data_7LX4 # _entry.id 7LX4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7LX4 pdb_00007lx4 10.2210/pdb7lx4/pdb WWPDB D_1000254967 ? ? BMRB 30873 ? 10.13018/BMR30873 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-03 2 'Structure model' 1 1 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7LX4 _pdbx_database_status.recvd_initial_deposition_date 2021-03-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 7LRW 7LRW unspecified PDB 7LT7 7LT7 unspecified BMRB 'Structure of Hact-SCRiP1' 30873 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schmidt, C.A.' 1 0000-0001-5821-1124 'Daly, N.L.' 2 0000-0002-4697-6602 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Diversity of coral derived peptides' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schmidt, C.A.' 1 0000-0001-5821-1124 primary 'Daly, N.L.' 2 0000-0002-4697-6602 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description Hact-SCRiP1 _entity.formula_weight 4583.381 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)SEFCGHDVGECVPPKLVCRPPTHECLHFPCPGYLKCCCYP' _entity_poly.pdbx_seq_one_letter_code_can QSEFCGHDVGECVPPKLVCRPPTHECLHFPCPGYLKCCCYP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 SER n 1 3 GLU n 1 4 PHE n 1 5 CYS n 1 6 GLY n 1 7 HIS n 1 8 ASP n 1 9 VAL n 1 10 GLY n 1 11 GLU n 1 12 CYS n 1 13 VAL n 1 14 PRO n 1 15 PRO n 1 16 LYS n 1 17 LEU n 1 18 VAL n 1 19 CYS n 1 20 ARG n 1 21 PRO n 1 22 PRO n 1 23 THR n 1 24 HIS n 1 25 GLU n 1 26 CYS n 1 27 LEU n 1 28 HIS n 1 29 PHE n 1 30 PRO n 1 31 CYS n 1 32 PRO n 1 33 GLY n 1 34 TYR n 1 35 LEU n 1 36 LYS n 1 37 CYS n 1 38 CYS n 1 39 CYS n 1 40 TYR n 1 41 PRO n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 41 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Heliofungia actiniformis' _entity_src_nat.pdbx_ncbi_taxonomy_id 75303 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 PRO 41 41 41 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7LX4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7LX4 _struct.title 'Structure of Hact-SCRiP1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7LX4 _struct_keywords.text 'UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7LX4 _struct_ref.pdbx_db_accession 7LX4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7LX4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 41 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7LX4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 41 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 41 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 5 A CYS 37 1_555 ? ? ? ? ? ? ? 1.999 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 12 A CYS 31 1_555 ? ? ? ? ? ? ? 1.977 ? ? disulf3 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 19 A CYS 38 1_555 ? ? ? ? ? ? ? 1.980 ? ? disulf4 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 26 A CYS 39 1_555 ? ? ? ? ? ? ? 1.984 ? ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A SER 2 N ? ? A PCA 1 A SER 2 1_555 ? ? ? ? ? ? ? 1.329 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PCA A 1 ? . . . . PCA A 1 ? 1_555 . . . . . . . GLN 1 PCA 'Pyrrolidone carboxylic acid' 'Named protein modification' 2 CYS A 5 ? CYS A 37 ? CYS A 5 ? 1_555 CYS A 37 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 12 ? CYS A 31 ? CYS A 12 ? 1_555 CYS A 31 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 19 ? CYS A 38 ? CYS A 19 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 26 ? CYS A 39 ? CYS A 26 ? 1_555 CYS A 39 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 10 ? VAL A 13 ? GLY A 10 VAL A 13 AA1 2 LYS A 36 ? CYS A 39 ? LYS A 36 CYS A 39 AA1 3 HIS A 24 ? GLU A 25 ? HIS A 24 GLU A 25 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 13 ? N VAL A 13 O LYS A 36 ? O LYS A 36 AA1 2 3 O CYS A 39 ? O CYS A 39 N HIS A 24 ? N HIS A 24 # _pdbx_entry_details.entry_id 7LX4 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 7 ? ? -133.68 -74.56 2 1 PRO A 22 ? ? -69.74 67.33 3 1 GLU A 25 ? ? -59.22 102.02 4 1 PRO A 30 ? ? -69.81 95.79 5 2 HIS A 7 ? ? -136.64 -51.04 6 2 PRO A 22 ? ? -69.78 66.78 7 2 GLU A 25 ? ? -58.66 101.71 8 2 HIS A 28 ? ? -108.76 -71.64 9 3 HIS A 7 ? ? -130.98 -40.57 10 3 CYS A 19 ? ? -59.27 110.00 11 3 PRO A 22 ? ? -69.72 66.69 12 3 HIS A 28 ? ? -107.73 -64.01 13 4 SER A 2 ? ? -117.29 65.60 14 4 HIS A 7 ? ? -125.85 -58.58 15 4 CYS A 19 ? ? -54.10 109.44 16 4 PRO A 22 ? ? -69.75 66.67 17 4 HIS A 28 ? ? -139.26 -43.27 18 4 PRO A 30 ? ? -69.77 76.99 19 5 CYS A 19 ? ? -57.11 109.58 20 5 PRO A 22 ? ? -69.76 67.42 21 5 HIS A 28 ? ? -139.56 -41.99 22 5 PRO A 30 ? ? -69.79 84.42 23 6 HIS A 7 ? ? -153.60 -51.62 24 6 PRO A 22 ? ? -69.71 66.67 25 6 PRO A 30 ? ? -69.75 78.70 26 7 SER A 2 ? ? -116.81 79.54 27 7 CYS A 19 ? ? -52.00 109.86 28 7 PRO A 22 ? ? -69.74 66.53 29 7 GLU A 25 ? ? -64.50 99.78 30 7 HIS A 28 ? ? -120.96 -62.55 31 8 HIS A 7 ? ? -133.94 -41.62 32 8 CYS A 19 ? ? -56.91 109.95 33 8 PRO A 22 ? ? -69.73 67.40 34 8 GLU A 25 ? ? -56.19 109.44 35 8 PRO A 30 ? ? -69.79 81.94 36 9 HIS A 7 ? ? -129.04 -50.84 37 9 PRO A 22 ? ? -69.76 67.43 38 9 HIS A 28 ? ? -131.59 -45.17 39 9 PRO A 30 ? ? -69.77 81.55 40 10 HIS A 7 ? ? -71.59 -168.13 41 10 CYS A 19 ? ? -51.02 108.80 42 10 PRO A 22 ? ? -69.72 67.20 43 10 GLU A 25 ? ? -52.58 108.69 44 10 HIS A 28 ? ? -130.58 -75.68 45 10 PRO A 30 ? ? -69.73 90.17 46 11 HIS A 7 ? ? -136.59 -58.09 47 11 ASP A 8 ? ? -60.15 -73.84 48 11 PRO A 22 ? ? -69.72 67.69 49 11 HIS A 28 ? ? -101.04 -76.44 50 11 PRO A 30 ? ? -69.75 82.60 51 12 CYS A 19 ? ? -58.92 109.88 52 12 PRO A 22 ? ? -69.73 67.10 53 12 GLU A 25 ? ? -57.20 108.98 54 12 PRO A 30 ? ? -69.76 98.36 55 13 HIS A 7 ? ? -137.25 -47.13 56 13 CYS A 19 ? ? -54.92 109.82 57 13 PRO A 22 ? ? -69.72 66.88 58 13 HIS A 28 ? ? -136.56 -40.90 59 13 PRO A 30 ? ? -69.72 83.43 60 14 HIS A 7 ? ? -61.82 -166.44 61 14 CYS A 19 ? ? -51.54 109.79 62 14 PRO A 22 ? ? -69.67 67.03 63 14 HIS A 28 ? ? -123.45 -55.28 64 14 PRO A 30 ? ? -69.76 91.79 65 15 PRO A 22 ? ? -69.78 67.54 66 15 GLU A 25 ? ? -65.58 99.09 67 15 HIS A 28 ? ? -128.19 -73.45 68 15 PRO A 30 ? ? -69.77 80.38 69 16 SER A 2 ? ? -100.97 50.09 70 16 HIS A 7 ? ? -137.33 -65.91 71 16 CYS A 19 ? ? -52.91 109.56 72 16 PRO A 22 ? ? -69.76 66.41 73 16 GLU A 25 ? ? -57.66 99.00 74 17 HIS A 7 ? ? -134.58 -70.32 75 17 PRO A 22 ? ? -69.80 67.43 76 17 HIS A 28 ? ? -110.89 -74.66 77 17 PRO A 30 ? ? -69.75 94.81 78 18 HIS A 7 ? ? -134.05 -55.66 79 18 PRO A 22 ? ? -69.69 67.18 80 18 GLU A 25 ? ? -57.10 104.29 81 18 HIS A 28 ? ? -139.37 -48.22 82 18 PRO A 30 ? ? -69.76 96.51 83 19 SER A 2 ? ? -99.41 37.88 84 19 HIS A 7 ? ? -126.50 -67.77 85 19 CYS A 19 ? ? -55.97 108.51 86 19 PRO A 22 ? ? -69.70 0.05 87 19 HIS A 28 ? ? -116.12 -71.72 88 20 HIS A 7 ? ? -140.21 -43.28 89 20 CYS A 19 ? ? -53.04 108.15 90 20 PRO A 22 ? ? -69.69 0.45 91 20 THR A 23 ? ? -47.85 163.42 92 20 HIS A 28 ? ? -123.31 -52.01 93 20 PRO A 30 ? ? -69.87 94.41 # _pdbx_nmr_ensemble.entry_id 7LX4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7LX4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM Hact-SCRiP1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component Hact-SCRiP1 _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 290 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-13C HSQC' 1 isotropic 4 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 7LX4 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 'data analysis' 'CcpNmr Analysis' ? CCPN 3 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 4 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASP N N N N 28 ASP CA C N S 29 ASP C C N N 30 ASP O O N N 31 ASP CB C N N 32 ASP CG C N N 33 ASP OD1 O N N 34 ASP OD2 O N N 35 ASP OXT O N N 36 ASP H H N N 37 ASP H2 H N N 38 ASP HA H N N 39 ASP HB2 H N N 40 ASP HB3 H N N 41 ASP HD2 H N N 42 ASP HXT H N N 43 CYS N N N N 44 CYS CA C N R 45 CYS C C N N 46 CYS O O N N 47 CYS CB C N N 48 CYS SG S N N 49 CYS OXT O N N 50 CYS H H N N 51 CYS H2 H N N 52 CYS HA H N N 53 CYS HB2 H N N 54 CYS HB3 H N N 55 CYS HG H N N 56 CYS HXT H N N 57 GLU N N N N 58 GLU CA C N S 59 GLU C C N N 60 GLU O O N N 61 GLU CB C N N 62 GLU CG C N N 63 GLU CD C N N 64 GLU OE1 O N N 65 GLU OE2 O N N 66 GLU OXT O N N 67 GLU H H N N 68 GLU H2 H N N 69 GLU HA H N N 70 GLU HB2 H N N 71 GLU HB3 H N N 72 GLU HG2 H N N 73 GLU HG3 H N N 74 GLU HE2 H N N 75 GLU HXT H N N 76 GLY N N N N 77 GLY CA C N N 78 GLY C C N N 79 GLY O O N N 80 GLY OXT O N N 81 GLY H H N N 82 GLY H2 H N N 83 GLY HA2 H N N 84 GLY HA3 H N N 85 GLY HXT H N N 86 HIS N N N N 87 HIS CA C N S 88 HIS C C N N 89 HIS O O N N 90 HIS CB C N N 91 HIS CG C Y N 92 HIS ND1 N Y N 93 HIS CD2 C Y N 94 HIS CE1 C Y N 95 HIS NE2 N Y N 96 HIS OXT O N N 97 HIS H H N N 98 HIS H2 H N N 99 HIS HA H N N 100 HIS HB2 H N N 101 HIS HB3 H N N 102 HIS HD1 H N N 103 HIS HD2 H N N 104 HIS HE1 H N N 105 HIS HE2 H N N 106 HIS HXT H N N 107 LEU N N N N 108 LEU CA C N S 109 LEU C C N N 110 LEU O O N N 111 LEU CB C N N 112 LEU CG C N N 113 LEU CD1 C N N 114 LEU CD2 C N N 115 LEU OXT O N N 116 LEU H H N N 117 LEU H2 H N N 118 LEU HA H N N 119 LEU HB2 H N N 120 LEU HB3 H N N 121 LEU HG H N N 122 LEU HD11 H N N 123 LEU HD12 H N N 124 LEU HD13 H N N 125 LEU HD21 H N N 126 LEU HD22 H N N 127 LEU HD23 H N N 128 LEU HXT H N N 129 LYS N N N N 130 LYS CA C N S 131 LYS C C N N 132 LYS O O N N 133 LYS CB C N N 134 LYS CG C N N 135 LYS CD C N N 136 LYS CE C N N 137 LYS NZ N N N 138 LYS OXT O N N 139 LYS H H N N 140 LYS H2 H N N 141 LYS HA H N N 142 LYS HB2 H N N 143 LYS HB3 H N N 144 LYS HG2 H N N 145 LYS HG3 H N N 146 LYS HD2 H N N 147 LYS HD3 H N N 148 LYS HE2 H N N 149 LYS HE3 H N N 150 LYS HZ1 H N N 151 LYS HZ2 H N N 152 LYS HZ3 H N N 153 LYS HXT H N N 154 PCA N N N N 155 PCA CA C N S 156 PCA CB C N N 157 PCA CG C N N 158 PCA CD C N N 159 PCA OE O N N 160 PCA C C N N 161 PCA O O N N 162 PCA OXT O N N 163 PCA H H N N 164 PCA HA H N N 165 PCA HB2 H N N 166 PCA HB3 H N N 167 PCA HG2 H N N 168 PCA HG3 H N N 169 PCA HXT H N N 170 PHE N N N N 171 PHE CA C N S 172 PHE C C N N 173 PHE O O N N 174 PHE CB C N N 175 PHE CG C Y N 176 PHE CD1 C Y N 177 PHE CD2 C Y N 178 PHE CE1 C Y N 179 PHE CE2 C Y N 180 PHE CZ C Y N 181 PHE OXT O N N 182 PHE H H N N 183 PHE H2 H N N 184 PHE HA H N N 185 PHE HB2 H N N 186 PHE HB3 H N N 187 PHE HD1 H N N 188 PHE HD2 H N N 189 PHE HE1 H N N 190 PHE HE2 H N N 191 PHE HZ H N N 192 PHE HXT H N N 193 PRO N N N N 194 PRO CA C N S 195 PRO C C N N 196 PRO O O N N 197 PRO CB C N N 198 PRO CG C N N 199 PRO CD C N N 200 PRO OXT O N N 201 PRO H H N N 202 PRO HA H N N 203 PRO HB2 H N N 204 PRO HB3 H N N 205 PRO HG2 H N N 206 PRO HG3 H N N 207 PRO HD2 H N N 208 PRO HD3 H N N 209 PRO HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TYR N N N N 242 TYR CA C N S 243 TYR C C N N 244 TYR O O N N 245 TYR CB C N N 246 TYR CG C Y N 247 TYR CD1 C Y N 248 TYR CD2 C Y N 249 TYR CE1 C Y N 250 TYR CE2 C Y N 251 TYR CZ C Y N 252 TYR OH O N N 253 TYR OXT O N N 254 TYR H H N N 255 TYR H2 H N N 256 TYR HA H N N 257 TYR HB2 H N N 258 TYR HB3 H N N 259 TYR HD1 H N N 260 TYR HD2 H N N 261 TYR HE1 H N N 262 TYR HE2 H N N 263 TYR HH H N N 264 TYR HXT H N N 265 VAL N N N N 266 VAL CA C N S 267 VAL C C N N 268 VAL O O N N 269 VAL CB C N N 270 VAL CG1 C N N 271 VAL CG2 C N N 272 VAL OXT O N N 273 VAL H H N N 274 VAL H2 H N N 275 VAL HA H N N 276 VAL HB H N N 277 VAL HG11 H N N 278 VAL HG12 H N N 279 VAL HG13 H N N 280 VAL HG21 H N N 281 VAL HG22 H N N 282 VAL HG23 H N N 283 VAL HXT H N N 284 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASP N CA sing N N 27 ASP N H sing N N 28 ASP N H2 sing N N 29 ASP CA C sing N N 30 ASP CA CB sing N N 31 ASP CA HA sing N N 32 ASP C O doub N N 33 ASP C OXT sing N N 34 ASP CB CG sing N N 35 ASP CB HB2 sing N N 36 ASP CB HB3 sing N N 37 ASP CG OD1 doub N N 38 ASP CG OD2 sing N N 39 ASP OD2 HD2 sing N N 40 ASP OXT HXT sing N N 41 CYS N CA sing N N 42 CYS N H sing N N 43 CYS N H2 sing N N 44 CYS CA C sing N N 45 CYS CA CB sing N N 46 CYS CA HA sing N N 47 CYS C O doub N N 48 CYS C OXT sing N N 49 CYS CB SG sing N N 50 CYS CB HB2 sing N N 51 CYS CB HB3 sing N N 52 CYS SG HG sing N N 53 CYS OXT HXT sing N N 54 GLU N CA sing N N 55 GLU N H sing N N 56 GLU N H2 sing N N 57 GLU CA C sing N N 58 GLU CA CB sing N N 59 GLU CA HA sing N N 60 GLU C O doub N N 61 GLU C OXT sing N N 62 GLU CB CG sing N N 63 GLU CB HB2 sing N N 64 GLU CB HB3 sing N N 65 GLU CG CD sing N N 66 GLU CG HG2 sing N N 67 GLU CG HG3 sing N N 68 GLU CD OE1 doub N N 69 GLU CD OE2 sing N N 70 GLU OE2 HE2 sing N N 71 GLU OXT HXT sing N N 72 GLY N CA sing N N 73 GLY N H sing N N 74 GLY N H2 sing N N 75 GLY CA C sing N N 76 GLY CA HA2 sing N N 77 GLY CA HA3 sing N N 78 GLY C O doub N N 79 GLY C OXT sing N N 80 GLY OXT HXT sing N N 81 HIS N CA sing N N 82 HIS N H sing N N 83 HIS N H2 sing N N 84 HIS CA C sing N N 85 HIS CA CB sing N N 86 HIS CA HA sing N N 87 HIS C O doub N N 88 HIS C OXT sing N N 89 HIS CB CG sing N N 90 HIS CB HB2 sing N N 91 HIS CB HB3 sing N N 92 HIS CG ND1 sing Y N 93 HIS CG CD2 doub Y N 94 HIS ND1 CE1 doub Y N 95 HIS ND1 HD1 sing N N 96 HIS CD2 NE2 sing Y N 97 HIS CD2 HD2 sing N N 98 HIS CE1 NE2 sing Y N 99 HIS CE1 HE1 sing N N 100 HIS NE2 HE2 sing N N 101 HIS OXT HXT sing N N 102 LEU N CA sing N N 103 LEU N H sing N N 104 LEU N H2 sing N N 105 LEU CA C sing N N 106 LEU CA CB sing N N 107 LEU CA HA sing N N 108 LEU C O doub N N 109 LEU C OXT sing N N 110 LEU CB CG sing N N 111 LEU CB HB2 sing N N 112 LEU CB HB3 sing N N 113 LEU CG CD1 sing N N 114 LEU CG CD2 sing N N 115 LEU CG HG sing N N 116 LEU CD1 HD11 sing N N 117 LEU CD1 HD12 sing N N 118 LEU CD1 HD13 sing N N 119 LEU CD2 HD21 sing N N 120 LEU CD2 HD22 sing N N 121 LEU CD2 HD23 sing N N 122 LEU OXT HXT sing N N 123 LYS N CA sing N N 124 LYS N H sing N N 125 LYS N H2 sing N N 126 LYS CA C sing N N 127 LYS CA CB sing N N 128 LYS CA HA sing N N 129 LYS C O doub N N 130 LYS C OXT sing N N 131 LYS CB CG sing N N 132 LYS CB HB2 sing N N 133 LYS CB HB3 sing N N 134 LYS CG CD sing N N 135 LYS CG HG2 sing N N 136 LYS CG HG3 sing N N 137 LYS CD CE sing N N 138 LYS CD HD2 sing N N 139 LYS CD HD3 sing N N 140 LYS CE NZ sing N N 141 LYS CE HE2 sing N N 142 LYS CE HE3 sing N N 143 LYS NZ HZ1 sing N N 144 LYS NZ HZ2 sing N N 145 LYS NZ HZ3 sing N N 146 LYS OXT HXT sing N N 147 PCA N CA sing N N 148 PCA N CD sing N N 149 PCA N H sing N N 150 PCA CA CB sing N N 151 PCA CA C sing N N 152 PCA CA HA sing N N 153 PCA CB CG sing N N 154 PCA CB HB2 sing N N 155 PCA CB HB3 sing N N 156 PCA CG CD sing N N 157 PCA CG HG2 sing N N 158 PCA CG HG3 sing N N 159 PCA CD OE doub N N 160 PCA C O doub N N 161 PCA C OXT sing N N 162 PCA OXT HXT sing N N 163 PHE N CA sing N N 164 PHE N H sing N N 165 PHE N H2 sing N N 166 PHE CA C sing N N 167 PHE CA CB sing N N 168 PHE CA HA sing N N 169 PHE C O doub N N 170 PHE C OXT sing N N 171 PHE CB CG sing N N 172 PHE CB HB2 sing N N 173 PHE CB HB3 sing N N 174 PHE CG CD1 doub Y N 175 PHE CG CD2 sing Y N 176 PHE CD1 CE1 sing Y N 177 PHE CD1 HD1 sing N N 178 PHE CD2 CE2 doub Y N 179 PHE CD2 HD2 sing N N 180 PHE CE1 CZ doub Y N 181 PHE CE1 HE1 sing N N 182 PHE CE2 CZ sing Y N 183 PHE CE2 HE2 sing N N 184 PHE CZ HZ sing N N 185 PHE OXT HXT sing N N 186 PRO N CA sing N N 187 PRO N CD sing N N 188 PRO N H sing N N 189 PRO CA C sing N N 190 PRO CA CB sing N N 191 PRO CA HA sing N N 192 PRO C O doub N N 193 PRO C OXT sing N N 194 PRO CB CG sing N N 195 PRO CB HB2 sing N N 196 PRO CB HB3 sing N N 197 PRO CG CD sing N N 198 PRO CG HG2 sing N N 199 PRO CG HG3 sing N N 200 PRO CD HD2 sing N N 201 PRO CD HD3 sing N N 202 PRO OXT HXT sing N N 203 SER N CA sing N N 204 SER N H sing N N 205 SER N H2 sing N N 206 SER CA C sing N N 207 SER CA CB sing N N 208 SER CA HA sing N N 209 SER C O doub N N 210 SER C OXT sing N N 211 SER CB OG sing N N 212 SER CB HB2 sing N N 213 SER CB HB3 sing N N 214 SER OG HG sing N N 215 SER OXT HXT sing N N 216 THR N CA sing N N 217 THR N H sing N N 218 THR N H2 sing N N 219 THR CA C sing N N 220 THR CA CB sing N N 221 THR CA HA sing N N 222 THR C O doub N N 223 THR C OXT sing N N 224 THR CB OG1 sing N N 225 THR CB CG2 sing N N 226 THR CB HB sing N N 227 THR OG1 HG1 sing N N 228 THR CG2 HG21 sing N N 229 THR CG2 HG22 sing N N 230 THR CG2 HG23 sing N N 231 THR OXT HXT sing N N 232 TYR N CA sing N N 233 TYR N H sing N N 234 TYR N H2 sing N N 235 TYR CA C sing N N 236 TYR CA CB sing N N 237 TYR CA HA sing N N 238 TYR C O doub N N 239 TYR C OXT sing N N 240 TYR CB CG sing N N 241 TYR CB HB2 sing N N 242 TYR CB HB3 sing N N 243 TYR CG CD1 doub Y N 244 TYR CG CD2 sing Y N 245 TYR CD1 CE1 sing Y N 246 TYR CD1 HD1 sing N N 247 TYR CD2 CE2 doub Y N 248 TYR CD2 HD2 sing N N 249 TYR CE1 CZ doub Y N 250 TYR CE1 HE1 sing N N 251 TYR CE2 CZ sing Y N 252 TYR CE2 HE2 sing N N 253 TYR CZ OH sing N N 254 TYR OH HH sing N N 255 TYR OXT HXT sing N N 256 VAL N CA sing N N 257 VAL N H sing N N 258 VAL N H2 sing N N 259 VAL CA C sing N N 260 VAL CA CB sing N N 261 VAL CA HA sing N N 262 VAL C O doub N N 263 VAL C OXT sing N N 264 VAL CB CG1 sing N N 265 VAL CB CG2 sing N N 266 VAL CB HB sing N N 267 VAL CG1 HG11 sing N N 268 VAL CG1 HG12 sing N N 269 VAL CG1 HG13 sing N N 270 VAL CG2 HG21 sing N N 271 VAL CG2 HG22 sing N N 272 VAL CG2 HG23 sing N N 273 VAL OXT HXT sing N N 274 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7LX4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_