data_7LXF # _entry.id 7LXF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.359 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7LXF pdb_00007lxf 10.2210/pdb7lxf/pdb WWPDB D_1000254943 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7LXF _pdbx_database_status.recvd_initial_deposition_date 2021-03-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hwang, T.' 1 ? 'Grant, R.A.' 2 ? 'Keating, A.E.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'A distributed residue network permits conformational binding specificity in a conserved family of actin remodelers.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.70601 _citation.pdbx_database_id_PubMed 34854809 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hwang, T.' 1 0000-0002-9011-2174 primary 'Parker, S.S.' 2 0000-0003-3670-6147 primary 'Hill, S.M.' 3 0000-0002-6454-7430 primary 'Ilunga, M.W.' 4 ? primary 'Grant, R.A.' 5 0000-0002-5072-2867 primary 'Mouneimne, G.' 6 0000-0001-8103-4701 primary 'Keating, A.E.' 7 0000-0003-4074-8980 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7LXF _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.120 _cell.length_a_esd ? _cell.length_b 52.120 _cell.length_b_esd ? _cell.length_c 197.850 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7LXF _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein enabled homolog,Photoreceptor cilium actin regulator' 17091.225 1 ? ? ? ? 2 water nat water 18.015 36 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTF HQWRDARQVYGLNFGSKEDANVFASAMMHALEVLGGSGSGAAKSEELSCEMEGNLEHLPPPPMEVLMDKSFASLES ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTF HQWRDARQVYGLNFGSKEDANVFASAMMHALEVLGGSGSGAAKSEELSCEMEGNLEHLPPPPMEVLMDKSFASLES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MET n 1 5 SER n 1 6 GLU n 1 7 GLN n 1 8 SER n 1 9 ILE n 1 10 CYS n 1 11 GLN n 1 12 ALA n 1 13 ARG n 1 14 ALA n 1 15 ALA n 1 16 VAL n 1 17 MET n 1 18 VAL n 1 19 TYR n 1 20 ASP n 1 21 ASP n 1 22 ALA n 1 23 ASN n 1 24 LYS n 1 25 LYS n 1 26 TRP n 1 27 VAL n 1 28 PRO n 1 29 ALA n 1 30 GLY n 1 31 GLY n 1 32 SER n 1 33 THR n 1 34 GLY n 1 35 PHE n 1 36 SER n 1 37 ARG n 1 38 VAL n 1 39 HIS n 1 40 ILE n 1 41 TYR n 1 42 HIS n 1 43 HIS n 1 44 THR n 1 45 GLY n 1 46 ASN n 1 47 ASN n 1 48 THR n 1 49 PHE n 1 50 ARG n 1 51 VAL n 1 52 VAL n 1 53 GLY n 1 54 ARG n 1 55 LYS n 1 56 ILE n 1 57 GLN n 1 58 ASP n 1 59 HIS n 1 60 GLN n 1 61 VAL n 1 62 VAL n 1 63 ILE n 1 64 ASN n 1 65 CYS n 1 66 ALA n 1 67 ILE n 1 68 PRO n 1 69 LYS n 1 70 GLY n 1 71 LEU n 1 72 LYS n 1 73 TYR n 1 74 ASN n 1 75 GLN n 1 76 ALA n 1 77 THR n 1 78 GLN n 1 79 THR n 1 80 PHE n 1 81 HIS n 1 82 GLN n 1 83 TRP n 1 84 ARG n 1 85 ASP n 1 86 ALA n 1 87 ARG n 1 88 GLN n 1 89 VAL n 1 90 TYR n 1 91 GLY n 1 92 LEU n 1 93 ASN n 1 94 PHE n 1 95 GLY n 1 96 SER n 1 97 LYS n 1 98 GLU n 1 99 ASP n 1 100 ALA n 1 101 ASN n 1 102 VAL n 1 103 PHE n 1 104 ALA n 1 105 SER n 1 106 ALA n 1 107 MET n 1 108 MET n 1 109 HIS n 1 110 ALA n 1 111 LEU n 1 112 GLU n 1 113 VAL n 1 114 LEU n 1 115 GLY n 1 116 GLY n 1 117 SER n 1 118 GLY n 1 119 SER n 1 120 GLY n 1 121 ALA n 1 122 ALA n 1 123 LYS n 1 124 SER n 1 125 GLU n 1 126 GLU n 1 127 LEU n 1 128 SER n 1 129 CYS n 1 130 GLU n 1 131 MET n 1 132 GLU n 1 133 GLY n 1 134 ASN n 1 135 LEU n 1 136 GLU n 1 137 HIS n 1 138 LEU n 1 139 PRO n 1 140 PRO n 1 141 PRO n 1 142 PRO n 1 143 MET n 1 144 GLU n 1 145 VAL n 1 146 LEU n 1 147 MET n 1 148 ASP n 1 149 LYS n 1 150 SER n 1 151 PHE n 1 152 ALA n 1 153 SER n 1 154 LEU n 1 155 GLU n 1 156 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 120 Human ? ENAH ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 121 156 Human ? 'PCARE, C2orf71' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A075B6E5_HUMAN A0A075B6E5 ? 1 ;MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQW RDARQVYGLNFGSKEDANVFASAMMHALEVL ; 1 2 UNP PCARE_HUMAN A6NGG8 ? 1 AAKSEELSCEMEGNLEHLPPPPMEVLMDKSFASLES 813 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7LXF A 4 ? 114 ? A0A075B6E5 1 ? 111 ? 1 111 2 2 7LXF A 121 ? 156 ? A6NGG8 813 ? 848 ? 118 153 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7LXF SER A 1 ? UNP A0A075B6E5 ? ? 'expression tag' -2 1 1 7LXF ASN A 2 ? UNP A0A075B6E5 ? ? 'expression tag' -1 2 1 7LXF ALA A 3 ? UNP A0A075B6E5 ? ? 'expression tag' 0 3 1 7LXF GLY A 115 ? UNP A0A075B6E5 ? ? linker 112 4 1 7LXF GLY A 116 ? UNP A0A075B6E5 ? ? linker 113 5 1 7LXF SER A 117 ? UNP A0A075B6E5 ? ? linker 114 6 1 7LXF GLY A 118 ? UNP A0A075B6E5 ? ? linker 115 7 1 7LXF SER A 119 ? UNP A0A075B6E5 ? ? linker 116 8 1 7LXF GLY A 120 ? UNP A0A075B6E5 ? ? linker 117 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7LXF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Tris pH 8.0, 3.30M NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-07-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979180 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979180 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 43.283 _reflns.entry_id 7LXF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.650 _reflns.d_resolution_low 45.140 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20302 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 36.584 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.940 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.836 _reflns.pdbx_scaling_rejects 36 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.067 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 742720 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.650 1.690 ? 0.790 ? 37650 1459 ? 1449 99.300 ? ? ? ? 4.117 ? ? ? ? ? ? ? ? 25.983 ? ? ? ? 4.199 ? ? 1 1 0.702 ? ? 1.690 1.740 ? 1.270 ? 50618 1437 ? 1436 99.900 ? ? ? ? 3.211 ? ? ? ? ? ? ? ? 35.249 ? ? ? ? 3.257 ? ? 2 1 0.778 ? ? 1.740 1.790 ? 1.930 ? 54169 1367 ? 1367 100.000 ? ? ? ? 2.344 ? ? ? ? ? ? ? ? 39.626 ? ? ? ? 2.374 ? ? 3 1 0.846 ? ? 1.790 1.840 ? 3.080 ? 53022 1332 ? 1332 100.000 ? ? ? ? 1.520 ? ? ? ? ? ? ? ? 39.806 ? ? ? ? 1.539 ? ? 4 1 0.986 ? ? 1.840 1.900 ? 4.370 ? 51260 1298 ? 1298 100.000 ? ? ? ? 1.115 ? ? ? ? ? ? ? ? 39.492 ? ? ? ? 1.129 ? ? 5 1 0.963 ? ? 1.900 1.970 ? 6.480 ? 49564 1266 ? 1266 100.000 ? ? ? ? 0.742 ? ? ? ? ? ? ? ? 39.150 ? ? ? ? 0.752 ? ? 6 1 0.983 ? ? 1.970 2.050 ? 9.050 ? 46980 1231 ? 1230 99.900 ? ? ? ? 0.509 ? ? ? ? ? ? ? ? 38.195 ? ? ? ? 0.516 ? ? 7 1 0.991 ? ? 2.050 2.130 ? 12.310 ? 42332 1174 ? 1174 100.000 ? ? ? ? 0.368 ? ? ? ? ? ? ? ? 36.058 ? ? ? ? 0.374 ? ? 8 1 0.995 ? ? 2.130 2.220 ? 16.200 ? 42082 1143 ? 1143 100.000 ? ? ? ? 0.263 ? ? ? ? ? ? ? ? 36.817 ? ? ? ? 0.267 ? ? 9 1 0.999 ? ? 2.220 2.330 ? 21.090 ? 42754 1085 ? 1085 100.000 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 39.405 ? ? ? ? 0.205 ? ? 10 1 0.998 ? ? 2.330 2.460 ? 27.260 ? 41010 1056 ? 1056 100.000 ? ? ? ? 0.148 ? ? ? ? ? ? ? ? 38.835 ? ? ? ? 0.150 ? ? 11 1 0.999 ? ? 2.460 2.610 ? 33.100 ? 38419 1010 ? 1010 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 38.039 ? ? ? ? 0.115 ? ? 12 1 0.999 ? ? 2.610 2.790 ? 41.450 ? 34429 923 ? 923 100.000 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 37.301 ? ? ? ? 0.092 ? ? 13 1 0.999 ? ? 2.790 3.010 ? 50.330 ? 31432 891 ? 889 99.800 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 35.357 ? ? ? ? 0.070 ? ? 14 1 0.999 ? ? 3.010 3.300 ? 64.980 ? 28741 823 ? 823 100.000 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 34.922 ? ? ? ? 0.053 ? ? 15 1 1.000 ? ? 3.300 3.690 ? 83.000 ? 28828 752 ? 752 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 38.335 ? ? ? ? 0.045 ? ? 16 1 1.000 ? ? 3.690 4.260 ? 91.420 ? 24704 673 ? 673 100.000 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 36.707 ? ? ? ? 0.040 ? ? 17 1 1.000 ? ? 4.260 5.220 ? 97.790 ? 20750 601 ? 601 100.000 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 34.526 ? ? ? ? 0.038 ? ? 18 1 1.000 ? ? 5.220 7.380 ? 94.060 ? 14899 477 ? 475 99.600 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 31.366 ? ? ? ? 0.037 ? ? 19 1 1.000 ? ? 7.380 45.140 ? 94.780 ? 9077 323 ? 320 99.100 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 28.366 ? ? ? ? 0.035 ? ? 20 1 1.000 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 153.320 _refine.B_iso_mean 53.2093 _refine.B_iso_min 29.350 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7LXF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6500 _refine.ls_d_res_low 45.1400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20184 _refine.ls_number_reflns_R_free 1013 _refine.ls_number_reflns_R_work 19171 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8200 _refine.ls_percent_reflns_R_free 5.0200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2182 _refine.ls_R_factor_R_free 0.2345 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2174 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6RD2 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.1000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.6500 _refine_hist.d_res_low 45.1400 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 1084 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 134 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 43.72 _refine_hist.pdbx_number_atoms_protein 1048 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6500 1.7400 2802 . 142 2660 99.0000 . . . 0.3379 0.0000 0.3368 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.7400 1.8500 2780 . 138 2642 100.0000 . . . 0.2800 0.0000 0.2839 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.8500 1.9900 2812 . 141 2671 100.0000 . . . 0.2461 0.0000 0.2393 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.9900 2.1900 2846 . 143 2703 100.0000 . . . 0.2776 0.0000 0.2239 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.1900 2.5000 2871 . 144 2727 100.0000 . . . 0.2506 0.0000 0.2397 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.5000 3.1500 2911 . 146 2765 100.0000 . . . 0.2738 0.0000 0.2572 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.1500 45.1400 3162 . 159 3003 100.0000 . . . 0.2050 0.0000 0.1894 . . . . . . . 7 . . . # _struct.entry_id 7LXF _struct.title 'ENAH EVH1 domain bound to peptide from protein PCARE' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7LXF _struct_keywords.text 'Complex, cytoskeleton, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 30 ? SER A 32 ? GLY A 27 SER A 29 5 ? 3 HELX_P HELX_P2 AA2 SER A 96 ? GLY A 115 ? SER A 93 GLY A 112 1 ? 20 HELX_P HELX_P3 AA3 PRO A 142 ? MET A 147 ? PRO A 139 MET A 144 1 ? 6 HELX_P HELX_P4 AA4 LYS A 149 ? LEU A 154 ? LYS A 146 LEU A 151 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 25 ? PRO A 28 ? LYS A 22 PRO A 25 AA1 2 GLU A 6 ? ASP A 20 ? GLU A 3 ASP A 17 AA1 3 SER A 36 ? HIS A 43 ? SER A 33 HIS A 40 AA1 4 PHE A 49 ? LYS A 55 ? PHE A 46 LYS A 52 AA1 5 VAL A 61 ? ILE A 67 ? VAL A 58 ILE A 64 AA2 1 LYS A 25 ? PRO A 28 ? LYS A 22 PRO A 25 AA2 2 GLU A 6 ? ASP A 20 ? GLU A 3 ASP A 17 AA2 3 VAL A 89 ? PHE A 94 ? VAL A 86 PHE A 91 AA2 4 PHE A 80 ? ARG A 84 ? PHE A 77 ARG A 81 AA2 5 ASN A 74 ? THR A 77 ? ASN A 71 THR A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 25 ? O LYS A 22 N ASP A 20 ? N ASP A 17 AA1 2 3 N ALA A 12 ? N ALA A 9 O VAL A 38 ? O VAL A 35 AA1 3 4 N TYR A 41 ? N TYR A 38 O ARG A 50 ? O ARG A 47 AA1 4 5 N VAL A 51 ? N VAL A 48 O CYS A 65 ? O CYS A 62 AA2 1 2 O LYS A 25 ? O LYS A 22 N ASP A 20 ? N ASP A 17 AA2 2 3 N MET A 17 ? N MET A 14 O GLY A 91 ? O GLY A 88 AA2 3 4 O TYR A 90 ? O TYR A 87 N TRP A 83 ? N TRP A 80 AA2 4 5 O GLN A 82 ? O GLN A 79 N ASN A 74 ? N ASN A 71 # _atom_sites.entry_id 7LXF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019186 _atom_sites.fract_transf_matrix[1][2] 0.011077 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022155 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005054 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 0 ALA ALA A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 GLU 6 3 3 GLU GLU A . n A 1 7 GLN 7 4 4 GLN GLN A . n A 1 8 SER 8 5 5 SER SER A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 CYS 10 7 7 CYS CYS A . n A 1 11 GLN 11 8 8 GLN GLN A . n A 1 12 ALA 12 9 9 ALA ALA A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 ALA 14 11 11 ALA ALA A . n A 1 15 ALA 15 12 12 ALA ALA A . n A 1 16 VAL 16 13 13 VAL VAL A . n A 1 17 MET 17 14 14 MET MET A . n A 1 18 VAL 18 15 15 VAL VAL A . n A 1 19 TYR 19 16 16 TYR TYR A . n A 1 20 ASP 20 17 17 ASP ASP A . n A 1 21 ASP 21 18 18 ASP ASP A . n A 1 22 ALA 22 19 19 ALA ALA A . n A 1 23 ASN 23 20 20 ASN ASN A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 TRP 26 23 23 TRP TRP A . n A 1 27 VAL 27 24 24 VAL VAL A . n A 1 28 PRO 28 25 25 PRO PRO A . n A 1 29 ALA 29 26 26 ALA ALA A . n A 1 30 GLY 30 27 27 GLY GLY A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 SER 32 29 29 SER SER A . n A 1 33 THR 33 30 30 THR THR A . n A 1 34 GLY 34 31 31 GLY GLY A . n A 1 35 PHE 35 32 32 PHE PHE A . n A 1 36 SER 36 33 33 SER SER A . n A 1 37 ARG 37 34 34 ARG ARG A . n A 1 38 VAL 38 35 35 VAL VAL A . n A 1 39 HIS 39 36 36 HIS HIS A . n A 1 40 ILE 40 37 37 ILE ILE A . n A 1 41 TYR 41 38 38 TYR TYR A . n A 1 42 HIS 42 39 39 HIS HIS A . n A 1 43 HIS 43 40 40 HIS HIS A . n A 1 44 THR 44 41 41 THR THR A . n A 1 45 GLY 45 42 42 GLY GLY A . n A 1 46 ASN 46 43 43 ASN ASN A . n A 1 47 ASN 47 44 44 ASN ASN A . n A 1 48 THR 48 45 45 THR THR A . n A 1 49 PHE 49 46 46 PHE PHE A . n A 1 50 ARG 50 47 47 ARG ARG A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 VAL 52 49 49 VAL VAL A . n A 1 53 GLY 53 50 50 GLY GLY A . n A 1 54 ARG 54 51 51 ARG ARG A . n A 1 55 LYS 55 52 52 LYS LYS A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 GLN 57 54 54 GLN GLN A . n A 1 58 ASP 58 55 55 ASP ASP A . n A 1 59 HIS 59 56 56 HIS HIS A . n A 1 60 GLN 60 57 57 GLN GLN A . n A 1 61 VAL 61 58 58 VAL VAL A . n A 1 62 VAL 62 59 59 VAL VAL A . n A 1 63 ILE 63 60 60 ILE ILE A . n A 1 64 ASN 64 61 61 ASN ASN A . n A 1 65 CYS 65 62 62 CYS CYS A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 ILE 67 64 64 ILE ILE A . n A 1 68 PRO 68 65 65 PRO PRO A . n A 1 69 LYS 69 66 66 LYS LYS A . n A 1 70 GLY 70 67 67 GLY GLY A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 LYS 72 69 69 LYS LYS A . n A 1 73 TYR 73 70 70 TYR TYR A . n A 1 74 ASN 74 71 71 ASN ASN A . n A 1 75 GLN 75 72 72 GLN GLN A . n A 1 76 ALA 76 73 73 ALA ALA A . n A 1 77 THR 77 74 74 THR THR A . n A 1 78 GLN 78 75 75 GLN GLN A . n A 1 79 THR 79 76 76 THR THR A . n A 1 80 PHE 80 77 77 PHE PHE A . n A 1 81 HIS 81 78 78 HIS HIS A . n A 1 82 GLN 82 79 79 GLN GLN A . n A 1 83 TRP 83 80 80 TRP TRP A . n A 1 84 ARG 84 81 81 ARG ARG A . n A 1 85 ASP 85 82 82 ASP ASP A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 ARG 87 84 84 ARG ARG A . n A 1 88 GLN 88 85 85 GLN GLN A . n A 1 89 VAL 89 86 86 VAL VAL A . n A 1 90 TYR 90 87 87 TYR TYR A . n A 1 91 GLY 91 88 88 GLY GLY A . n A 1 92 LEU 92 89 89 LEU LEU A . n A 1 93 ASN 93 90 90 ASN ASN A . n A 1 94 PHE 94 91 91 PHE PHE A . n A 1 95 GLY 95 92 92 GLY GLY A . n A 1 96 SER 96 93 93 SER SER A . n A 1 97 LYS 97 94 94 LYS LYS A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 ASP 99 96 96 ASP ASP A . n A 1 100 ALA 100 97 97 ALA ALA A . n A 1 101 ASN 101 98 98 ASN ASN A . n A 1 102 VAL 102 99 99 VAL VAL A . n A 1 103 PHE 103 100 100 PHE PHE A . n A 1 104 ALA 104 101 101 ALA ALA A . n A 1 105 SER 105 102 102 SER SER A . n A 1 106 ALA 106 103 103 ALA ALA A . n A 1 107 MET 107 104 104 MET MET A . n A 1 108 MET 108 105 105 MET MET A . n A 1 109 HIS 109 106 106 HIS HIS A . n A 1 110 ALA 110 107 107 ALA ALA A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 GLU 112 109 109 GLU GLU A . n A 1 113 VAL 113 110 110 VAL VAL A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 GLY 115 112 112 GLY GLY A . n A 1 116 GLY 116 113 ? ? ? A . n A 1 117 SER 117 114 ? ? ? A . n A 1 118 GLY 118 115 ? ? ? A . n A 1 119 SER 119 116 ? ? ? A . n A 1 120 GLY 120 117 ? ? ? A . n A 1 121 ALA 121 118 ? ? ? A . n A 1 122 ALA 122 119 ? ? ? A . n A 1 123 LYS 123 120 ? ? ? A . n A 1 124 SER 124 121 ? ? ? A . n A 1 125 GLU 125 122 ? ? ? A . n A 1 126 GLU 126 123 ? ? ? A . n A 1 127 LEU 127 124 ? ? ? A . n A 1 128 SER 128 125 ? ? ? A . n A 1 129 CYS 129 126 ? ? ? A . n A 1 130 GLU 130 127 ? ? ? A . n A 1 131 MET 131 128 ? ? ? A . n A 1 132 GLU 132 129 ? ? ? A . n A 1 133 GLY 133 130 ? ? ? A . n A 1 134 ASN 134 131 ? ? ? A . n A 1 135 LEU 135 132 ? ? ? A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 HIS 137 134 134 HIS HIS A . n A 1 138 LEU 138 135 135 LEU LEU A . n A 1 139 PRO 139 136 136 PRO PRO A . n A 1 140 PRO 140 137 137 PRO PRO A . n A 1 141 PRO 141 138 138 PRO PRO A . n A 1 142 PRO 142 139 139 PRO PRO A . n A 1 143 MET 143 140 140 MET MET A . n A 1 144 GLU 144 141 141 GLU GLU A . n A 1 145 VAL 145 142 142 VAL VAL A . n A 1 146 LEU 146 143 143 LEU LEU A . n A 1 147 MET 147 144 144 MET MET A . n A 1 148 ASP 148 145 145 ASP ASP A . n A 1 149 LYS 149 146 146 LYS LYS A . n A 1 150 SER 150 147 147 SER SER A . n A 1 151 PHE 151 148 148 PHE PHE A . n A 1 152 ALA 152 149 149 ALA ALA A . n A 1 153 SER 153 150 150 SER SER A . n A 1 154 LEU 154 151 151 LEU LEU A . n A 1 155 GLU 155 152 152 GLU GLU A . n A 1 156 SER 156 153 153 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 15 HOH HOH A . B 2 HOH 2 202 36 HOH HOH A . B 2 HOH 3 203 7 HOH HOH A . B 2 HOH 4 204 25 HOH HOH A . B 2 HOH 5 205 4 HOH HOH A . B 2 HOH 6 206 6 HOH HOH A . B 2 HOH 7 207 26 HOH HOH A . B 2 HOH 8 208 19 HOH HOH A . B 2 HOH 9 209 16 HOH HOH A . B 2 HOH 10 210 35 HOH HOH A . B 2 HOH 11 211 9 HOH HOH A . B 2 HOH 12 212 5 HOH HOH A . B 2 HOH 13 213 31 HOH HOH A . B 2 HOH 14 214 30 HOH HOH A . B 2 HOH 15 215 18 HOH HOH A . B 2 HOH 16 216 1 HOH HOH A . B 2 HOH 17 217 2 HOH HOH A . B 2 HOH 18 218 3 HOH HOH A . B 2 HOH 19 219 17 HOH HOH A . B 2 HOH 20 220 32 HOH HOH A . B 2 HOH 21 221 24 HOH HOH A . B 2 HOH 22 222 34 HOH HOH A . B 2 HOH 23 223 23 HOH HOH A . B 2 HOH 24 224 22 HOH HOH A . B 2 HOH 25 225 12 HOH HOH A . B 2 HOH 26 226 27 HOH HOH A . B 2 HOH 27 227 11 HOH HOH A . B 2 HOH 28 228 8 HOH HOH A . B 2 HOH 29 229 20 HOH HOH A . B 2 HOH 30 230 29 HOH HOH A . B 2 HOH 31 231 21 HOH HOH A . B 2 HOH 32 232 10 HOH HOH A . B 2 HOH 33 233 33 HOH HOH A . B 2 HOH 34 234 14 HOH HOH A . B 2 HOH 35 235 28 HOH HOH A . B 2 HOH 36 236 13 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 232 ? B HOH . 2 1 A HOH 234 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-11-24 2 'Structure model' 1 1 2022-06-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 62 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 62 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.707 _pdbx_validate_rmsd_bond.bond_target_value 1.812 _pdbx_validate_rmsd_bond.bond_deviation -0.105 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.016 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 1 ? ? -101.17 50.63 2 1 ASP A 82 ? ? -122.47 -166.23 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A GLY 113 ? A GLY 116 4 1 Y 1 A SER 114 ? A SER 117 5 1 Y 1 A GLY 115 ? A GLY 118 6 1 Y 1 A SER 116 ? A SER 119 7 1 Y 1 A GLY 117 ? A GLY 120 8 1 Y 1 A ALA 118 ? A ALA 121 9 1 Y 1 A ALA 119 ? A ALA 122 10 1 Y 1 A LYS 120 ? A LYS 123 11 1 Y 1 A SER 121 ? A SER 124 12 1 Y 1 A GLU 122 ? A GLU 125 13 1 Y 1 A GLU 123 ? A GLU 126 14 1 Y 1 A LEU 124 ? A LEU 127 15 1 Y 1 A SER 125 ? A SER 128 16 1 Y 1 A CYS 126 ? A CYS 129 17 1 Y 1 A GLU 127 ? A GLU 130 18 1 Y 1 A MET 128 ? A MET 131 19 1 Y 1 A GLU 129 ? A GLU 132 20 1 Y 1 A GLY 130 ? A GLY 133 21 1 Y 1 A ASN 131 ? A ASN 134 22 1 Y 1 A LEU 132 ? A LEU 135 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM129007-03 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #