data_7M3Z # _entry.id 7M3Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7M3Z pdb_00007m3z 10.2210/pdb7m3z/pdb WWPDB D_1000255609 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '7M3Y contains the same protein complexed with a different ligand.' _pdbx_database_related.db_id 7M3Y _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7M3Z _pdbx_database_status.recvd_initial_deposition_date 2021-03-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Rietz, T.A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 14757 _citation.page_last 14772 _citation.title 'Fragment-Based Discovery of Small Molecules Bound to T-Cell Immunoglobulin and Mucin Domain-Containing Molecule 3 (TIM-3).' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c01336 _citation.pdbx_database_id_PubMed 34597046 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rietz, T.A.' 1 ? primary 'Teuscher, K.B.' 2 ? primary 'Mills, J.J.' 3 ? primary 'Gogliotti, R.D.' 4 ? primary 'Lepovitz, L.T.' 5 ? primary 'Scaggs, W.R.' 6 ? primary 'Yoshida, K.' 7 ? primary 'Luong, K.' 8 ? primary 'Lee, T.' 9 ? primary 'Fesik, S.W.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7M3Z _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.928 _cell.length_a_esd ? _cell.length_b 85.168 _cell.length_b_esd ? _cell.length_c 53.476 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7M3Z _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hepatitis A virus cellular receptor 2' 12298.002 1 ? ? ? ? 2 non-polymer syn 'N-{4-[(4S,10aP)-8-chloro-2-methyl-5-oxo-5,6-dihydro[1,2,4]triazolo[1,5-c]quinazolin-9-yl]-3-methylphenyl}methanesulfonamide' 417.869 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 139 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;HAVcr-2,T-cell immunoglobulin and mucin domain-containing protein 3,TIMD-3,T-cell immunoglobulin mucin receptor 3,TIM-3,T-cell membrane protein 3 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVT LADSGIYCCRIQIPGIMNDEKFNLKLVIK ; _entity_poly.pdbx_seq_one_letter_code_can ;SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVT LADSGIYCCRIQIPGIMNDEKFNLKLVIK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 VAL n 1 4 GLU n 1 5 TYR n 1 6 ARG n 1 7 ALA n 1 8 GLU n 1 9 VAL n 1 10 GLY n 1 11 GLN n 1 12 ASN n 1 13 ALA n 1 14 TYR n 1 15 LEU n 1 16 PRO n 1 17 CYS n 1 18 PHE n 1 19 TYR n 1 20 THR n 1 21 PRO n 1 22 ALA n 1 23 ALA n 1 24 PRO n 1 25 GLY n 1 26 ASN n 1 27 LEU n 1 28 VAL n 1 29 PRO n 1 30 VAL n 1 31 CYS n 1 32 TRP n 1 33 GLY n 1 34 LYS n 1 35 GLY n 1 36 ALA n 1 37 CYS n 1 38 PRO n 1 39 VAL n 1 40 PHE n 1 41 GLU n 1 42 CYS n 1 43 GLY n 1 44 ASN n 1 45 VAL n 1 46 VAL n 1 47 LEU n 1 48 ARG n 1 49 THR n 1 50 ASP n 1 51 GLU n 1 52 ARG n 1 53 ASP n 1 54 VAL n 1 55 ASN n 1 56 TYR n 1 57 TRP n 1 58 THR n 1 59 SER n 1 60 ARG n 1 61 TYR n 1 62 TRP n 1 63 LEU n 1 64 ASN n 1 65 GLY n 1 66 ASP n 1 67 PHE n 1 68 ARG n 1 69 LYS n 1 70 GLY n 1 71 ASP n 1 72 VAL n 1 73 SER n 1 74 LEU n 1 75 THR n 1 76 ILE n 1 77 GLU n 1 78 ASN n 1 79 VAL n 1 80 THR n 1 81 LEU n 1 82 ALA n 1 83 ASP n 1 84 SER n 1 85 GLY n 1 86 ILE n 1 87 TYR n 1 88 CYS n 1 89 CYS n 1 90 ARG n 1 91 ILE n 1 92 GLN n 1 93 ILE n 1 94 PRO n 1 95 GLY n 1 96 ILE n 1 97 MET n 1 98 ASN n 1 99 ASP n 1 100 GLU n 1 101 LYS n 1 102 PHE n 1 103 ASN n 1 104 LEU n 1 105 LYS n 1 106 LEU n 1 107 VAL n 1 108 ILE n 1 109 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HAVCR2, TIM3, TIMD3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HAVR2_HUMAN _struct_ref.pdbx_db_accession Q8TDQ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVT LADSGIYCCRIQIPGIMNDEKFNLKLVIK ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7M3Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8TDQ0 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YQD non-polymer . 'N-{4-[(4S,10aP)-8-chloro-2-methyl-5-oxo-5,6-dihydro[1,2,4]triazolo[1,5-c]quinazolin-9-yl]-3-methylphenyl}methanesulfonamide' ? 'C18 H16 Cl N5 O3 S' 417.869 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7M3Z _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.247 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.8 M sodium tartrate dibasic dihydrate, 0.1 M HEPES pH 6.8-8.2, and 10 mM CaCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 12.150 _reflns.entry_id 7M3Z _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.400 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21544 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.000 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.437 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.061 _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 172502 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.400 1.420 ? ? ? ? ? ? 1079 100.000 ? ? ? ? 0.416 ? ? ? ? ? ? ? ? 7.200 ? 0.889 ? ? 0.448 0.165 ? 1 1 0.924 ? ? 1.420 1.450 ? ? ? ? ? ? 1045 100.000 ? ? ? ? 0.375 ? ? ? ? ? ? ? ? 8.000 ? 0.889 ? ? 0.401 0.140 ? 2 1 0.949 ? ? 1.450 1.480 ? ? ? ? ? ? 1075 100.000 ? ? ? ? 0.334 ? ? ? ? ? ? ? ? 8.000 ? 0.923 ? ? 0.357 0.124 ? 3 1 0.959 ? ? 1.480 1.510 ? ? ? ? ? ? 1051 100.000 ? ? ? ? 0.290 ? ? ? ? ? ? ? ? 8.100 ? 1.021 ? ? 0.310 0.108 ? 4 1 0.960 ? ? 1.510 1.540 ? ? ? ? ? ? 1052 100.000 ? ? ? ? 0.265 ? ? ? ? ? ? ? ? 8.000 ? 1.032 ? ? 0.283 0.099 ? 5 1 0.972 ? ? 1.540 1.580 ? ? ? ? ? ? 1078 100.000 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 8.000 ? 1.069 ? ? 0.238 0.083 ? 6 1 0.980 ? ? 1.580 1.620 ? ? ? ? ? ? 1060 100.000 ? ? ? ? 0.189 ? ? ? ? ? ? ? ? 8.100 ? 1.168 ? ? 0.202 0.070 ? 7 1 0.983 ? ? 1.620 1.660 ? ? ? ? ? ? 1050 100.000 ? ? ? ? 0.164 ? ? ? ? ? ? ? ? 8.100 ? 1.338 ? ? 0.175 0.061 ? 8 1 0.990 ? ? 1.660 1.710 ? ? ? ? ? ? 1068 100.000 ? ? ? ? 0.160 ? ? ? ? ? ? ? ? 8.100 ? 1.346 ? ? 0.170 0.059 ? 9 1 0.988 ? ? 1.710 1.760 ? ? ? ? ? ? 1065 100.000 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 8.100 ? 1.461 ? ? 0.152 0.053 ? 10 1 0.990 ? ? 1.760 1.830 ? ? ? ? ? ? 1070 100.000 ? ? ? ? 0.129 ? ? ? ? ? ? ? ? 8.100 ? 1.846 ? ? 0.137 0.047 ? 11 1 0.992 ? ? 1.830 1.900 ? ? ? ? ? ? 1070 100.000 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 8.100 ? 1.957 ? ? 0.116 0.040 ? 12 1 0.994 ? ? 1.900 1.990 ? ? ? ? ? ? 1070 100.000 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 8.100 ? 2.012 ? ? 0.097 0.034 ? 13 1 0.996 ? ? 1.990 2.090 ? ? ? ? ? ? 1080 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 8.200 ? 1.909 ? ? 0.083 0.028 ? 14 1 0.996 ? ? 2.090 2.220 ? ? ? ? ? ? 1091 100.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 8.100 ? 1.644 ? ? 0.070 0.024 ? 15 1 0.997 ? ? 2.220 2.390 ? ? ? ? ? ? 1069 100.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 8.100 ? 1.889 ? ? 0.067 0.023 ? 16 1 0.997 ? ? 2.390 2.630 ? ? ? ? ? ? 1088 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 8.100 ? 2.040 ? ? 0.063 0.022 ? 17 1 0.997 ? ? 2.630 3.020 ? ? ? ? ? ? 1098 100.000 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 8.100 ? 1.592 ? ? 0.044 0.015 ? 18 1 0.999 ? ? 3.020 3.800 ? ? ? ? ? ? 1110 100.000 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 8.000 ? 1.313 ? ? 0.032 0.011 ? 19 1 0.999 ? ? 3.800 30.000 ? ? ? ? ? ? 1175 99.900 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 7.500 ? 1.275 ? ? 0.029 0.010 ? 20 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 56.020 _refine.B_iso_mean 17.7081 _refine.B_iso_min 6.290 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7M3Z _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4000 _refine.ls_d_res_low 26.7400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21523 _refine.ls_number_reflns_R_free 1006 _refine.ls_number_reflns_R_work 20517 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9500 _refine.ls_percent_reflns_R_free 4.6700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1837 _refine.ls_R_factor_R_free 0.1954 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1831 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5F71 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.5000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.4000 _refine_hist.d_res_low 26.7400 _refine_hist.number_atoms_solvent 139 _refine_hist.number_atoms_total 1030 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 109 _refine_hist.pdbx_B_iso_mean_ligand 13.19 _refine_hist.pdbx_B_iso_mean_solvent 25.99 _refine_hist.pdbx_number_atoms_protein 862 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4000 1.4700 3025 . 119 2906 100.0000 . . . 0.2553 0.0000 0.2207 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.4700 1.5700 3046 . 132 2914 100.0000 . . . 0.2604 0.0000 0.2004 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.5700 1.6900 3022 . 175 2847 100.0000 . . . 0.2214 0.0000 0.1860 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.6900 1.8600 3054 . 156 2898 100.0000 . . . 0.2365 0.0000 0.1852 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.8600 2.1200 3073 . 145 2928 100.0000 . . . 0.1800 0.0000 0.1790 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.1200 2.6800 3092 . 122 2970 100.0000 . . . 0.2246 0.0000 0.1962 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.6800 26.7400 3211 . 157 3054 100.0000 . . . 0.1634 0.0000 0.1690 . . . . . . . 7 . . . # _struct.entry_id 7M3Z _struct.title ;Structure of TIM-3 in complex with N-(4-(8-chloro-2-mehtyl-5-oxo-5,6-dihydro-[1,2,4]triazolo[1,5-c]quinazolin-9-yl)-3-methylphenyl)methanesulfonamdide (compound 35) ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7M3Z _struct_keywords.text 'IgV, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 66 ? GLY A 70 ? ASP A 66 GLY A 70 5 ? 5 HELX_P HELX_P2 AA2 THR A 80 ? SER A 84 ? THR A 80 SER A 84 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 89 SG ? ? A CYS 17 A CYS 89 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 31 A CYS 42 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf3 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 37 A CYS 88 1_555 ? ? ? ? ? ? ? 2.051 ? ? metalc1 metalc ? ? A ILE 93 O ? ? ? 1_555 C CA . CA ? ? A ILE 93 A CA 202 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc2 metalc ? ? A GLY 95 O ? ? ? 1_555 C CA . CA ? ? A GLY 95 A CA 202 1_555 ? ? ? ? ? ? ? 2.361 ? ? metalc3 metalc ? ? A ASN 98 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 98 A CA 202 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc4 metalc ? ? A ASP 99 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 99 A CA 202 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 202 A HOH 402 1_555 ? ? ? ? ? ? ? 2.414 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 5 ? GLU A 8 ? TYR A 5 GLU A 8 AA1 2 GLU A 100 ? LYS A 109 ? GLU A 100 LYS A 109 AA1 3 GLY A 85 ? ILE A 91 ? GLY A 85 ILE A 91 AA1 4 VAL A 30 ? LYS A 34 ? VAL A 30 LYS A 34 AA1 5 ASN A 44 ? THR A 49 ? ASN A 44 THR A 49 AA1 6 VAL A 54 ? TRP A 57 ? VAL A 54 TRP A 57 AA2 1 ALA A 13 ? LEU A 15 ? ALA A 13 LEU A 15 AA2 2 LEU A 74 ? ILE A 76 ? LEU A 74 ILE A 76 AA2 3 TYR A 61 ? TRP A 62 ? TYR A 61 TRP A 62 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 5 ? N TYR A 5 O VAL A 107 ? O VAL A 107 AA1 2 3 O LEU A 106 ? O LEU A 106 N GLY A 85 ? N GLY A 85 AA1 3 4 O ARG A 90 ? O ARG A 90 N CYS A 31 ? N CYS A 31 AA1 4 5 N LYS A 34 ? N LYS A 34 O ASN A 44 ? O ASN A 44 AA1 5 6 N ARG A 48 ? N ARG A 48 O TYR A 56 ? O TYR A 56 AA2 1 2 N LEU A 15 ? N LEU A 15 O LEU A 74 ? O LEU A 74 AA2 2 3 O THR A 75 ? O THR A 75 N TRP A 62 ? N TRP A 62 # _atom_sites.entry_id 7M3Z _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.021309 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011741 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018700 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LYS 109 109 109 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 YQD 1 201 201 YQD LIG A . C 3 CA 1 202 1 CA CA A . D 4 HOH 1 301 118 HOH HOH A . D 4 HOH 2 302 48 HOH HOH A . D 4 HOH 3 303 58 HOH HOH A . D 4 HOH 4 304 119 HOH HOH A . D 4 HOH 5 305 80 HOH HOH A . D 4 HOH 6 306 129 HOH HOH A . D 4 HOH 7 307 16 HOH HOH A . D 4 HOH 8 308 66 HOH HOH A . D 4 HOH 9 309 55 HOH HOH A . D 4 HOH 10 310 76 HOH HOH A . D 4 HOH 11 311 45 HOH HOH A . D 4 HOH 12 312 13 HOH HOH A . D 4 HOH 13 313 120 HOH HOH A . D 4 HOH 14 314 9 HOH HOH A . D 4 HOH 15 315 115 HOH HOH A . D 4 HOH 16 316 60 HOH HOH A . D 4 HOH 17 317 89 HOH HOH A . D 4 HOH 18 318 70 HOH HOH A . D 4 HOH 19 319 36 HOH HOH A . D 4 HOH 20 320 33 HOH HOH A . D 4 HOH 21 321 65 HOH HOH A . D 4 HOH 22 322 14 HOH HOH A . D 4 HOH 23 323 23 HOH HOH A . D 4 HOH 24 324 77 HOH HOH A . D 4 HOH 25 325 26 HOH HOH A . D 4 HOH 26 326 86 HOH HOH A . D 4 HOH 27 327 132 HOH HOH A . D 4 HOH 28 328 24 HOH HOH A . D 4 HOH 29 329 96 HOH HOH A . D 4 HOH 30 330 10 HOH HOH A . D 4 HOH 31 331 71 HOH HOH A . D 4 HOH 32 332 106 HOH HOH A . D 4 HOH 33 333 18 HOH HOH A . D 4 HOH 34 334 133 HOH HOH A . D 4 HOH 35 335 53 HOH HOH A . D 4 HOH 36 336 15 HOH HOH A . D 4 HOH 37 337 50 HOH HOH A . D 4 HOH 38 338 34 HOH HOH A . D 4 HOH 39 339 105 HOH HOH A . D 4 HOH 40 340 61 HOH HOH A . D 4 HOH 41 341 7 HOH HOH A . D 4 HOH 42 342 3 HOH HOH A . D 4 HOH 43 343 110 HOH HOH A . D 4 HOH 44 344 63 HOH HOH A . D 4 HOH 45 345 109 HOH HOH A . D 4 HOH 46 346 101 HOH HOH A . D 4 HOH 47 347 54 HOH HOH A . D 4 HOH 48 348 4 HOH HOH A . D 4 HOH 49 349 30 HOH HOH A . D 4 HOH 50 350 92 HOH HOH A . D 4 HOH 51 351 82 HOH HOH A . D 4 HOH 52 352 87 HOH HOH A . D 4 HOH 53 353 108 HOH HOH A . D 4 HOH 54 354 31 HOH HOH A . D 4 HOH 55 355 95 HOH HOH A . D 4 HOH 56 356 11 HOH HOH A . D 4 HOH 57 357 43 HOH HOH A . D 4 HOH 58 358 47 HOH HOH A . D 4 HOH 59 359 88 HOH HOH A . D 4 HOH 60 360 83 HOH HOH A . D 4 HOH 61 361 44 HOH HOH A . D 4 HOH 62 362 20 HOH HOH A . D 4 HOH 63 363 2 HOH HOH A . D 4 HOH 64 364 19 HOH HOH A . D 4 HOH 65 365 17 HOH HOH A . D 4 HOH 66 366 22 HOH HOH A . D 4 HOH 67 367 78 HOH HOH A . D 4 HOH 68 368 126 HOH HOH A . D 4 HOH 69 369 35 HOH HOH A . D 4 HOH 70 370 38 HOH HOH A . D 4 HOH 71 371 25 HOH HOH A . D 4 HOH 72 372 8 HOH HOH A . D 4 HOH 73 373 56 HOH HOH A . D 4 HOH 74 374 81 HOH HOH A . D 4 HOH 75 375 42 HOH HOH A . D 4 HOH 76 376 113 HOH HOH A . D 4 HOH 77 377 122 HOH HOH A . D 4 HOH 78 378 130 HOH HOH A . D 4 HOH 79 379 6 HOH HOH A . D 4 HOH 80 380 90 HOH HOH A . D 4 HOH 81 381 102 HOH HOH A . D 4 HOH 82 382 97 HOH HOH A . D 4 HOH 83 383 111 HOH HOH A . D 4 HOH 84 384 79 HOH HOH A . D 4 HOH 85 385 57 HOH HOH A . D 4 HOH 86 386 68 HOH HOH A . D 4 HOH 87 387 104 HOH HOH A . D 4 HOH 88 388 21 HOH HOH A . D 4 HOH 89 389 52 HOH HOH A . D 4 HOH 90 390 5 HOH HOH A . D 4 HOH 91 391 62 HOH HOH A . D 4 HOH 92 392 39 HOH HOH A . D 4 HOH 93 393 29 HOH HOH A . D 4 HOH 94 394 116 HOH HOH A . D 4 HOH 95 395 41 HOH HOH A . D 4 HOH 96 396 37 HOH HOH A . D 4 HOH 97 397 1 HOH HOH A . D 4 HOH 98 398 28 HOH HOH A . D 4 HOH 99 399 74 HOH HOH A . D 4 HOH 100 400 117 HOH HOH A . D 4 HOH 101 401 32 HOH HOH A . D 4 HOH 102 402 49 HOH HOH A . D 4 HOH 103 403 127 HOH HOH A . D 4 HOH 104 404 99 HOH HOH A . D 4 HOH 105 405 124 HOH HOH A . D 4 HOH 106 406 84 HOH HOH A . D 4 HOH 107 407 125 HOH HOH A . D 4 HOH 108 408 114 HOH HOH A . D 4 HOH 109 409 123 HOH HOH A . D 4 HOH 110 410 100 HOH HOH A . D 4 HOH 111 411 94 HOH HOH A . D 4 HOH 112 412 93 HOH HOH A . D 4 HOH 113 413 73 HOH HOH A . D 4 HOH 114 414 59 HOH HOH A . D 4 HOH 115 415 67 HOH HOH A . D 4 HOH 116 416 137 HOH HOH A . D 4 HOH 117 417 112 HOH HOH A . D 4 HOH 118 418 64 HOH HOH A . D 4 HOH 119 419 138 HOH HOH A . D 4 HOH 120 420 121 HOH HOH A . D 4 HOH 121 421 103 HOH HOH A . D 4 HOH 122 422 12 HOH HOH A . D 4 HOH 123 423 128 HOH HOH A . D 4 HOH 124 424 75 HOH HOH A . D 4 HOH 125 425 134 HOH HOH A . D 4 HOH 126 426 98 HOH HOH A . D 4 HOH 127 427 107 HOH HOH A . D 4 HOH 128 428 131 HOH HOH A . D 4 HOH 129 429 85 HOH HOH A . D 4 HOH 130 430 69 HOH HOH A . D 4 HOH 131 431 40 HOH HOH A . D 4 HOH 132 432 135 HOH HOH A . D 4 HOH 133 433 136 HOH HOH A . D 4 HOH 134 434 72 HOH HOH A . D 4 HOH 135 435 139 HOH HOH A . D 4 HOH 136 436 46 HOH HOH A . D 4 HOH 137 437 91 HOH HOH A . D 4 HOH 138 438 27 HOH HOH A . D 4 HOH 139 439 51 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 397 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ILE 93 ? A ILE 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLY 95 ? A GLY 95 ? 1_555 99.3 ? 2 O ? A ILE 93 ? A ILE 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASN 98 ? A ASN 98 ? 1_555 87.7 ? 3 O ? A GLY 95 ? A GLY 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASN 98 ? A ASN 98 ? 1_555 77.8 ? 4 O ? A ILE 93 ? A ILE 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 92.4 ? 5 O ? A GLY 95 ? A GLY 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 167.8 ? 6 OD1 ? A ASN 98 ? A ASN 98 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 106.5 ? 7 O ? A ILE 93 ? A ILE 93 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 402 ? 1_555 82.2 ? 8 O ? A GLY 95 ? A GLY 95 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 402 ? 1_555 89.5 ? 9 OD1 ? A ASN 98 ? A ASN 98 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 402 ? 1_555 162.3 ? 10 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 402 ? 1_555 88.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-13 2 'Structure model' 1 1 2021-10-27 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_phasing_MR.entry_id 7M3Z _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 4.490 _pdbx_phasing_MR.d_res_low_rotation 26.740 _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # _pdbx_entry_details.entry_id 7M3Z _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 394 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 400 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.07 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 335 ? ? 1_555 O A HOH 335 ? ? 3_654 1.95 2 1 O A HOH 304 ? ? 1_555 O A HOH 423 ? ? 3_554 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 40 ? ? 55.40 -126.88 2 1 CYS A 42 ? ? -148.34 39.54 3 1 ASP A 50 ? ? -121.67 -156.74 4 1 ARG A 60 ? ? 91.14 -11.12 5 1 ASN A 98 ? ? -140.62 10.45 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HOH O O N N 138 HOH H1 H N N 139 HOH H2 H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TRP N N N N 301 TRP CA C N S 302 TRP C C N N 303 TRP O O N N 304 TRP CB C N N 305 TRP CG C Y N 306 TRP CD1 C Y N 307 TRP CD2 C Y N 308 TRP NE1 N Y N 309 TRP CE2 C Y N 310 TRP CE3 C Y N 311 TRP CZ2 C Y N 312 TRP CZ3 C Y N 313 TRP CH2 C Y N 314 TRP OXT O N N 315 TRP H H N N 316 TRP H2 H N N 317 TRP HA H N N 318 TRP HB2 H N N 319 TRP HB3 H N N 320 TRP HD1 H N N 321 TRP HE1 H N N 322 TRP HE3 H N N 323 TRP HZ2 H N N 324 TRP HZ3 H N N 325 TRP HH2 H N N 326 TRP HXT H N N 327 TYR N N N N 328 TYR CA C N S 329 TYR C C N N 330 TYR O O N N 331 TYR CB C N N 332 TYR CG C Y N 333 TYR CD1 C Y N 334 TYR CD2 C Y N 335 TYR CE1 C Y N 336 TYR CE2 C Y N 337 TYR CZ C Y N 338 TYR OH O N N 339 TYR OXT O N N 340 TYR H H N N 341 TYR H2 H N N 342 TYR HA H N N 343 TYR HB2 H N N 344 TYR HB3 H N N 345 TYR HD1 H N N 346 TYR HD2 H N N 347 TYR HE1 H N N 348 TYR HE2 H N N 349 TYR HH H N N 350 TYR HXT H N N 351 VAL N N N N 352 VAL CA C N S 353 VAL C C N N 354 VAL O O N N 355 VAL CB C N N 356 VAL CG1 C N N 357 VAL CG2 C N N 358 VAL OXT O N N 359 VAL H H N N 360 VAL H2 H N N 361 VAL HA H N N 362 VAL HB H N N 363 VAL HG11 H N N 364 VAL HG12 H N N 365 VAL HG13 H N N 366 VAL HG21 H N N 367 VAL HG22 H N N 368 VAL HG23 H N N 369 VAL HXT H N N 370 YQD N1 N N N 371 YQD N3 N Y N 372 YQD C4 C Y N 373 YQD C5 C Y N 374 YQD C6 C Y N 375 YQD C7 C N N 376 YQD C8 C Y N 377 YQD C10 C N N 378 YQD C13 C Y N 379 YQD C15 C Y N 380 YQD C17 C N N 381 YQD C1 C Y N 382 YQD C11 C Y N 383 YQD C12 C Y N 384 YQD C14 C Y N 385 YQD C16 C Y N 386 YQD C18 C N N 387 YQD C2 C Y N 388 YQD C3 C Y N 389 YQD C9 C Y N 390 YQD N2 N Y N 391 YQD N4 N Y N 392 YQD N5 N N N 393 YQD O1 O N N 394 YQD O2 O N N 395 YQD O3 O N N 396 YQD S1 S N N 397 YQD CL1 CL N N 398 YQD H1 H N N 399 YQD H2 H N N 400 YQD H3 H N N 401 YQD H4 H N N 402 YQD H5 H N N 403 YQD H6 H N N 404 YQD H7 H N N 405 YQD H8 H N N 406 YQD H9 H N N 407 YQD H10 H N N 408 YQD H11 H N N 409 YQD H12 H N N 410 YQD H13 H N N 411 YQD H14 H N N 412 YQD H15 H N N 413 YQD H16 H N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 YQD CL1 C3 sing N N 355 YQD C4 C3 doub Y N 356 YQD C4 C5 sing Y N 357 YQD N1 C5 sing N N 358 YQD N1 C7 sing N N 359 YQD O1 C7 doub N N 360 YQD C3 C2 sing Y N 361 YQD C5 C6 doub Y N 362 YQD C7 N2 sing N N 363 YQD C2 C11 sing N N 364 YQD C2 C1 doub Y N 365 YQD C6 C1 sing Y N 366 YQD C6 C8 sing N N 367 YQD N2 C8 sing Y N 368 YQD N2 N3 sing Y N 369 YQD C11 C16 doub Y N 370 YQD C11 C12 sing Y N 371 YQD C17 C12 sing N N 372 YQD C8 N4 doub Y N 373 YQD C16 C15 sing Y N 374 YQD N3 C9 doub Y N 375 YQD C12 C13 doub Y N 376 YQD C15 C14 doub Y N 377 YQD C13 C14 sing Y N 378 YQD C14 N5 sing N N 379 YQD N4 C9 sing Y N 380 YQD C9 C10 sing N N 381 YQD N5 S1 sing N N 382 YQD S1 O3 doub N N 383 YQD S1 O2 doub N N 384 YQD S1 C18 sing N N 385 YQD N1 H1 sing N N 386 YQD C4 H2 sing N N 387 YQD C10 H3 sing N N 388 YQD C10 H4 sing N N 389 YQD C10 H5 sing N N 390 YQD C13 H6 sing N N 391 YQD C15 H7 sing N N 392 YQD C17 H8 sing N N 393 YQD C17 H9 sing N N 394 YQD C17 H10 sing N N 395 YQD C1 H11 sing N N 396 YQD C16 H12 sing N N 397 YQD C18 H13 sing N N 398 YQD C18 H14 sing N N 399 YQD C18 H15 sing N N 400 YQD N5 H16 sing N N 401 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id YQD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id YQD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-{4-[(4S,10aP)-8-chloro-2-methyl-5-oxo-5,6-dihydro[1,2,4]triazolo[1,5-c]quinazolin-9-yl]-3-methylphenyl}methanesulfonamide' YQD 3 'CALCIUM ION' CA 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5F71 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #