data_7M1D # _entry.id 7M1D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7M1D pdb_00007m1d 10.2210/pdb7m1d/pdb WWPDB D_1000254104 ? ? BMRB 30878 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Structural and functional studies about scorpine showed the presence of blocking channel and cytolytic activities as well as two different structural domains ; _pdbx_database_related.db_id 30878 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7M1D _pdbx_database_status.recvd_initial_deposition_date 2021-03-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'del Rio-Portilla, F.' 1 0000-0001-8672-0567 'Lopez-Giraldo, A.E.' 2 0000-0001-5319-4409 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Toxicon _citation.journal_id_ASTM TOXIA6 _citation.journal_id_CSD 2043 _citation.journal_id_ISSN 0041-0101 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 222 _citation.language ? _citation.page_first 106985 _citation.page_last 106985 _citation.title 'Structural and functional studies of scorpine: A channel blocker and cytolytic peptide.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.toxicon.2022.106985 _citation.pdbx_database_id_PubMed 36436588 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lopez-Giraldo, E.' 1 ? primary 'Carrillo, E.' 2 ? primary 'Titaux-Delgado, G.' 3 ? primary 'Cano-Sanchez, P.' 4 ? primary 'Colorado, A.' 5 ? primary 'Possani, L.D.' 6 ? primary 'Rio-Portilla, F.D.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Scorpine _entity.formula_weight 5310.185 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal residues 48-94' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Scorpin,Panscorpine # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GVHKMAKNEFQCMANMDMLGNCEKHCQTSGEKGYCHGTKCKCGTPLSY _entity_poly.pdbx_seq_one_letter_code_can GVHKMAKNEFQCMANMDMLGNCEKHCQTSGEKGYCHGTKCKCGTPLSY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 HIS n 1 4 LYS n 1 5 MET n 1 6 ALA n 1 7 LYS n 1 8 ASN n 1 9 GLU n 1 10 PHE n 1 11 GLN n 1 12 CYS n 1 13 MET n 1 14 ALA n 1 15 ASN n 1 16 MET n 1 17 ASP n 1 18 MET n 1 19 LEU n 1 20 GLY n 1 21 ASN n 1 22 CYS n 1 23 GLU n 1 24 LYS n 1 25 HIS n 1 26 CYS n 1 27 GLN n 1 28 THR n 1 29 SER n 1 30 GLY n 1 31 GLU n 1 32 LYS n 1 33 GLY n 1 34 TYR n 1 35 CYS n 1 36 HIS n 1 37 GLY n 1 38 THR n 1 39 LYS n 1 40 CYS n 1 41 LYS n 1 42 CYS n 1 43 GLY n 1 44 THR n 1 45 PRO n 1 46 LEU n 1 47 SER n 1 48 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 48 _entity_src_gen.gene_src_common_name 'Emperor scorpion' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pandinus imperator' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 55084 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KBX3_PANIM _struct_ref.pdbx_db_accession P56972 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VHKMAKNEFQCMANMDMLGNCEKHCQTSGEKGYCHGTKCKCGTPLSY _struct_ref.pdbx_align_begin 48 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7M1D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 48 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56972 _struct_ref_seq.db_align_beg 48 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 48 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7M1D _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P56972 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H COSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '5 mM C-terminal extreme scorpine, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 1H _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7M1D _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 7M1D _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7M1D _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber 16 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, and Kollman' 2 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CARA 1.5 'Keller and Wuthrich' 4 'peak picking' CARA 1.5 'Keller and Wuthrich' 5 processing NMRPipe 2014 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7M1D _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7M1D _struct.title ;Structural and functional studies about scorpine showed the presence of blocking channel and cytolytic activities as well as two different structural domains ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7M1D _struct_keywords.text 'scorpion toxins, potassium channels, scorpine like-peptides, cytolytic peptides, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 30 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 26 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 30 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 12 A CYS 35 1_555 ? ? ? ? ? ? ? 2.042 ? ? disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 22 A CYS 40 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf3 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 26 A CYS 42 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 32 ? TYR A 34 ? LYS A 32 TYR A 34 AA1 2 LYS A 41 ? GLY A 43 ? LYS A 41 GLY A 43 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 34 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 34 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 41 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 41 # _atom_sites.entry_id 7M1D _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 TYR 48 48 48 TYR TYR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-19 2 'Structure model' 1 1 2022-12-21 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'C-terminal extreme scorpine' _pdbx_nmr_exptl_sample.concentration 5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 6 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 26 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 26 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 26 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 120.85 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 6.65 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 10 ? ? 60.90 -40.80 2 1 ASN A 15 ? ? -62.43 7.57 3 1 LEU A 19 ? ? -95.27 50.71 4 1 ASN A 21 ? ? -74.84 20.41 5 1 LEU A 46 ? ? 59.89 170.08 6 2 MET A 16 ? ? -144.64 31.18 7 2 HIS A 36 ? ? -78.93 -152.70 8 2 THR A 38 ? ? -76.59 42.62 9 3 ALA A 14 ? ? -129.80 -161.43 10 3 LEU A 46 ? ? 55.39 5.93 11 4 HIS A 3 ? ? -83.33 30.08 12 4 LYS A 7 ? ? -76.92 37.90 13 4 GLN A 11 ? ? 57.90 12.03 14 4 MET A 13 ? ? -77.47 35.50 15 4 ALA A 14 ? ? -67.83 -178.69 16 4 ASN A 21 ? ? 62.11 167.89 17 4 PRO A 45 ? ? -59.66 -6.10 18 4 SER A 47 ? ? 67.21 147.20 19 5 ASP A 17 ? ? -152.32 77.61 20 5 HIS A 36 ? ? -120.18 -164.65 21 6 GLU A 9 ? ? -82.28 41.46 22 6 GLN A 11 ? ? 56.50 5.88 23 6 CYS A 22 ? ? 58.34 5.11 24 6 CYS A 40 ? ? -172.29 125.68 25 6 CYS A 42 ? ? 50.55 170.63 26 7 GLN A 11 ? ? 49.13 25.86 27 7 GLU A 23 ? ? 56.90 -168.75 28 7 LYS A 24 ? ? -63.44 1.02 29 7 LEU A 46 ? ? 69.87 139.48 30 8 ASN A 8 ? ? -140.15 -22.80 31 8 GLN A 11 ? ? 54.59 79.45 32 8 CYS A 12 ? ? 56.40 1.17 33 8 ASN A 15 ? ? -155.81 -50.00 34 8 ASP A 17 ? ? -79.60 41.36 35 8 THR A 38 ? ? -151.81 18.41 36 8 SER A 47 ? ? -58.35 5.90 37 9 ASN A 8 ? ? -159.52 -56.74 38 9 ASN A 15 ? ? -77.98 26.91 39 10 ASN A 21 ? ? -158.41 23.75 40 10 THR A 38 ? ? -152.58 -16.46 41 10 CYS A 40 ? ? -160.19 117.00 42 11 ASN A 8 ? ? -87.00 39.24 43 11 HIS A 36 ? ? -83.12 -158.48 44 12 PHE A 10 ? ? -62.70 65.92 45 12 GLN A 11 ? ? 72.51 -14.14 46 12 ASN A 15 ? ? -66.86 16.88 47 12 ASN A 21 ? ? -148.24 -34.03 48 12 CYS A 22 ? ? -153.66 -34.10 49 12 SER A 47 ? ? -78.97 41.90 50 13 HIS A 3 ? ? 65.03 -49.89 51 13 LYS A 7 ? ? -147.57 -5.52 52 13 ASN A 15 ? ? -132.34 -36.75 53 13 LEU A 46 ? ? 54.76 6.37 54 14 HIS A 3 ? ? -82.41 34.48 55 14 ALA A 6 ? ? 56.17 84.98 56 14 ASP A 17 ? ? -55.08 -9.13 57 14 LEU A 19 ? ? 46.43 13.74 58 14 THR A 38 ? ? -135.51 -33.55 59 15 MET A 5 ? ? -143.74 -7.39 60 15 LYS A 7 ? ? -67.15 3.93 61 15 GLN A 11 ? ? 37.70 85.00 62 15 ASP A 17 ? ? -152.23 2.65 63 15 CYS A 22 ? ? -159.63 -36.86 64 15 SER A 47 ? ? -143.58 58.07 65 16 VAL A 2 ? ? 59.13 99.46 66 16 LYS A 7 ? ? -141.05 -23.41 67 16 ASN A 8 ? ? -143.98 -24.98 68 16 MET A 13 ? ? -73.66 21.38 69 16 MET A 18 ? ? -142.15 -6.47 70 17 LYS A 4 ? ? -83.48 39.27 71 17 MET A 5 ? ? -158.86 34.47 72 17 CYS A 12 ? ? -153.69 71.48 73 17 MET A 16 ? ? -74.46 35.84 74 18 ALA A 6 ? ? -153.12 -31.63 75 18 ASN A 8 ? ? -93.92 38.67 76 19 CYS A 12 ? ? 58.39 15.69 77 19 CYS A 22 ? ? -144.98 -25.54 78 19 SER A 47 ? ? 57.68 16.96 79 20 MET A 5 ? ? 53.47 85.53 80 20 ALA A 6 ? ? -159.79 79.82 81 20 CYS A 12 ? ? 53.97 14.50 82 20 MET A 13 ? ? 49.76 27.91 83 20 ASN A 21 ? ? -150.42 -15.82 84 20 LYS A 32 ? ? -55.49 -74.38 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 HIS A 36 ? ? 0.116 'SIDE CHAIN' 2 6 TYR A 34 ? ? 0.069 'SIDE CHAIN' 3 8 TYR A 48 ? ? 0.066 'SIDE CHAIN' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #