data_7LZ9 # _entry.id 7LZ9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7LZ9 pdb_00007lz9 10.2210/pdb7lz9/pdb WWPDB D_1000255359 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-14 2 'Structure model' 1 1 2021-08-25 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_database_2.pdbx_DOI' 12 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7LZ9 _pdbx_database_status.recvd_initial_deposition_date 2021-03-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Maciunas, L.J.' 1 0000-0002-4430-9961 'Loll, P.J.' 2 0000-0001-5416-4500 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 77 _citation.language ? _citation.page_first 1027 _citation.page_last 1039 _citation.title 'Structures of full-length VanR from Streptomyces coelicolor in both the inactive and activated states.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798321006288 _citation.pdbx_database_id_PubMed 34342276 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Maciunas, L.J.' 1 ? primary 'Porter, N.' 2 ? primary 'Lee, P.J.' 3 ? primary 'Gupta, K.' 4 ? primary 'Loll, P.J.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative two-component system response regulator' 24976.266 1 ? ? ? 'VanR in the inactive (dephosphorylated) form' 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 water nat water 18.015 28 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMRVLIVEDEPYLAEAIRDGLRLEAIAADIAGDGDTALELLSVNAYDIAVLDRDIPGPSGDEIAERIVASGSGMPILMLT AADRLDDKASGFGLGADDYLTKPFELQELALRLRALDRRRAHSRPPVREIAGLRLDPFRREVYRGGRYVALTRKQFAVLE VLVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDTAPVSEQAGGDGG ; _entity_poly.pdbx_seq_one_letter_code_can ;GMRVLIVEDEPYLAEAIRDGLRLEAIAADIAGDGDTALELLSVNAYDIAVLDRDIPGPSGDEIAERIVASGSGMPILMLT AADRLDDKASGFGLGADDYLTKPFELQELALRLRALDRRRAHSRPPVREIAGLRLDPFRREVYRGGRYVALTRKQFAVLE VLVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDTAPVSEQAGGDGG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ARG n 1 4 VAL n 1 5 LEU n 1 6 ILE n 1 7 VAL n 1 8 GLU n 1 9 ASP n 1 10 GLU n 1 11 PRO n 1 12 TYR n 1 13 LEU n 1 14 ALA n 1 15 GLU n 1 16 ALA n 1 17 ILE n 1 18 ARG n 1 19 ASP n 1 20 GLY n 1 21 LEU n 1 22 ARG n 1 23 LEU n 1 24 GLU n 1 25 ALA n 1 26 ILE n 1 27 ALA n 1 28 ALA n 1 29 ASP n 1 30 ILE n 1 31 ALA n 1 32 GLY n 1 33 ASP n 1 34 GLY n 1 35 ASP n 1 36 THR n 1 37 ALA n 1 38 LEU n 1 39 GLU n 1 40 LEU n 1 41 LEU n 1 42 SER n 1 43 VAL n 1 44 ASN n 1 45 ALA n 1 46 TYR n 1 47 ASP n 1 48 ILE n 1 49 ALA n 1 50 VAL n 1 51 LEU n 1 52 ASP n 1 53 ARG n 1 54 ASP n 1 55 ILE n 1 56 PRO n 1 57 GLY n 1 58 PRO n 1 59 SER n 1 60 GLY n 1 61 ASP n 1 62 GLU n 1 63 ILE n 1 64 ALA n 1 65 GLU n 1 66 ARG n 1 67 ILE n 1 68 VAL n 1 69 ALA n 1 70 SER n 1 71 GLY n 1 72 SER n 1 73 GLY n 1 74 MET n 1 75 PRO n 1 76 ILE n 1 77 LEU n 1 78 MET n 1 79 LEU n 1 80 THR n 1 81 ALA n 1 82 ALA n 1 83 ASP n 1 84 ARG n 1 85 LEU n 1 86 ASP n 1 87 ASP n 1 88 LYS n 1 89 ALA n 1 90 SER n 1 91 GLY n 1 92 PHE n 1 93 GLY n 1 94 LEU n 1 95 GLY n 1 96 ALA n 1 97 ASP n 1 98 ASP n 1 99 TYR n 1 100 LEU n 1 101 THR n 1 102 LYS n 1 103 PRO n 1 104 PHE n 1 105 GLU n 1 106 LEU n 1 107 GLN n 1 108 GLU n 1 109 LEU n 1 110 ALA n 1 111 LEU n 1 112 ARG n 1 113 LEU n 1 114 ARG n 1 115 ALA n 1 116 LEU n 1 117 ASP n 1 118 ARG n 1 119 ARG n 1 120 ARG n 1 121 ALA n 1 122 HIS n 1 123 SER n 1 124 ARG n 1 125 PRO n 1 126 PRO n 1 127 VAL n 1 128 ARG n 1 129 GLU n 1 130 ILE n 1 131 ALA n 1 132 GLY n 1 133 LEU n 1 134 ARG n 1 135 LEU n 1 136 ASP n 1 137 PRO n 1 138 PHE n 1 139 ARG n 1 140 ARG n 1 141 GLU n 1 142 VAL n 1 143 TYR n 1 144 ARG n 1 145 GLY n 1 146 GLY n 1 147 ARG n 1 148 TYR n 1 149 VAL n 1 150 ALA n 1 151 LEU n 1 152 THR n 1 153 ARG n 1 154 LYS n 1 155 GLN n 1 156 PHE n 1 157 ALA n 1 158 VAL n 1 159 LEU n 1 160 GLU n 1 161 VAL n 1 162 LEU n 1 163 VAL n 1 164 ALA n 1 165 ALA n 1 166 GLU n 1 167 GLY n 1 168 GLY n 1 169 VAL n 1 170 VAL n 1 171 SER n 1 172 ALA n 1 173 GLU n 1 174 GLU n 1 175 LEU n 1 176 LEU n 1 177 GLU n 1 178 ARG n 1 179 ALA n 1 180 TRP n 1 181 ASP n 1 182 GLU n 1 183 ASN n 1 184 ALA n 1 185 ASP n 1 186 PRO n 1 187 PHE n 1 188 THR n 1 189 ASN n 1 190 ALA n 1 191 VAL n 1 192 ARG n 1 193 ILE n 1 194 THR n 1 195 VAL n 1 196 SER n 1 197 ALA n 1 198 LEU n 1 199 ARG n 1 200 LYS n 1 201 ARG n 1 202 LEU n 1 203 GLY n 1 204 GLU n 1 205 PRO n 1 206 GLY n 1 207 ILE n 1 208 ILE n 1 209 ALA n 1 210 THR n 1 211 VAL n 1 212 PRO n 1 213 GLY n 1 214 VAL n 1 215 GLY n 1 216 TYR n 1 217 ARG n 1 218 ILE n 1 219 ASP n 1 220 THR n 1 221 ALA n 1 222 PRO n 1 223 VAL n 1 224 SER n 1 225 GLU n 1 226 GLN n 1 227 ALA n 1 228 GLY n 1 229 GLY n 1 230 ASP n 1 231 GLY n 1 232 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 232 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SCO3590 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-471 / A3(2) / M145' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 100226 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETHSUL _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 ARG 3 2 2 ARG ARG A . n A 1 4 VAL 4 3 3 VAL VAL A . n A 1 5 LEU 5 4 4 LEU LEU A . n A 1 6 ILE 6 5 5 ILE ILE A . n A 1 7 VAL 7 6 6 VAL VAL A . n A 1 8 GLU 8 7 7 GLU GLU A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 GLU 10 9 9 GLU GLU A . n A 1 11 PRO 11 10 10 PRO PRO A . n A 1 12 TYR 12 11 11 TYR TYR A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 ILE 17 16 16 ILE ILE A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 ASP 19 18 18 ASP ASP A . n A 1 20 GLY 20 19 19 GLY GLY A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 ARG 22 21 21 ARG ARG A . n A 1 23 LEU 23 22 22 LEU LEU A . n A 1 24 GLU 24 23 23 GLU GLU A . n A 1 25 ALA 25 24 24 ALA ALA A . n A 1 26 ILE 26 25 25 ILE ILE A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 ALA 28 27 27 ALA ALA A . n A 1 29 ASP 29 28 28 ASP ASP A . n A 1 30 ILE 30 29 29 ILE ILE A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 ASP 33 32 32 ASP ASP A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 ASP 35 34 34 ASP ASP A . n A 1 36 THR 36 35 35 THR THR A . n A 1 37 ALA 37 36 36 ALA ALA A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 LEU 40 39 39 LEU LEU A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 VAL 43 42 42 VAL VAL A . n A 1 44 ASN 44 43 43 ASN ASN A . n A 1 45 ALA 45 44 44 ALA ALA A . n A 1 46 TYR 46 45 45 TYR TYR A . n A 1 47 ASP 47 46 46 ASP ASP A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 ALA 49 48 48 ALA ALA A . n A 1 50 VAL 50 49 49 VAL VAL A . n A 1 51 LEU 51 50 50 LEU LEU A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 ARG 53 52 52 ARG ARG A . n A 1 54 ASP 54 53 53 ASP ASP A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 PRO 56 55 55 PRO PRO A . n A 1 57 GLY 57 56 56 GLY GLY A . n A 1 58 PRO 58 57 57 PRO PRO A . n A 1 59 SER 59 58 58 SER SER A . n A 1 60 GLY 60 59 59 GLY GLY A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 ALA 64 63 63 ALA ALA A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 ARG 66 65 65 ARG ARG A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 VAL 68 67 67 VAL VAL A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 SER 70 69 69 SER SER A . n A 1 71 GLY 71 70 70 GLY GLY A . n A 1 72 SER 72 71 71 SER SER A . n A 1 73 GLY 73 72 72 GLY GLY A . n A 1 74 MET 74 73 73 MET MET A . n A 1 75 PRO 75 74 74 PRO PRO A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 MET 78 77 77 MET MET A . n A 1 79 LEU 79 78 78 LEU LEU A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 ALA 81 80 80 ALA ALA A . n A 1 82 ALA 82 81 81 ALA ALA A . n A 1 83 ASP 83 82 ? ? ? A . n A 1 84 ARG 84 83 ? ? ? A . n A 1 85 LEU 85 84 ? ? ? A . n A 1 86 ASP 86 85 ? ? ? A . n A 1 87 ASP 87 86 ? ? ? A . n A 1 88 LYS 88 87 ? ? ? A . n A 1 89 ALA 89 88 ? ? ? A . n A 1 90 SER 90 89 ? ? ? A . n A 1 91 GLY 91 90 ? ? ? A . n A 1 92 PHE 92 91 ? ? ? A . n A 1 93 GLY 93 92 ? ? ? A . n A 1 94 LEU 94 93 ? ? ? A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 ALA 96 95 95 ALA ALA A . n A 1 97 ASP 97 96 96 ASP ASP A . n A 1 98 ASP 98 97 97 ASP ASP A . n A 1 99 TYR 99 98 98 TYR TYR A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 THR 101 100 100 THR THR A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 PRO 103 102 102 PRO PRO A . n A 1 104 PHE 104 103 103 PHE PHE A . n A 1 105 GLU 105 104 104 GLU GLU A . n A 1 106 LEU 106 105 105 LEU LEU A . n A 1 107 GLN 107 106 106 GLN GLN A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 ARG 112 111 111 ARG ARG A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 ARG 114 113 113 ARG ARG A . n A 1 115 ALA 115 114 114 ALA ALA A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 ASP 117 116 116 ASP ASP A . n A 1 118 ARG 118 117 117 ARG ARG A . n A 1 119 ARG 119 118 118 ARG ARG A . n A 1 120 ARG 120 119 119 ARG ARG A . n A 1 121 ALA 121 120 120 ALA ALA A . n A 1 122 HIS 122 121 121 HIS HIS A . n A 1 123 SER 123 122 122 SER SER A . n A 1 124 ARG 124 123 123 ARG ARG A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 PRO 126 125 125 PRO PRO A . n A 1 127 VAL 127 126 126 VAL VAL A . n A 1 128 ARG 128 127 127 ARG ARG A . n A 1 129 GLU 129 128 128 GLU GLU A . n A 1 130 ILE 130 129 129 ILE ILE A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 GLY 132 131 131 GLY GLY A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 ARG 134 133 133 ARG ARG A . n A 1 135 LEU 135 134 134 LEU LEU A . n A 1 136 ASP 136 135 135 ASP ASP A . n A 1 137 PRO 137 136 136 PRO PRO A . n A 1 138 PHE 138 137 137 PHE PHE A . n A 1 139 ARG 139 138 138 ARG ARG A . n A 1 140 ARG 140 139 139 ARG ARG A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 VAL 142 141 141 VAL VAL A . n A 1 143 TYR 143 142 142 TYR TYR A . n A 1 144 ARG 144 143 143 ARG ARG A . n A 1 145 GLY 145 144 144 GLY GLY A . n A 1 146 GLY 146 145 145 GLY GLY A . n A 1 147 ARG 147 146 146 ARG ARG A . n A 1 148 TYR 148 147 147 TYR TYR A . n A 1 149 VAL 149 148 148 VAL VAL A . n A 1 150 ALA 150 149 149 ALA ALA A . n A 1 151 LEU 151 150 150 LEU LEU A . n A 1 152 THR 152 151 151 THR THR A . n A 1 153 ARG 153 152 152 ARG ARG A . n A 1 154 LYS 154 153 153 LYS LYS A . n A 1 155 GLN 155 154 154 GLN GLN A . n A 1 156 PHE 156 155 155 PHE PHE A . n A 1 157 ALA 157 156 156 ALA ALA A . n A 1 158 VAL 158 157 157 VAL VAL A . n A 1 159 LEU 159 158 158 LEU LEU A . n A 1 160 GLU 160 159 159 GLU GLU A . n A 1 161 VAL 161 160 160 VAL VAL A . n A 1 162 LEU 162 161 161 LEU LEU A . n A 1 163 VAL 163 162 162 VAL VAL A . n A 1 164 ALA 164 163 163 ALA ALA A . n A 1 165 ALA 165 164 164 ALA ALA A . n A 1 166 GLU 166 165 165 GLU GLU A . n A 1 167 GLY 167 166 166 GLY GLY A . n A 1 168 GLY 168 167 167 GLY GLY A . n A 1 169 VAL 169 168 168 VAL VAL A . n A 1 170 VAL 170 169 169 VAL VAL A . n A 1 171 SER 171 170 170 SER SER A . n A 1 172 ALA 172 171 171 ALA ALA A . n A 1 173 GLU 173 172 172 GLU GLU A . n A 1 174 GLU 174 173 173 GLU GLU A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 LEU 176 175 175 LEU LEU A . n A 1 177 GLU 177 176 176 GLU GLU A . n A 1 178 ARG 178 177 177 ARG ARG A . n A 1 179 ALA 179 178 178 ALA ALA A . n A 1 180 TRP 180 179 179 TRP TRP A . n A 1 181 ASP 181 180 180 ASP ASP A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 ASN 183 182 182 ASN ASN A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 ASP 185 184 184 ASP ASP A . n A 1 186 PRO 186 185 185 PRO PRO A . n A 1 187 PHE 187 186 186 PHE PHE A . n A 1 188 THR 188 187 187 THR THR A . n A 1 189 ASN 189 188 188 ASN ASN A . n A 1 190 ALA 190 189 189 ALA ALA A . n A 1 191 VAL 191 190 190 VAL VAL A . n A 1 192 ARG 192 191 191 ARG ARG A . n A 1 193 ILE 193 192 192 ILE ILE A . n A 1 194 THR 194 193 193 THR THR A . n A 1 195 VAL 195 194 194 VAL VAL A . n A 1 196 SER 196 195 195 SER SER A . n A 1 197 ALA 197 196 196 ALA ALA A . n A 1 198 LEU 198 197 197 LEU LEU A . n A 1 199 ARG 199 198 198 ARG ARG A . n A 1 200 LYS 200 199 199 LYS LYS A . n A 1 201 ARG 201 200 200 ARG ARG A . n A 1 202 LEU 202 201 201 LEU LEU A . n A 1 203 GLY 203 202 202 GLY GLY A . n A 1 204 GLU 204 203 203 GLU GLU A . n A 1 205 PRO 205 204 204 PRO PRO A . n A 1 206 GLY 206 205 205 GLY GLY A . n A 1 207 ILE 207 206 206 ILE ILE A . n A 1 208 ILE 208 207 207 ILE ILE A . n A 1 209 ALA 209 208 208 ALA ALA A . n A 1 210 THR 210 209 209 THR THR A . n A 1 211 VAL 211 210 210 VAL VAL A . n A 1 212 PRO 212 211 211 PRO PRO A . n A 1 213 GLY 213 212 212 GLY GLY A . n A 1 214 VAL 214 213 213 VAL VAL A . n A 1 215 GLY 215 214 214 GLY GLY A . n A 1 216 TYR 216 215 215 TYR TYR A . n A 1 217 ARG 217 216 216 ARG ARG A . n A 1 218 ILE 218 217 217 ILE ILE A . n A 1 219 ASP 219 218 218 ASP ASP A . n A 1 220 THR 220 219 219 THR THR A . n A 1 221 ALA 221 220 ? ? ? A . n A 1 222 PRO 222 221 ? ? ? A . n A 1 223 VAL 223 222 ? ? ? A . n A 1 224 SER 224 223 ? ? ? A . n A 1 225 GLU 225 224 ? ? ? A . n A 1 226 GLN 226 225 ? ? ? A . n A 1 227 ALA 227 226 ? ? ? A . n A 1 228 GLY 228 227 ? ? ? A . n A 1 229 GLY 229 228 ? ? ? A . n A 1 230 ASP 230 229 ? ? ? A . n A 1 231 GLY 231 230 ? ? ? A . n A 1 232 GLY 232 231 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 1 MG MG A . C 3 HOH 1 401 14 HOH HOH A . C 3 HOH 2 402 12 HOH HOH A . C 3 HOH 3 403 19 HOH HOH A . C 3 HOH 4 404 11 HOH HOH A . C 3 HOH 5 405 22 HOH HOH A . C 3 HOH 6 406 2 HOH HOH A . C 3 HOH 7 407 28 HOH HOH A . C 3 HOH 8 408 1 HOH HOH A . C 3 HOH 9 409 9 HOH HOH A . C 3 HOH 10 410 20 HOH HOH A . C 3 HOH 11 411 27 HOH HOH A . C 3 HOH 12 412 4 HOH HOH A . C 3 HOH 13 413 10 HOH HOH A . C 3 HOH 14 414 21 HOH HOH A . C 3 HOH 15 415 26 HOH HOH A . C 3 HOH 16 416 5 HOH HOH A . C 3 HOH 17 417 24 HOH HOH A . C 3 HOH 18 418 3 HOH HOH A . C 3 HOH 19 419 25 HOH HOH A . C 3 HOH 20 420 13 HOH HOH A . C 3 HOH 21 421 8 HOH HOH A . C 3 HOH 22 422 15 HOH HOH A . C 3 HOH 23 423 7 HOH HOH A . C 3 HOH 24 424 18 HOH HOH A . C 3 HOH 25 425 23 HOH HOH A . C 3 HOH 26 426 29 HOH HOH A . C 3 HOH 27 427 16 HOH HOH A . C 3 HOH 28 428 17 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7LZ9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.380 _cell.length_a_esd ? _cell.length_b 74.380 _cell.length_b_esd ? _cell.length_c 138.230 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7LZ9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7LZ9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.34 _exptl_crystal.description 'thin needle' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Mix protein (11.3 mg/mL in 500 mM NaCl, 5 mM MgCl2, 10% glycerol, 40 mM Tris pH 8) 1:1 with 0.2 M MgCl2, 0.1 M Tris pH=8.5, 30% w/v PEG400; incubate under Al's Oil. ; _exptl_crystal_grow.pdbx_pH_range 8-8.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.920089 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.920089 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 33.8 _reflns.entry_id 7LZ9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 32.75 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10592 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.6 _reflns.pdbx_Rmerge_I_obs 0.246 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.251 _reflns.pdbx_Rpim_I_all 0.049 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1033 _reflns_shell.percent_possible_all 98.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.953 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 23.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.996 _reflns_shell.pdbx_Rpim_I_all 0.145 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.696 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 80.420 _refine.B_iso_mean 43.0008 _refine.B_iso_min 26.290 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7LZ9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 32.7500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10591 _refine.ls_number_reflns_R_free 529 _refine.ls_number_reflns_R_work 10062 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4400 _refine.ls_percent_reflns_R_free 4.9900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2045 _refine.ls_R_factor_R_free 0.2555 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2018 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model unpublished _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.2600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 32.7500 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 1623 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 208 _refine_hist.pdbx_B_iso_mean_ligand 46.96 _refine_hist.pdbx_B_iso_mean_solvent 39.43 _refine_hist.pdbx_number_atoms_protein 1594 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3001 2.5315 . . 128 2437 99.0000 . . . 0.3214 0.0000 0.2534 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5315 2.8976 . . 129 2456 99.0000 . . . 0.2954 0.0000 0.2429 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8976 3.6499 . . 132 2494 100.0000 . . . 0.3109 0.0000 0.2190 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6499 32.75 . . 140 2675 100.0000 . . . 0.2054 0.0000 0.1722 . . . . . . . . . . . # _struct.entry_id 7LZ9 _struct.title 'Inactive form of VanR from S. coelicolor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7LZ9 _struct_keywords.text 'inactive, antibiotic resistance, response regulator, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8CJW1_STRCO _struct_ref.pdbx_db_accession Q8CJW1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRVLIVEDEPYLAEAIRDGLRLEAIAADIAGDGDTALELLSVNAYDIAVLDRDIPGPSGDEIAERIVASGSGMPILMLTA ADRLDDKASGFGLGADDYLTKPFELQELALRLRALDRRRAHSRPPVREIAGLRLDPFRREVYRGGRYVALTRKQFAVLEV LVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDTAPVSEQAGGDGG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7LZ9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 232 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8CJW1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 231 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7LZ9 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8CJW1 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 12 ? LEU A 23 ? TYR A 11 LEU A 22 1 ? 12 HELX_P HELX_P2 AA2 ASP A 33 ? ASN A 44 ? ASP A 32 ASN A 43 1 ? 12 HELX_P HELX_P3 AA3 SER A 59 ? GLY A 71 ? SER A 58 GLY A 70 1 ? 13 HELX_P HELX_P4 AA4 GLU A 105 ? ARG A 120 ? GLU A 104 ARG A 119 1 ? 16 HELX_P HELX_P5 AA5 THR A 152 ? ALA A 165 ? THR A 151 ALA A 164 1 ? 14 HELX_P HELX_P6 AA6 SER A 171 ? TRP A 180 ? SER A 170 TRP A 179 1 ? 10 HELX_P HELX_P7 AA7 THR A 188 ? GLY A 203 ? THR A 187 GLY A 202 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 9 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 8 A MG 301 1_555 ? ? ? ? ? ? ? 2.125 ? ? metalc2 metalc ? ? A ASP 52 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 51 A MG 301 1_555 ? ? ? ? ? ? ? 2.122 ? ? metalc3 metalc ? ? A ASP 54 O ? ? ? 1_555 B MG . MG ? ? A ASP 53 A MG 301 1_555 ? ? ? ? ? ? ? 2.056 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 402 1_555 ? ? ? ? ? ? ? 2.119 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 404 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 413 1_555 ? ? ? ? ? ? ? 2.159 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 85.6 ? 2 OD1 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? A ASP 54 ? A ASP 53 ? 1_555 101.7 ? 3 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? A ASP 54 ? A ASP 53 ? 1_555 92.0 ? 4 OD1 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 402 ? 1_555 74.2 ? 5 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 402 ? 1_555 81.1 ? 6 O ? A ASP 54 ? A ASP 53 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 402 ? 1_555 172.1 ? 7 OD1 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 404 ? 1_555 91.2 ? 8 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 404 ? 1_555 176.6 ? 9 O ? A ASP 54 ? A ASP 53 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 404 ? 1_555 89.7 ? 10 O ? C HOH . ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 404 ? 1_555 97.1 ? 11 OD1 ? A ASP 9 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 413 ? 1_555 155.8 ? 12 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 413 ? 1_555 79.2 ? 13 O ? A ASP 54 ? A ASP 53 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 413 ? 1_555 97.5 ? 14 O ? C HOH . ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 413 ? 1_555 84.9 ? 15 O ? C HOH . ? A HOH 404 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 413 ? 1_555 103.6 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 102 A . ? LYS 101 A PRO 103 A ? PRO 102 A 1 -2.80 2 GLU 204 A . ? GLU 203 A PRO 205 A ? PRO 204 A 1 -2.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 26 ? ALA A 31 ? ILE A 25 ALA A 30 AA1 2 MET A 2 ? VAL A 7 ? MET A 1 VAL A 6 AA1 3 ILE A 48 ? ASP A 52 ? ILE A 47 ASP A 51 AA1 4 ILE A 76 ? THR A 80 ? ILE A 75 THR A 79 AA1 5 ASP A 98 ? THR A 101 ? ASP A 97 THR A 100 AA2 1 GLU A 129 ? ILE A 130 ? GLU A 128 ILE A 129 AA2 2 LEU A 133 ? ASP A 136 ? LEU A 132 ASP A 135 AA2 3 GLU A 141 ? ARG A 144 ? GLU A 140 ARG A 143 AA2 4 ARG A 147 ? VAL A 149 ? ARG A 146 VAL A 148 AA3 1 ILE A 208 ? VAL A 211 ? ILE A 207 VAL A 210 AA3 2 GLY A 215 ? ILE A 218 ? GLY A 214 ILE A 217 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASP A 29 ? O ASP A 28 N ILE A 6 ? N ILE A 5 AA1 2 3 N LEU A 5 ? N LEU A 4 O VAL A 50 ? O VAL A 49 AA1 3 4 N ALA A 49 ? N ALA A 48 O LEU A 77 ? O LEU A 76 AA1 4 5 N MET A 78 ? N MET A 77 O LEU A 100 ? O LEU A 99 AA2 1 2 N ILE A 130 ? N ILE A 129 O LEU A 133 ? O LEU A 132 AA2 2 3 N ASP A 136 ? N ASP A 135 O GLU A 141 ? O GLU A 140 AA2 3 4 N VAL A 142 ? N VAL A 141 O VAL A 149 ? O VAL A 148 AA3 1 2 N VAL A 211 ? N VAL A 210 O GLY A 215 ? O GLY A 214 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 11 ? ? 72.58 -12.49 2 1 TRP A 179 ? ? -109.24 -72.32 3 1 PRO A 185 ? ? -65.46 83.66 # _pdbx_entry_details.entry_id 7LZ9 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 82 ? A ASP 83 2 1 Y 1 A ARG 83 ? A ARG 84 3 1 Y 1 A LEU 84 ? A LEU 85 4 1 Y 1 A ASP 85 ? A ASP 86 5 1 Y 1 A ASP 86 ? A ASP 87 6 1 Y 1 A LYS 87 ? A LYS 88 7 1 Y 1 A ALA 88 ? A ALA 89 8 1 Y 1 A SER 89 ? A SER 90 9 1 Y 1 A GLY 90 ? A GLY 91 10 1 Y 1 A PHE 91 ? A PHE 92 11 1 Y 1 A GLY 92 ? A GLY 93 12 1 Y 1 A LEU 93 ? A LEU 94 13 1 Y 1 A ALA 220 ? A ALA 221 14 1 Y 1 A PRO 221 ? A PRO 222 15 1 Y 1 A VAL 222 ? A VAL 223 16 1 Y 1 A SER 223 ? A SER 224 17 1 Y 1 A GLU 224 ? A GLU 225 18 1 Y 1 A GLN 225 ? A GLN 226 19 1 Y 1 A ALA 226 ? A ALA 227 20 1 Y 1 A GLY 227 ? A GLY 228 21 1 Y 1 A GLY 228 ? A GLY 229 22 1 Y 1 A ASP 229 ? A ASP 230 23 1 Y 1 A GLY 230 ? A GLY 231 24 1 Y 1 A GLY 231 ? A GLY 232 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 MG MG MG N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'R01 AI 148679' 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'F31 AI 136385' 2 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details unpublished # _atom_sites.entry_id 7LZ9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013444 _atom_sites.fract_transf_matrix[1][2] 0.007762 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015524 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007234 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O S # loop_