR TYR C . n C 1 71 LYS 71 332 332 LYS LYS C . n C 1 72 ASP 72 333 333 ASP ASP C . n C 1 73 ALA 73 334 334 ALA ALA C . n C 1 74 TYR 74 335 335 TYR TYR C . n C 1 75 LYS 75 336 336 LYS LYS C . n C 1 76 PHE 76 337 337 PHE PHE C . n C 1 77 ALA 77 338 338 ALA ALA C . n C 1 78 ALA 78 339 339 ALA ALA C . n C 1 79 ASP 79 340 340 ASP ASP C . n C 1 80 VAL 80 341 341 VAL VAL C . n C 1 81 ARG 81 342 342 ARG ARG C . n C 1 82 LEU 82 343 343 LEU LEU C . n C 1 83 MET 83 344 344 MET MET C . n C 1 84 PHE 84 345 345 PHE PHE C . n C 1 85 MET 85 346 346 MET MET C . n C 1 86 ASN 86 347 347 ASN ASN C . n C 1 87 CYS 87 348 348 CYS CYS C . n C 1 88 TYR 88 349 349 TYR TYR C . n C 1 89 LYS 89 350 350 LYS LYS C . n C 1 90 TYR 90 351 351 TYR TYR C . n C 1 91 ASN 91 352 352 ASN ASN C . n C 1 92 PRO 92 353 353 PRO PRO C . n C 1 93 PRO 93 354 354 PRO PRO C . n C 1 94 ASP 94 355 355 ASP ASP C . n C 1 95 HIS 95 356 356 HIS HIS C . n C 1 96 GLU 96 357 357 GLU GLU C . n C 1 97 VAL 97 358 358 VAL VAL C . n C 1 98 VAL 98 359 359 VAL VAL C . n C 1 99 THR 99 360 360 THR THR C . n C 1 100 MET 100 361 361 MET MET C . n C 1 101 ALA 101 362 362 ALA ALA C . n C 1 102 ARG 102 363 363 ARG ARG C . n C 1 103 MET 103 364 364 MET MET C . n C 1 104 LEU 104 365 365 LEU LEU C . n C 1 105 GLN 105 366 366 GLN GLN C . n C 1 106 ASP 106 367 367 ASP ASP C . n C 1 107 VAL 107 368 368 VAL VAL C . n C 1 108 PHE 108 369 369 PHE PHE C . n C 1 109 GLU 109 370 370 GLU GLU C . n C 1 110 THR 110 371 371 THR THR C . n C 1 111 HIS 111 372 372 HIS HIS C . n C 1 112 PHE 112 373 373 PHE PHE C . n C 1 113 SER 113 374 374 SER SER C . n C 1 114 LYS 114 375 375 LYS LYS C . n C 1 115 ILE 115 376 376 ILE ILE C . n C 1 116 PRO 116 377 377 PRO PRO C . n C 1 117 ILE 117 378 378 ILE ILE C . n D 1 1 GLY 1 262 ? ? ? D . n D 1 2 ALA 2 263 ? ? ? D . n D 1 3 ALA 3 264 ? ? ? D . n D 1 4 SER 4 265 265 SER SER D . n D 1 5 THR 5 266 266 THR THR D . n D 1 6 VAL 6 267 267 VAL VAL D . n D 1 7 LYS 7 268 268 LYS LYS D . n D 1 8 VAL 8 269 269 VAL VAL D . n D 1 9 THR 9 270 270 THR THR D . n D 1 10 GLU 10 271 271 GLU GLU D . n D 1 11 GLN 11 272 272 GLN GLN D . n D 1 12 LEU 12 273 273 LEU LEU D . n D 1 13 ARG 13 274 274 ARG ARG D . n D 1 14 HIS 14 275 275 HIS HIS D . n D 1 15 CYS 15 276 276 CYS CYS D . n D 1 16 SER 16 277 277 SER SER D . n D 1 17 GLU 17 278 278 GLU GLU D . n D 1 18 ILE 18 279 279 ILE ILE D . n D 1 19 LEU 19 280 280 LEU LEU D . n D 1 20 LYS 20 281 281 LYS LYS D . n D 1 21 GLU 21 282 282 GLU GLU D . n D 1 22 MET 22 283 283 MET MET D . n D 1 23 LEU 23 284 284 LEU LEU D . n D 1 24 ALA 24 285 285 ALA ALA D . n D 1 25 LYS 25 286 286 LYS LYS D . n D 1 26 LYS 26 287 287 LYS LYS D . n D 1 27 HIS 27 288 288 HIS HIS D . n D 1 28 PHE 28 289 289 PHE PHE D . n D 1 29 SER 29 290 290 SER SER D . n D 1 30 TYR 30 291 291 TYR TYR D . n D 1 31 ALA 31 292 292 ALA ALA D . n D 1 32 TRP 32 293 293 TRP TRP D . n D 1 33 PRO 33 294 294 PRO PRO D . n D 1 34 PHE 34 295 295 PHE PHE D . n D 1 35 TYR 35 296 296 TYR TYR D . n D 1 36 ASN 36 297 297 ASN ASN D . n D 1 37 PRO 37 298 298 PRO PRO D . n D 1 38 VAL 38 299 299 VAL VAL D . n D 1 39 ASP 39 300 300 ASP ASP D . n D 1 40 VAL 40 301 301 VAL VAL D . n D 1 41 ASN 41 302 302 ASN ASN D . n D 1 42 ALA 42 303 303 ALA ALA D . n D 1 43 LEU 43 304 304 LEU LEU D . n D 1 44 GLY 44 305 305 GLY GLY D . n D 1 45 LEU 45 306 306 LEU LEU D . n D 1 46 HIS 46 307 307 HIS HIS D . n D 1 47 ASN 47 308 308 ASN ASN D . n D 1 48 TYR 48 309 309 TYR TYR D . n D 1 49 TYR 49 310 310 TYR TYR D . n D 1 50 ASP 50 311 311 ASP ASP D . n D 1 51 VAL 51 312 312 VAL VAL D . n D 1 52 VAL 52 313 313 VAL VAL D . n D 1 53 LYS 53 314 314 LYS LYS D . n D 1 54 ASN 54 315 315 ASN ASN D . n D 1 55 PRO 55 316 316 PRO PRO D . n D 1 56 MET 56 317 317 MET MET D . n D 1 57 ASP 57 318 318 ASP ASP D . n D 1 58 LEU 58 319 319 LEU LEU D . n D 1 59 GLY 59 320 320 GLY GLY D . n D 1 60 THR 60 321 321 THR THR D . n D 1 61 ILE 61 322 322 ILE ILE D . n D 1 62 LYS 62 323 323 LYS LYS D . n D 1 63 GLU 63 324 324 GLU GLU D . n D 1 64 LYS 64 325 325 LYS LYS D . n D 1 65 MET 65 326 326 MET MET D . n D 1 66 ASP 66 327 327 ASP ASP D . n D 1 67 ASN 67 328 328 ASN ASN D . n D 1 68 GLN 68 329 329 GLN GLN D . n D 1 69 GLU 69 330 330 GLU GLU D . n D 1 70 TYR 70 331 331 TYR TYR D . n D 1 71 LYS 71 332 332 LYS LYS D . n D 1 72 ASP 72 333 333 ASP ASP D . n D 1 73 ALA 73 334 334 ALA ALA D . n D 1 74 TYR 74 335 335 TYR TYR D . n D 1 75 LYS 75 336 336 LYS LYS D . n D 1 76 PHE 76 337 337 PHE PHE D . n D 1 77 ALA 77 338 338 ALA ALA D . n D 1 78 ALA 78 339 339 ALA ALA D . n D 1 79 ASP 79 340 340 ASP ASP D . n D 1 80 VAL 80 341 341 VAL VAL D . n D 1 81 ARG 81 342 342 ARG ARG D . n D 1 82 LEU 82 343 343 LEU LEU D . n D 1 83 MET 83 344 344 MET MET D . n D 1 84 PHE 84 345 345 PHE PHE D . n D 1 85 MET 85 346 346 MET MET D . n D 1 86 ASN 86 347 347 ASN ASN D . n D 1 87 CYS 87 348 348 CYS CYS D . n D 1 88 TYR 88 349 349 TYR TYR D . n D 1 89 LYS 89 350 350 LYS LYS D . n D 1 90 TYR 90 351 351 TYR TYR D . n D 1 91 ASN 91 352 352 ASN ASN D . n D 1 92 PRO 92 353 353 PRO PRO D . n D 1 93 PRO 93 354 354 PRO PRO D . n D 1 94 ASP 94 355 355 ASP ASP D . n D 1 95 HIS 95 356 356 HIS HIS D . n D 1 96 GLU 96 357 357 GLU GLU D . n D 1 97 VAL 97 358 358 VAL VAL D . n D 1 98 VAL 98 359 359 VAL VAL D . n D 1 99 THR 99 360 360 THR THR D . n D 1 100 MET 100 361 361 MET MET D . n D 1 101 ALA 101 362 362 ALA ALA D . n D 1 102 ARG 102 363 363 ARG ARG D . n D 1 103 MET 103 364 364 MET MET D . n D 1 104 LEU 104 365 365 LEU LEU D . n D 1 105 GLN 105 366 366 GLN GLN D . n D 1 106 ASP 106 367 367 ASP ASP D . n D 1 107 VAL 107 368 368 VAL VAL D . n D 1 108 PHE 108 369 369 PHE PHE D . n D 1 109 GLU 109 370 370 GLU GLU D . n D 1 110 THR 110 371 371 THR THR D . n D 1 111 HIS 111 372 372 HIS HIS D . n D 1 112 PHE 112 373 373 PHE PHE D . n D 1 113 SER 113 374 374 SER SER D . n D 1 114 LYS 114 375 375 LYS LYS D . n D 1 115 ILE 115 376 376 ILE ILE D . n D 1 116 PRO 116 377 377 PRO PRO D . n D 1 117 ILE 117 378 378 ILE ALA D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 VYJ 1 401 1 VYJ ERK A . F 2 VYJ 1 401 3 VYJ ERK B . G 3 CL 1 402 1 CL CL B . H 2 VYJ 1 401 2 VYJ ERK C . I 4 EDO 1 402 1 EDO EDO C . J 2 VYJ 1 401 4 VYJ ERK D . K 5 HOH 1 501 2 HOH HOH A . K 5 HOH 2 502 24 HOH HOH A . K 5 HOH 3 503 69 HOH HOH A . K 5 HOH 4 504 17 HOH HOH A . K 5 HOH 5 505 22 HOH HOH A . K 5 HOH 6 506 19 HOH HOH A . K 5 HOH 7 507 18 HOH HOH A . K 5 HOH 8 508 3 HOH HOH A . K 5 HOH 9 509 10 HOH HOH A . K 5 HOH 10 510 5 HOH HOH A . K 5 HOH 11 511 68 HOH HOH A . K 5 HOH 12 512 36 HOH HOH A . K 5 HOH 13 513 63 HOH HOH A . K 5 HOH 14 514 66 HOH HOH A . K 5 HOH 15 515 48 HOH HOH A . K 5 HOH 16 516 58 HOH HOH A . K 5 HOH 17 517 60 HOH HOH A . K 5 HOH 18 518 42 HOH HOH A . K 5 HOH 19 519 45 HOH HOH A . K 5 HOH 20 520 13 HOH HOH A . L 5 HOH 1 501 62 HOH HOH B . L 5 HOH 2 502 1 HOH HOH B . L 5 HOH 3 503 4 HOH HOH B . L 5 HOH 4 504 8 HOH HOH B . L 5 HOH 5 505 44 HOH HOH B . L 5 HOH 6 506 49 HOH HOH B . L 5 HOH 7 507 14 HOH HOH B . L 5 HOH 8 508 37 HOH HOH B . L 5 HOH 9 509 54 HOH HOH B . L 5 HOH 10 510 26 HOH HOH B . L 5 HOH 11 511 46 HOH HOH B . L 5 HOH 12 512 55 HOH HOH B . L 5 HOH 13 513 61 HOH HOH B . L 5 HOH 14 514 11 HOH HOH B . L 5 HOH 15 515 33 HOH HOH B . L 5 HOH 16 516 52 HOH HOH B . M 5 HOH 1 501 15 HOH HOH C . M 5 HOH 2 502 59 HOH HOH C . M 5 HOH 3 503 53 HOH HOH C . M 5 HOH 4 504 7 HOH HOH C . M 5 HOH 5 505 34 HOH HOH C . M 5 HOH 6 506 28 HOH HOH C . M 5 HOH 7 507 35 HOH HOH C . M 5 HOH 8 508 23 HOH HOH C . M 5 HOH 9 509 51 HOH HOH C . M 5 HOH 10 510 39 HOH HOH C . M 5 HOH 11 511 20 HOH HOH C . N 5 HOH 1 501 56 HOH HOH D . N 5 HOH 2 502 21 HOH HOH D . N 5 HOH 3 503 25 HOH HOH D . N 5 HOH 4 504 64 HOH HOH D . N 5 HOH 5 505 38 HOH HOH D . N 5 HOH 6 506 43 HOH HOH D . N 5 HOH 7 507 30 HOH HOH D . N 5 HOH 8 508 32 HOH HOH D . N 5 HOH 9 509 67 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E,K 2 1 B,F,G,L 3 1 C,H,I,M 4 1 D,J,N # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 402 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-14 2 'Structure model' 1 1 2021-11-17 3 'Structure model' 1 2 2021-11-24 4 'Structure model' 1 3 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_database_2.pdbx_DOI' 11 2 'Structure model' '_database_2.pdbx_database_accession' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -5.3771 -3.2391 17.4213 0.4904 ? 0.0275 ? 0.1036 ? 0.3717 ? -0.0730 ? 0.5468 ? 6.4422 ? -1.3637 ? 0.2330 ? 9.8007 ? -1.5658 ? 5.5242 ? -0.1776 ? -0.4665 ? 0.1328 ? 0.6923 ? 0.3489 ? 1.1258 ? -1.1645 ? -0.7165 ? -0.1667 ? 2 'X-RAY DIFFRACTION' ? refined 6.2485 -19.4376 16.0745 0.3211 ? 0.0511 ? -0.0901 ? 0.3070 ? -0.0237 ? 0.2611 ? 5.4422 ? -0.9934 ? 0.0257 ? 5.8939 ? -0.0641 ? 4.4096 ? -0.3267 ? -0.2922 ? -1.1594 ? 0.2707 ? 0.1885 ? -0.1253 ? -0.0569 ? 0.0805 ? -0.1561 ? 3 'X-RAY DIFFRACTION' ? refined 20.0750 -21.0024 3.7857 0.2220 ? -0.0326 ? 0.1295 ? 0.6567 ? -0.2028 ? 0.6926 ? 7.7416 ? 2.9268 ? 0.1081 ? 5.8095 ? -5.0383 ? 5.7328 ? -0.1162 ? 1.8843 ? -1.1987 ? -0.8561 ? 0.1295 ? -1.3650 ? 0.5337 ? 0.7126 ? 0.2462 ? 4 'X-RAY DIFFRACTION' ? refined 8.3419 -6.2534 9.2206 0.4266 ? -0.0793 ? -0.0310 ? 0.2944 ? -0.0372 ? 0.4347 ? 5.3586 ? -1.7845 ? -2.1256 ? 5.5582 ? 2.0398 ? 3.2773 ? -0.0615 ? -0.4396 ? 0.8900 ? 0.3622 ? 0.3457 ? -0.4372 ? -0.2799 ? 0.3652 ? -0.5371 ? 5 'X-RAY DIFFRACTION' ? refined -0.5317 -15.7103 6.6628 0.3546 ? -0.0257 ? -0.0420 ? 0.2602 ? -0.0013 ? 0.2011 ? 5.3449 ? -1.0106 ? -2.2163 ? 4.3354 ? 1.7044 ? 3.2339 ? 0.0786 ? -0.3122 ? -0.0542 ? -0.0873 ? 0.0135 ? 0.0216 ? -0.1304 ? 0.0398 ? 0.0651 ? 6 'X-RAY DIFFRACTION' ? refined -5.5284 -20.8352 38.9309 0.3771 ? 0.0009 ? 0.0259 ? 0.4598 ? -0.0246 ? 0.2447 ? 7.4339 ? -6.5758 ? 5.1526 ? 8.3909 ? -6.6837 ? 6.5685 ? -0.3704 ? -0.3138 ? 0.0983 ? 0.2570 ? 0.6002 ? 0.2779 ? -0.1425 ? -0.4027 ? -0.0273 ? 7 'X-RAY DIFFRACTION' ? refined 4.7710 -38.0702 44.6759 0.5162 ? 0.0513 ? -0.0516 ? 0.3738 ? 0.0938 ? 0.2604 ? 6.9365 ? -3.1689 ? 0.5401 ? 6.9168 ? 0.8068 ? 3.1691 ? 0.3053 ? -1.0899 ? -0.4038 ? 0.7276 ? 0.2163 ? 0.2948 ? 0.6735 ? -0.2198 ? -0.4299 ? 8 'X-RAY DIFFRACTION' ? refined 23.4254 -39.2814 43.5369 0.3975 ? 0.0477 ? -0.1329 ? 0.5197 ? 0.0400 ? 0.7834 ? 5.0796 ? 3.5968 ? -0.8539 ? 5.9351 ? -6.0681 ? 8.9550 ? -0.5667 ? 0.0777 ? 0.2146 ? 0.1350 ? -0.7678 ? -2.1716 ? -0.0226 ? 2.2700 ? 1.2516 ? 9 'X-RAY DIFFRACTION' ? refined 6.9780 -30.6553 36.0036 0.3525 ? -0.0281 ? -0.0322 ? 0.3892 ? 0.0710 ? 0.3078 ? 6.1450 ? -2.9339 ? 1.6876 ? 3.6929 ? 0.1853 ? 2.5516 ? 0.1240 ? -0.2328 ? 0.1020 ? 0.2947 ? -0.0657 ? -0.3773 ? 0.0088 ? 0.0804 ? -0.0352 ? 10 'X-RAY DIFFRACTION' ? refined 36.3615 -11.9492 15.7697 0.4074 ? -0.0760 ? -0.1397 ? 0.4667 ? -0.0093 ? 0.7920 ? 4.3392 ? -0.7626 ? 0.0350 ? 4.5204 ? -0.1747 ? 3.6359 ? -0.1638 ? -0.7015 ? 0.0183 ? 0.2325 ? 0.3068 ? -1.6233 ? -0.1040 ? 0.6601 ? 0.0123 ? 11 'X-RAY DIFFRACTION' ? refined 16.0229 -1.9477 4.1223 0.4497 ? 0.0371 ? -0.2090 ? 0.5399 ? 0.0971 ? 0.4858 ? 7.4032 ? 3.3113 ? -4.3483 ? 6.0748 ? 1.7063 ? 5.4596 ? -0.4846 ? 2.2907 ? 1.1685 ? -2.1738 ? -0.0042 ? 1.3043 ? -0.8344 ? -1.2873 ? 0.0680 ? 12 'X-RAY DIFFRACTION' ? refined 33.7218 -10.8410 6.5875 0.4876 ? -0.1164 ? 0.0438 ? 0.3376 ? -0.0686 ? 0.6496 ? 5.7395 ? -1.8800 ? 0.7619 ? 7.5113 ? -2.3664 ? 5.3207 ? -0.0111 ? 0.1429 ? -0.4866 ? -0.3541 ? 0.0223 ? -1.3583 ? 0.1257 ? 0.3511 ? 0.0288 ? 13 'X-RAY DIFFRACTION' ? refined 3.6183 -42.4647 14.4336 0.5576 ? -0.1005 ? -0.2022 ? 0.4598 ? 0.1251 ? 0.6159 ? 2.2249 ? 3.0189 ? -1.9599 ? 7.0616 ? -1.3565 ? 2.2122 ? 0.1883 ? -0.0701 ? -0.6556 ? -0.6681 ? 0.0850 ? 0.6694 ? 0.3208 ? -0.2513 ? -0.3342 ? 14 'X-RAY DIFFRACTION' ? refined 7.3956 -42.5854 20.7301 0.3825 ? -0.0239 ? -0.1319 ? 0.3406 ? 0.1071 ? 0.5109 ? 3.6158 ? 0.9630 ? -0.4093 ? 5.0320 ? -1.9046 ? 4.7264 ? 0.1381 ? -0.1435 ? -0.6484 ? -0.2374 ? 0.2718 ? 0.4882 ? 0.6560 ? -0.2301 ? -0.3547 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 266 ? ? ? A 284 ? ? ;chain 'A' and (resid 266 through 284 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 285 ? ? ? A 300 ? ? ;chain 'A' and (resid 285 through 300 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 301 ? ? ? A 308 ? ? ;chain 'A' and (resid 301 through 308 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 309 ? ? ? A 333 ? ? ;chain 'A' and (resid 309 through 333 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 334 ? ? ? A 377 ? ? ;chain 'A' and (resid 334 through 377 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 263 ? ? ? B 284 ? ? ;chain 'B' and (resid 263 through 284 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 285 ? ? ? B 300 ? ? ;chain 'B' and (resid 285 through 300 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 301 ? ? ? B 308 ? ? ;chain 'B' and (resid 301 through 308 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 309 ? ? ? B 378 ? ? ;chain 'B' and (resid 309 through 378 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? C 267 ? ? ? C 300 ? ? ;chain 'C' and (resid 267 through 300 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? C 301 ? ? ? C 308 ? ? ;chain 'C' and (resid 301 through 308 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? C 309 ? ? ? C 378 ? ? ;chain 'C' and (resid 309 through 378 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? D 265 ? ? ? D 308 ? ? ;chain 'D' and (resid 265 through 308 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? D 309 ? ? ? D 378 ? ? ;chain 'D' and (resid 309 through 378 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19_4085 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7LEK _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 267 ? ? OG1 A THR 270 ? ? 2.11 2 1 NZ D LYS 314 ? ? O D HOH 501 ? ? 2.12 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 273 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 273 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 273 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 98.94 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -12.06 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 306 ? ? -103.02 78.09 2 1 ALA B 264 ? ? 68.76 -56.88 3 1 ALA B 285 ? ? -59.21 170.96 4 1 ASN B 308 ? ? -152.60 35.42 5 1 ALA C 285 ? ? -58.26 170.12 6 1 LEU C 306 ? ? -102.69 78.95 7 1 LEU D 306 ? ? -103.37 77.50 8 1 ASN D 308 ? ? 59.50 4.66 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 336 ? CG ? A LYS 75 CG 2 1 Y 1 A LYS 336 ? CD ? A LYS 75 CD 3 1 Y 1 A LYS 336 ? CE ? A LYS 75 CE 4 1 Y 1 A LYS 336 ? NZ ? A LYS 75 NZ 5 1 Y 1 C LYS 332 ? CG ? C LYS 71 CG 6 1 Y 1 C LYS 332 ? CD ? C LYS 71 CD 7 1 Y 1 C LYS 332 ? CE ? C LYS 71 CE 8 1 Y 1 C LYS 332 ? NZ ? C LYS 71 NZ 9 1 Y 1 C LYS 336 ? CG ? C LYS 75 CG 10 1 Y 1 C LYS 336 ? CD ? C LYS 75 CD 11 1 Y 1 C LYS 336 ? CE ? C LYS 75 CE 12 1 Y 1 C LYS 336 ? NZ ? C LYS 75 NZ 13 1 Y 1 D LYS 323 ? CG ? D LYS 62 CG 14 1 Y 1 D LYS 323 ? CD ? D LYS 62 CD 15 1 Y 1 D LYS 323 ? CE ? D LYS 62 CE 16 1 Y 1 D LYS 323 ? NZ ? D LYS 62 NZ 17 1 Y 1 D ILE 378 ? CG1 ? D ILE 117 CG1 18 1 Y 1 D ILE 378 ? CG2 ? D ILE 117 CG2 19 1 Y 1 D ILE 378 ? CD1 ? D ILE 117 CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 262 ? A GLY 1 2 1 Y 1 A ALA 263 ? A ALA 2 3 1 Y 1 A ALA 264 ? A ALA 3 4 1 Y 1 A SER 265 ? A SER 4 5 1 Y 1 A ILE 378 ? A ILE 117 6 1 Y 1 B GLY 262 ? B GLY 1 7 1 Y 1 C GLY 262 ? C GLY 1 8 1 Y 1 C ALA 263 ? C ALA 2 9 1 Y 1 C ALA 264 ? C ALA 3 10 1 Y 1 C SER 265 ? C SER 4 11 1 Y 1 C THR 266 ? C THR 5 12 1 Y 1 D GLY 262 ? D GLY 1 13 1 Y 1 D ALA 263 ? D ALA 2 14 1 Y 1 D ALA 264 ? D ALA 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 EDO C1 C N N 89 EDO O1 O N N 90 EDO C2 C N N 91 EDO O2 O N N 92 EDO H11 H N N 93 EDO H12 H N N 94 EDO HO1 H N N 95 EDO H21 H N N 96 EDO H22 H N N 97 EDO HO2 H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PRO N N N N 284 PRO CA C N S 285 PRO C C N N 286 PRO O O N N 287 PRO CB C N N 288 PRO CG C N N 289 PRO CD C N N 290 PRO OXT O N N 291 PRO H H N N 292 PRO HA H N N 293 PRO HB2 H N N 294 PRO HB3 H N N 295 PRO HG2 H N N 296 PRO HG3 H N N 297 PRO HD2 H N N 298 PRO HD3 H N N 299 PRO HXT H N N 300 SER N N N N 301 SER CA C N S 302 SER C C N N 303 SER O O N N 304 SER CB C N N 305 SER OG O N N 306 SER OXT O N N 307 SER H H N N 308 SER H2 H N N 309 SER HA H N N 310 SER HB2 H N N 311 SER HB3 H N N 312 SER HG H N N 313 SER HXT H N N 314 THR N N N N 315 THR CA C N S 316 THR C C N N 317 THR O O N N 318 THR CB C N R 319 THR OG1 O N N 320 THR CG2 C N N 321 THR OXT O N N 322 THR H H N N 323 THR H2 H N N 324 THR HA H N N 325 THR HB H N N 326 THR HG1 H N N 327 THR HG21 H N N 328 THR HG22 H N N 329 THR HG23 H N N 330 THR HXT H N N 331 TRP N N N N 332 TRP CA C N S 333 TRP C C N N 334 TRP O O N N 335 TRP CB C N N 336 TRP CG C Y N 337 TRP CD1 C Y N 338 TRP CD2 C Y N 339 TRP NE1 N Y N 340 TRP CE2 C Y N 341 TRP CE3 C Y N 342 TRP CZ2 C Y N 343 TRP CZ3 C Y N 344 TRP CH2 C Y N 345 TRP OXT O N N 346 TRP H H N N 347 TRP H2 H N N 348 TRP HA H N N 349 TRP HB2 H N N 350 TRP HB3 H N N 351 TRP HD1 H N N 352 TRP HE1 H N N 353 TRP HE3 H N N 354 TRP HZ2 H N N 355 TRP HZ3 H N N 356 TRP HH2 H N N 357 TRP HXT H N N 358 TYR N N N N 359 TYR CA C N S 360 TYR C C N N 361 TYR O O N N 362 TYR CB C N N 363 TYR CG C Y N 364 TYR CD1 C Y N 365 TYR CD2 C Y N 366 TYR CE1 C Y N 367 TYR CE2 C Y N 368 TYR CZ C Y N 369 TYR OH O N N 370 TYR OXT O N N 371 TYR H H N N 372 TYR H2 H N N 373 TYR HA H N N 374 TYR HB2 H N N 375 TYR HB3 H N N 376 TYR HD1 H N N 377 TYR HD2 H N N 378 TYR HE1 H N N 379 TYR HE2 H N N 380 TYR HH H N N 381 TYR HXT H N N 382 VAL N N N N 383 VAL CA C N S 384 VAL C C N N 385 VAL O O N N 386 VAL CB C N N 387 VAL CG1 C N N 388 VAL CG2 C N N 389 VAL OXT O N N 390 VAL H H N N 391 VAL H2 H N N 392 VAL HA H N N 393 VAL HB H N N 394 VAL HG11 H N N 395 VAL HG12 H N N 396 VAL HG13 H N N 397 VAL HG21 H N N 398 VAL HG22 H N N 399 VAL HG23 H N N 400 VAL HXT H N N 401 VYJ C13 C N N 402 VYJ C15 C N N 403 VYJ C20 C N N 404 VYJ C21 C N N 405 VYJ C22 C N N 406 VYJ C24 C Y N 407 VYJ C26 C Y N 408 VYJ C28 C Y N 409 VYJ C01 C N N 410 VYJ C02 C N N 411 VYJ C04 C Y N 412 VYJ C05 C Y N 413 VYJ C06 C Y N 414 VYJ C07 C Y N 415 VYJ C08 C Y N 416 VYJ C09 C N N 417 VYJ C11 C N N 418 VYJ C12 C N N 419 VYJ C16 C N N 420 VYJ C18 C N N 421 VYJ C19 C N N 422 VYJ C29 C Y N 423 VYJ C31 C N N 424 VYJ C32 C Y N 425 VYJ C33 C Y N 426 VYJ C35 C Y N 427 VYJ C37 C N N 428 VYJ C38 C N N 429 VYJ C39 C N N 430 VYJ C40 C N N 431 VYJ C41 C N N 432 VYJ C42 C Y N 433 VYJ C43 C Y N 434 VYJ C44 C Y N 435 VYJ C45 C Y N 436 VYJ C47 C N N 437 VYJ N10 N N N 438 VYJ N14 N N N 439 VYJ N17 N N N 440 VYJ N25 N N N 441 VYJ N27 N Y N 442 VYJ N30 N N N 443 VYJ N34 N N N 444 VYJ N36 N Y N 445 VYJ O03 O N N 446 VYJ O23 O N N 447 VYJ O46 O N N 448 VYJ H1 H N N 449 VYJ H2 H N N 450 VYJ H3 H N N 451 VYJ H4 H N N 452 VYJ H5 H N N 453 VYJ H6 H N N 454 VYJ H7 H N N 455 VYJ H8 H N N 456 VYJ H9 H N N 457 VYJ H10 H N N 458 VYJ H11 H N N 459 VYJ H12 H N N 460 VYJ H13 H N N 461 VYJ H14 H N N 462 VYJ H15 H N N 463 VYJ H16 H N N 464 VYJ H17 H N N 465 VYJ H18 H N N 466 VYJ H19 H N N 467 VYJ H20 H N N 468 VYJ H21 H N N 469 VYJ H22 H N N 470 VYJ H23 H N N 471 VYJ H24 H N N 472 VYJ H25 H N N 473 VYJ H26 H N N 474 VYJ H27 H N N 475 VYJ H28 H N N 476 VYJ H29 H N N 477 VYJ H30 H N N 478 VYJ H31 H N N 479 VYJ H32 H N N 480 VYJ H33 H N N 481 VYJ H34 H N N 482 VYJ H35 H N N 483 VYJ H36 H N N 484 VYJ H37 H N N 485 VYJ H38 H N N 486 VYJ H39 H N N 487 VYJ H40 H N N 488 VYJ H41 H N N 489 VYJ H42 H N N 490 VYJ H43 H N N 491 VYJ H44 H N N 492 VYJ H45 H N N 493 VYJ H48 H N N 494 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 VYJ C21 C22 sing N N 385 VYJ C21 C13 sing N N 386 VYJ C22 N10 sing N N 387 VYJ C18 C19 sing N N 388 VYJ C18 N17 sing N N 389 VYJ C20 N17 sing N N 390 VYJ N14 C19 sing N N 391 VYJ N14 C13 sing N N 392 VYJ N14 C15 sing N N 393 VYJ C16 N17 sing N N 394 VYJ C16 C15 sing N N 395 VYJ C13 C12 sing N N 396 VYJ O23 C09 doub N N 397 VYJ N10 C09 sing N N 398 VYJ N10 C11 sing N N 399 VYJ C09 C08 sing N N 400 VYJ C12 C11 sing N N 401 VYJ C08 C07 doub Y N 402 VYJ C08 C24 sing Y N 403 VYJ C39 C40 sing N N 404 VYJ C39 C38 sing N N 405 VYJ C40 C41 sing N N 406 VYJ C07 C06 sing Y N 407 VYJ C24 C04 doub Y N 408 VYJ C41 C37 sing N N 409 VYJ C38 C37 sing N N 410 VYJ C06 C05 doub Y N 411 VYJ C04 C05 sing Y N 412 VYJ C04 O03 sing N N 413 VYJ C02 O03 sing N N 414 VYJ C02 C01 sing N N 415 VYJ C37 N34 sing N N 416 VYJ C05 N25 sing N N 417 VYJ N25 C26 sing N N 418 VYJ N34 C35 sing N N 419 VYJ N34 C33 sing N N 420 VYJ N36 C26 doub Y N 421 VYJ N36 C35 sing Y N 422 VYJ C42 C33 doub Y N 423 VYJ C42 C43 sing Y N 424 VYJ C26 N27 sing Y N 425 VYJ C35 C29 doub Y N 426 VYJ C33 C32 sing Y N 427 VYJ C43 C44 doub Y N 428 VYJ N27 C28 doub Y N 429 VYJ C29 C28 sing Y N 430 VYJ C29 N30 sing N N 431 VYJ C32 C31 sing N N 432 VYJ C32 C45 doub Y N 433 VYJ C44 C45 sing Y N 434 VYJ N30 C31 sing N N 435 VYJ N30 C47 sing N N 436 VYJ C31 O46 doub N N 437 VYJ C13 H1 sing N N 438 VYJ C15 H2 sing N N 439 VYJ C15 H3 sing N N 440 VYJ C20 H4 sing N N 441 VYJ C20 H5 sing N N 442 VYJ C20 H6 sing N N 443 VYJ C21 H7 sing N N 444 VYJ C21 H8 sing N N 445 VYJ C22 H9 sing N N 446 VYJ C22 H10 sing N N 447 VYJ C24 H11 sing N N 448 VYJ C28 H12 sing N N 449 VYJ C01 H13 sing N N 450 VYJ C01 H14 sing N N 451 VYJ C01 H15 sing N N 452 VYJ C02 H16 sing N N 453 VYJ C02 H17 sing N N 454 VYJ C06 H18 sing N N 455 VYJ C07 H19 sing N N 456 VYJ C11 H20 sing N N 457 VYJ C11 H21 sing N N 458 VYJ C12 H22 sing N N 459 VYJ C12 H23 sing N N 460 VYJ C16 H24 sing N N 461 VYJ C16 H25 sing N N 462 VYJ C18 H26 sing N N 463 VYJ C18 H27 sing N N 464 VYJ C19 H28 sing N N 465 VYJ C19 H29 sing N N 466 VYJ C37 H30 sing N N 467 VYJ C38 H31 sing N N 468 VYJ C38 H32 sing N N 469 VYJ C39 H33 sing N N 470 VYJ C39 H34 sing N N 471 VYJ C40 H35 sing N N 472 VYJ C40 H36 sing N N 473 VYJ C41 H37 sing N N 474 VYJ C41 H38 sing N N 475 VYJ C42 H39 sing N N 476 VYJ C43 H40 sing N N 477 VYJ C44 H41 sing N N 478 VYJ C45 H42 sing N N 479 VYJ C47 H43 sing N N 480 VYJ C47 H44 sing N N 481 VYJ C47 H45 sing N N 482 VYJ N25 H48 sing N N 483 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id VYJ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id VYJ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;11-cyclopentyl-2-({2-ethoxy-4-[4-(4-methylpiperazin-1-yl)piperidine-1-carbonyl]phenyl}amino)-5-methyl-5,11-dihydro-6H-pyrimido[4,5-b][1,4]benzodiazepin-6-one ; VYJ 3 'CHLORIDE ION' CL 4 1,2-ETHANEDIOL EDO 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3VBQ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #