data_7M0G # _entry.id 7M0G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7M0G pdb_00007m0g 10.2210/pdb7m0g/pdb WWPDB D_1000253465 ? ? BMRB 30877 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Magic Angle Spinning NMR Structure of Human Cofilin-2 Assembled on Actin Filaments' _pdbx_database_related.db_id 30877 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7M0G _pdbx_database_status.recvd_initial_deposition_date 2021-03-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kraus, J.' 1 0000-0002-6395-6283 'Polenova, T.' 2 0000-0002-0346-1131 'Perilla, J.P.' 3 0000-0003-1171-6816 'Xu, C.' 4 0000-0002-9870-4297 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 2114 _citation.page_last 2114 _citation.title ;Magic angle spinning NMR structure of human cofilin-2 assembled on actin filaments reveals isoform-specific conformation and binding mode. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-022-29595-9 _citation.pdbx_database_id_PubMed 35440100 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kraus, J.' 1 0000-0002-6395-6283 primary 'Russell, R.W.' 2 0000-0002-3599-133X primary 'Kudryashova, E.' 3 ? primary 'Xu, C.' 4 0000-0002-9870-4297 primary 'Katyal, N.' 5 ? primary 'Perilla, J.R.' 6 0000-0003-1171-6816 primary 'Kudryashov, D.S.' 7 0000-0003-1782-3305 primary 'Polenova, T.' 8 0000-0002-0346-1131 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Cofilin-2 _entity.formula_weight 18765.627 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cofilin,muscle isoform' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL ; _entity_poly.pdbx_seq_one_letter_code_can ;MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 GLY n 1 5 VAL n 1 6 THR n 1 7 VAL n 1 8 ASN n 1 9 ASP n 1 10 GLU n 1 11 VAL n 1 12 ILE n 1 13 LYS n 1 14 VAL n 1 15 PHE n 1 16 ASN n 1 17 ASP n 1 18 MET n 1 19 LYS n 1 20 VAL n 1 21 ARG n 1 22 LYS n 1 23 SER n 1 24 SER n 1 25 THR n 1 26 GLN n 1 27 GLU n 1 28 GLU n 1 29 ILE n 1 30 LYS n 1 31 LYS n 1 32 ARG n 1 33 LYS n 1 34 LYS n 1 35 ALA n 1 36 VAL n 1 37 LEU n 1 38 PHE n 1 39 CYS n 1 40 LEU n 1 41 SER n 1 42 ASP n 1 43 ASP n 1 44 LYS n 1 45 ARG n 1 46 GLN n 1 47 ILE n 1 48 ILE n 1 49 VAL n 1 50 GLU n 1 51 GLU n 1 52 ALA n 1 53 LYS n 1 54 GLN n 1 55 ILE n 1 56 LEU n 1 57 VAL n 1 58 GLY n 1 59 ASP n 1 60 ILE n 1 61 GLY n 1 62 ASP n 1 63 THR n 1 64 VAL n 1 65 GLU n 1 66 ASP n 1 67 PRO n 1 68 TYR n 1 69 THR n 1 70 SER n 1 71 PHE n 1 72 VAL n 1 73 LYS n 1 74 LEU n 1 75 LEU n 1 76 PRO n 1 77 LEU n 1 78 ASN n 1 79 ASP n 1 80 CYS n 1 81 ARG n 1 82 TYR n 1 83 ALA n 1 84 LEU n 1 85 TYR n 1 86 ASP n 1 87 ALA n 1 88 THR n 1 89 TYR n 1 90 GLU n 1 91 THR n 1 92 LYS n 1 93 GLU n 1 94 SER n 1 95 LYS n 1 96 LYS n 1 97 GLU n 1 98 ASP n 1 99 LEU n 1 100 VAL n 1 101 PHE n 1 102 ILE n 1 103 PHE n 1 104 TRP n 1 105 ALA n 1 106 PRO n 1 107 GLU n 1 108 SER n 1 109 ALA n 1 110 PRO n 1 111 LEU n 1 112 LYS n 1 113 SER n 1 114 LYS n 1 115 MET n 1 116 ILE n 1 117 TYR n 1 118 ALA n 1 119 SER n 1 120 SER n 1 121 LYS n 1 122 ASP n 1 123 ALA n 1 124 ILE n 1 125 LYS n 1 126 LYS n 1 127 LYS n 1 128 PHE n 1 129 THR n 1 130 GLY n 1 131 ILE n 1 132 LYS n 1 133 HIS n 1 134 GLU n 1 135 TRP n 1 136 GLN n 1 137 VAL n 1 138 ASN n 1 139 GLY n 1 140 LEU n 1 141 ASP n 1 142 ASP n 1 143 ILE n 1 144 LYS n 1 145 ASP n 1 146 ARG n 1 147 SER n 1 148 THR n 1 149 LEU n 1 150 GLY n 1 151 GLU n 1 152 LYS n 1 153 LEU n 1 154 GLY n 1 155 GLY n 1 156 ASN n 1 157 VAL n 1 158 VAL n 1 159 VAL n 1 160 SER n 1 161 LEU n 1 162 GLU n 1 163 GLY n 1 164 LYS n 1 165 PRO n 1 166 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 166 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CFL2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COF2_HUMAN _struct_ref.pdbx_db_accession Q9Y281 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7M0G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 166 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y281 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 166 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 166 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 Exp1_CORD50ms 1 isotropic 2 1 1 Exp2_CORD200ms 1 isotropic 3 1 2 Exp3_CORD50ms 1 isotropic 4 1 2 Exp4_CORD200ms 1 isotropic 5 1 2 Exp5_CORD500ms 1 isotropic 6 1 3 Exp6_CORD50ms 1 isotropic 7 1 3 Exp7_CORD200ms 1 isotropic 8 1 3 Exp8_CORD500ms 1 isotropic 9 1 3 Exp9_PAINCP 1 isotropic 10 1 1 Exp10_NCACX2d 1 isotropic 11 1 1 Exp11_NCACX3d 1 isotropic 12 1 1 Exp12_NCOCX2d 1 isotropic 13 1 1 Exp13_NCOCX3d 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 273 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'cofilin condition' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '20.8 % w/w [U-13C; U-15N] human cofilin-2, 79.2 % w/w NA-actin F-actin, solid' solid '[U-13C; U-15N]-cofilin2' solid 'Uniformly labeled human cofilin-2 in complex with natural abundance actin filaments obtained using rabbit skeletal muscle actin' 2 '20.8 % w/w [1,6-13C]-glucose, U-15N human cofilin-2, 79.2 % w/w NA-actin F-actin, solid' solid '[1,6-13C]-glucose, U-15N-cofilin2' solid 'Selectively labeled human cofilin-2 in complex with natural abundance actin filaments obtained using rabbit skeletal muscle actin' 3 '20.8 % w/w [2-13C]-glucose, U-15N human cofilin-2, 79.2 % w/w NA-actin F-actin, solid' solid '[2-13C]-glucose, U-15N-cofilin2' solid 'Selectively labeled human cofilin-2 in complex with natural abundance actin filaments obtained using rabbit skeletal muscle actin' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7M0G _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 7M0G _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7M0G _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 8 processing 'Rowland NMR Toolkit (RNMRTK)' ? 'Hoch and Stern' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN 5 'structure calculation' TALOS-N ? 'Cornilescu, Delaglio and Bax' 6 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 7 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7M0G _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLID-STATE NMR' _exptl.method_details ? # _struct.entry_id 7M0G _struct.title 'Magic Angle Spinning NMR Structure of Human Cofilin-2 Assembled on Actin Filaments' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7M0G _struct_keywords.text 'actin filament binding, actin filament severing, cytoskeletal assembly, CONTRACTILE PROTEIN' _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 11 ? VAL A 20 ? VAL A 11 VAL A 20 1 ? 10 HELX_P HELX_P2 AA2 GLU A 27 ? ARG A 32 ? GLU A 27 ARG A 32 1 ? 6 HELX_P HELX_P3 AA3 LEU A 56 ? GLY A 61 ? LEU A 56 GLY A 61 1 ? 6 HELX_P HELX_P4 AA4 PRO A 67 ? LEU A 75 ? PRO A 67 LEU A 75 1 ? 9 HELX_P HELX_P5 AA5 PRO A 110 ? PHE A 128 ? PRO A 110 PHE A 128 1 ? 19 HELX_P HELX_P6 AA6 GLY A 139 ? ASP A 145 ? GLY A 139 ASP A 145 1 ? 7 HELX_P HELX_P7 AA7 ASP A 145 ? GLY A 154 ? ASP A 145 GLY A 154 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 6 ? VAL A 7 ? THR A 6 VAL A 7 AA1 2 GLN A 46 ? VAL A 49 ? GLN A 46 VAL A 49 AA1 3 PHE A 38 ? LEU A 40 ? PHE A 38 LEU A 40 AA2 1 ILE A 131 ? VAL A 137 ? ILE A 131 VAL A 137 AA2 2 LYS A 95 ? TRP A 104 ? LYS A 95 TRP A 104 AA2 3 ARG A 81 ? GLU A 90 ? ARG A 81 GLU A 90 AA2 4 SER A 160 ? LEU A 161 ? SER A 160 LEU A 161 AA2 5 LYS A 164 ? PRO A 165 ? LYS A 164 PRO A 165 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 6 ? N THR A 6 O ILE A 47 ? O ILE A 47 AA1 2 3 O ILE A 48 ? O ILE A 48 N CYS A 39 ? N CYS A 39 AA2 1 2 O VAL A 137 ? O VAL A 137 N PHE A 103 ? N PHE A 103 AA2 2 3 O ILE A 102 ? O ILE A 102 N ALA A 83 ? N ALA A 83 AA2 3 4 N GLU A 90 ? N GLU A 90 O SER A 160 ? O SER A 160 AA2 4 5 N LEU A 161 ? N LEU A 161 O LYS A 164 ? O LYS A 164 # _atom_sites.entry_id 7M0G _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 MET 115 115 115 MET MET A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 LEU 166 166 166 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-20 2 'Structure model' 1 1 2022-05-04 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'human cofilin-2' 20.8 ? '% w/w' '[U-13C; U-15N]' 1 F-actin 79.2 ? '% w/w' NA-actin 2 'human cofilin-2' 20.8 ? '% w/w' '[1,6-13C]-glucose, U-15N' 2 F-actin 79.2 ? '% w/w' NA-actin 3 'human cofilin-2' 20.8 ? '% w/w' '[2-13C]-glucose, U-15N' 3 F-actin 79.2 ? '% w/w' NA-actin # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 20 ? ? -104.01 53.60 2 1 GLN A 26 ? ? -94.43 -66.16 3 1 ALA A 35 ? ? -173.58 140.03 4 1 ASN A 138 ? ? -149.98 12.12 5 2 VAL A 20 ? ? -101.95 68.87 6 2 GLN A 26 ? ? -93.14 -68.73 7 2 GLU A 27 ? ? -90.97 -60.52 8 2 LYS A 33 ? ? -45.42 153.05 9 2 ALA A 35 ? ? -172.56 133.87 10 2 ASN A 78 ? ? -104.50 41.26 11 3 VAL A 20 ? ? -108.79 79.12 12 3 GLN A 26 ? ? -95.54 -65.60 13 3 LYS A 33 ? ? -45.12 159.08 14 3 ALA A 35 ? ? -176.45 135.42 15 3 ASN A 78 ? ? -150.31 57.63 16 3 PHE A 128 ? ? -90.91 58.05 17 3 ASN A 138 ? ? -160.05 17.20 18 4 GLN A 26 ? ? -92.95 -67.85 19 4 GLU A 27 ? ? -90.23 -61.05 20 4 LYS A 33 ? ? -45.12 158.85 21 4 ALA A 35 ? ? -175.15 132.83 22 4 LYS A 95 ? ? -55.77 174.85 23 4 GLU A 162 ? ? 58.05 18.50 24 5 GLN A 26 ? ? -92.58 -66.63 25 5 ALA A 35 ? ? -175.93 134.78 26 5 ASP A 62 ? ? -130.44 -41.47 27 5 ASN A 78 ? ? -145.05 44.79 28 5 PHE A 128 ? ? -100.84 50.54 29 6 GLN A 26 ? ? -95.82 -66.04 30 6 ALA A 35 ? ? -175.59 134.16 31 6 ASN A 78 ? ? -156.23 73.91 32 6 ALA A 105 ? ? -160.84 104.89 33 6 PHE A 128 ? ? -104.33 44.99 34 6 ASN A 138 ? ? -116.73 -72.25 35 7 GLN A 26 ? ? -94.23 -68.28 36 7 GLU A 27 ? ? -90.73 -62.07 37 7 LYS A 33 ? ? -45.71 158.91 38 7 ALA A 35 ? ? -172.64 131.09 39 7 ASP A 62 ? ? -145.20 -37.30 40 7 ALA A 87 ? ? -65.68 99.25 41 7 ALA A 105 ? ? -162.75 104.84 42 7 PHE A 128 ? ? -95.57 59.68 43 7 ASN A 138 ? ? -143.15 17.92 44 8 GLN A 26 ? ? -93.57 -65.25 45 8 ARG A 32 ? ? 29.49 44.40 46 8 ALA A 35 ? ? -174.28 135.18 47 8 PHE A 128 ? ? -96.83 53.25 48 8 ASN A 138 ? ? -70.02 -83.18 49 9 GLN A 26 ? ? -93.55 -66.19 50 9 LYS A 33 ? ? -47.51 156.23 51 9 ALA A 35 ? ? -174.38 134.55 52 9 ASP A 79 ? ? -176.43 -173.86 53 10 GLN A 26 ? ? -92.45 -66.38 54 10 GLU A 27 ? ? -90.45 -60.46 55 10 ALA A 35 ? ? -173.85 132.11 56 10 ASP A 62 ? ? -127.17 -70.58 57 10 VAL A 159 ? ? 73.36 -42.79 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' 1247394 1 'National Science Foundation (NSF, United States)' 'United States' CHE0959496 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P30GM110758 3 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details 'Confirmed by negative-stain TEM and co-sedimentation assay' #