data_7MH7 # _entry.id 7MH7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.341 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7MH7 ? ? WWPDB D_1000256245 ? ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id CSGID-IDP97675 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7MH7 _pdbx_database_status.recvd_initial_deposition_date 2021-04-14 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chang, C.' 1 ? 'Evdokimova, E.' 2 ? 'Savchenko, A.' 3 ? 'Joachimiak, A.' 4 ? 'Center for Structural Genomics of Infectious Diseases (CSGID)' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of NAD kinase from Pseudomonas aeruginosa' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chang, C.' 1 ? primary 'Evdokimova, E.' 2 ? primary 'Savchenko, A.' 3 ? primary 'Joachimiak, A.' 4 ? primary 'Center for Structural Genomics of Infectious Diseases (CSGID)' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7MH7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 99.165 _cell.length_a_esd ? _cell.length_b 99.165 _cell.length_b_esd ? _cell.length_c 121.867 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7MH7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NAD kinase' 32181.301 1 2.7.1.23 ? ? ? 2 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405 1 ? ? ? ? 3 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP-dependent NAD kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEPFRNIGIIGRLGSTQVLDTIRRLKKFLIDRHLHVILEDTIAEVLPGHGLQTCSRKIMGEICDLVVVVGGDGSMLGAAR ALARHKVPVLGINRGSLGFLTDIRPDELEAKVGEVLDGQYIVESRFLLDAQVRRGIDSMGQGDALNDVVLHPGKSTRMIE FELYIDGQFVCSQKADGLIVATPTGSTAYALSAGGPIMHPKLDAIVIVPMYPHMLSSRPIVVDGNSELKIVVSPNMQIYP QVSCDGQNHFTCAPGDTVTISKKPQKLRLIHPIDHNYYEICRTKLGWGSRLGGGD ; _entity_poly.pdbx_seq_one_letter_code_can ;MEPFRNIGIIGRLGSTQVLDTIRRLKKFLIDRHLHVILEDTIAEVLPGHGLQTCSRKIMGEICDLVVVVGGDGSMLGAAR ALARHKVPVLGINRGSLGFLTDIRPDELEAKVGEVLDGQYIVESRFLLDAQVRRGIDSMGQGDALNDVVLHPGKSTRMIE FELYIDGQFVCSQKADGLIVATPTGSTAYALSAGGPIMHPKLDAIVIVPMYPHMLSSRPIVVDGNSELKIVVSPNMQIYP QVSCDGQNHFTCAPGDTVTISKKPQKLRLIHPIDHNYYEICRTKLGWGSRLGGGD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CSGID-IDP97675 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PRO n 1 4 PHE n 1 5 ARG n 1 6 ASN n 1 7 ILE n 1 8 GLY n 1 9 ILE n 1 10 ILE n 1 11 GLY n 1 12 ARG n 1 13 LEU n 1 14 GLY n 1 15 SER n 1 16 THR n 1 17 GLN n 1 18 VAL n 1 19 LEU n 1 20 ASP n 1 21 THR n 1 22 ILE n 1 23 ARG n 1 24 ARG n 1 25 LEU n 1 26 LYS n 1 27 LYS n 1 28 PHE n 1 29 LEU n 1 30 ILE n 1 31 ASP n 1 32 ARG n 1 33 HIS n 1 34 LEU n 1 35 HIS n 1 36 VAL n 1 37 ILE n 1 38 LEU n 1 39 GLU n 1 40 ASP n 1 41 THR n 1 42 ILE n 1 43 ALA n 1 44 GLU n 1 45 VAL n 1 46 LEU n 1 47 PRO n 1 48 GLY n 1 49 HIS n 1 50 GLY n 1 51 LEU n 1 52 GLN n 1 53 THR n 1 54 CYS n 1 55 SER n 1 56 ARG n 1 57 LYS n 1 58 ILE n 1 59 MET n 1 60 GLY n 1 61 GLU n 1 62 ILE n 1 63 CYS n 1 64 ASP n 1 65 LEU n 1 66 VAL n 1 67 VAL n 1 68 VAL n 1 69 VAL n 1 70 GLY n 1 71 GLY n 1 72 ASP n 1 73 GLY n 1 74 SER n 1 75 MET n 1 76 LEU n 1 77 GLY n 1 78 ALA n 1 79 ALA n 1 80 ARG n 1 81 ALA n 1 82 LEU n 1 83 ALA n 1 84 ARG n 1 85 HIS n 1 86 LYS n 1 87 VAL n 1 88 PRO n 1 89 VAL n 1 90 LEU n 1 91 GLY n 1 92 ILE n 1 93 ASN n 1 94 ARG n 1 95 GLY n 1 96 SER n 1 97 LEU n 1 98 GLY n 1 99 PHE n 1 100 LEU n 1 101 THR n 1 102 ASP n 1 103 ILE n 1 104 ARG n 1 105 PRO n 1 106 ASP n 1 107 GLU n 1 108 LEU n 1 109 GLU n 1 110 ALA n 1 111 LYS n 1 112 VAL n 1 113 GLY n 1 114 GLU n 1 115 VAL n 1 116 LEU n 1 117 ASP n 1 118 GLY n 1 119 GLN n 1 120 TYR n 1 121 ILE n 1 122 VAL n 1 123 GLU n 1 124 SER n 1 125 ARG n 1 126 PHE n 1 127 LEU n 1 128 LEU n 1 129 ASP n 1 130 ALA n 1 131 GLN n 1 132 VAL n 1 133 ARG n 1 134 ARG n 1 135 GLY n 1 136 ILE n 1 137 ASP n 1 138 SER n 1 139 MET n 1 140 GLY n 1 141 GLN n 1 142 GLY n 1 143 ASP n 1 144 ALA n 1 145 LEU n 1 146 ASN n 1 147 ASP n 1 148 VAL n 1 149 VAL n 1 150 LEU n 1 151 HIS n 1 152 PRO n 1 153 GLY n 1 154 LYS n 1 155 SER n 1 156 THR n 1 157 ARG n 1 158 MET n 1 159 ILE n 1 160 GLU n 1 161 PHE n 1 162 GLU n 1 163 LEU n 1 164 TYR n 1 165 ILE n 1 166 ASP n 1 167 GLY n 1 168 GLN n 1 169 PHE n 1 170 VAL n 1 171 CYS n 1 172 SER n 1 173 GLN n 1 174 LYS n 1 175 ALA n 1 176 ASP n 1 177 GLY n 1 178 LEU n 1 179 ILE n 1 180 VAL n 1 181 ALA n 1 182 THR n 1 183 PRO n 1 184 THR n 1 185 GLY n 1 186 SER n 1 187 THR n 1 188 ALA n 1 189 TYR n 1 190 ALA n 1 191 LEU n 1 192 SER n 1 193 ALA n 1 194 GLY n 1 195 GLY n 1 196 PRO n 1 197 ILE n 1 198 MET n 1 199 HIS n 1 200 PRO n 1 201 LYS n 1 202 LEU n 1 203 ASP n 1 204 ALA n 1 205 ILE n 1 206 VAL n 1 207 ILE n 1 208 VAL n 1 209 PRO n 1 210 MET n 1 211 TYR n 1 212 PRO n 1 213 HIS n 1 214 MET n 1 215 LEU n 1 216 SER n 1 217 SER n 1 218 ARG n 1 219 PRO n 1 220 ILE n 1 221 VAL n 1 222 VAL n 1 223 ASP n 1 224 GLY n 1 225 ASN n 1 226 SER n 1 227 GLU n 1 228 LEU n 1 229 LYS n 1 230 ILE n 1 231 VAL n 1 232 VAL n 1 233 SER n 1 234 PRO n 1 235 ASN n 1 236 MET n 1 237 GLN n 1 238 ILE n 1 239 TYR n 1 240 PRO n 1 241 GLN n 1 242 VAL n 1 243 SER n 1 244 CYS n 1 245 ASP n 1 246 GLY n 1 247 GLN n 1 248 ASN n 1 249 HIS n 1 250 PHE n 1 251 THR n 1 252 CYS n 1 253 ALA n 1 254 PRO n 1 255 GLY n 1 256 ASP n 1 257 THR n 1 258 VAL n 1 259 THR n 1 260 ILE n 1 261 SER n 1 262 LYS n 1 263 LYS n 1 264 PRO n 1 265 GLN n 1 266 LYS n 1 267 LEU n 1 268 ARG n 1 269 LEU n 1 270 ILE n 1 271 HIS n 1 272 PRO n 1 273 ILE n 1 274 ASP n 1 275 HIS n 1 276 ASN n 1 277 TYR n 1 278 TYR n 1 279 GLU n 1 280 ILE n 1 281 CYS n 1 282 ARG n 1 283 THR n 1 284 LYS n 1 285 LEU n 1 286 GLY n 1 287 TRP n 1 288 GLY n 1 289 SER n 1 290 ARG n 1 291 LEU n 1 292 GLY n 1 293 GLY n 1 294 GLY n 1 295 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 295 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nadK, PA3088' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa PAO1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NADK_PSEAE _struct_ref.pdbx_db_accession Q9HZC0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEPFRNIGIIGRLGSTQVLDTIRRLKKFLIDRHLHVILEDTIAEVLPGHGLQTCSRKIMGEICDLVVVVGGDGSMLGAAR ALARHKVPVLGINRGSLGFLTDIRPDELEAKVGEVLDGQYIVESRFLLDAQVRRGIDSMGQGDALNDVVLHPGKSTRMIE FELYIDGQFVCSQKADGLIVATPTGSTAYALSAGGPIMHPKLDAIVIVPMYPHMLSSRPIVVDGNSELKIVVSPNMQIYP QVSCDGQNHFTCAPGDTVTISKKPQKLRLIHPIDHNYYEICRTKLGWGSRLGGGD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7MH7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 295 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HZC0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 295 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 295 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAP non-polymer . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE ; 'C21 H28 N7 O17 P3' 743.405 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7MH7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.69 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M di-ammonium tartrate, 10% MPD, 1.5mM NADP' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 35.190 _reflns.entry_id 7MH7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11351 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 48.500 _reflns.pdbx_Rmerge_I_obs 0.113 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.990 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.114 _reflns.pdbx_Rpim_I_all 0.016 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 550309 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.600 2.640 ? ? ? ? ? ? 539 100.000 ? ? ? ? 2.782 ? ? ? ? ? ? ? ? 29.600 ? 0.924 ? ? 2.831 0.508 ? 1 1 0.659 ? ? ? ? ? ? ? ? ? ? 2.640 2.690 ? ? ? ? ? ? 551 99.800 ? ? ? ? 2.285 ? ? ? ? ? ? ? ? 35.600 ? 1.020 ? ? 2.318 0.384 ? 2 1 0.729 ? ? ? ? ? ? ? ? ? ? 2.690 2.740 ? ? ? ? ? ? 553 100.000 ? ? ? ? 2.032 ? ? ? ? ? ? ? ? 38.400 ? 0.932 ? ? 2.059 0.329 ? 3 1 0.763 ? ? ? ? ? ? ? ? ? ? 2.740 2.800 ? ? ? ? ? ? 548 100.000 ? ? ? ? 2.066 ? ? ? ? ? ? ? ? 40.800 ? 0.931 ? ? 2.091 0.324 ? 4 1 0.779 ? ? ? ? ? ? ? ? ? ? 2.800 2.860 ? ? ? ? ? ? 550 100.000 ? ? ? ? 1.814 ? ? ? ? ? ? ? ? 48.600 ? 0.941 ? ? 1.833 0.260 ? 5 1 0.902 ? ? ? ? ? ? ? ? ? ? 2.860 2.930 ? ? ? ? ? ? 551 100.000 ? ? ? ? 1.543 ? ? ? ? ? ? ? ? 51.000 ? 0.938 ? ? 1.558 0.216 ? 6 1 0.981 ? ? ? ? ? ? ? ? ? ? 2.930 3.000 ? ? ? ? ? ? 562 100.000 ? ? ? ? 1.159 ? ? ? ? ? ? ? ? 52.400 ? 0.969 ? ? 1.170 0.160 ? 7 1 0.966 ? ? ? ? ? ? ? ? ? ? 3.000 3.080 ? ? ? ? ? ? 555 100.000 ? ? ? ? 0.937 ? ? ? ? ? ? ? ? 52.800 ? 0.967 ? ? 0.946 0.129 ? 8 1 0.980 ? ? ? ? ? ? ? ? ? ? 3.080 3.170 ? ? ? ? ? ? 553 100.000 ? ? ? ? 0.729 ? ? ? ? ? ? ? ? 52.900 ? 0.968 ? ? 0.735 0.100 ? 9 1 0.987 ? ? ? ? ? ? ? ? ? ? 3.170 3.280 ? ? ? ? ? ? 566 100.000 ? ? ? ? 0.605 ? ? ? ? ? ? ? ? 52.100 ? 0.985 ? ? 0.611 0.083 ? 10 1 0.991 ? ? ? ? ? ? ? ? ? ? 3.280 3.390 ? ? ? ? ? ? 556 100.000 ? ? ? ? 0.413 ? ? ? ? ? ? ? ? 48.400 ? 1.020 ? ? 0.418 0.059 ? 11 1 0.996 ? ? ? ? ? ? ? ? ? ? 3.390 3.530 ? ? ? ? ? ? 556 100.000 ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 52.900 ? 1.032 ? ? 0.341 0.046 ? 12 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.530 3.690 ? ? ? ? ? ? 569 100.000 ? ? ? ? 0.227 ? ? ? ? ? ? ? ? 55.100 ? 1.040 ? ? 0.229 0.030 ? 13 1 0.998 ? ? ? ? ? ? ? ? ? ? 3.690 3.880 ? ? ? ? ? ? 558 100.000 ? ? ? ? 0.182 ? ? ? ? ? ? ? ? 54.800 ? 1.027 ? ? 0.184 0.024 ? 14 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.880 4.130 ? ? ? ? ? ? 578 99.800 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 53.400 ? 1.009 ? ? 0.145 0.020 ? 15 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.130 4.450 ? ? ? ? ? ? 565 100.000 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 50.100 ? 1.021 ? ? 0.099 0.014 ? 16 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.450 4.890 ? ? ? ? ? ? 583 100.000 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 52.600 ? 1.025 ? ? 0.081 0.011 ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.890 5.600 ? ? ? ? ? ? 586 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 53.000 ? 1.019 ? ? 0.079 0.011 ? 18 1 0.999 ? ? ? ? ? ? ? ? ? ? 5.600 7.050 ? ? ? ? ? ? 604 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 48.200 ? 0.992 ? ? 0.068 0.010 ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 7.050 50.000 ? ? ? ? ? ? 668 99.700 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 45.800 ? 0.976 ? ? 0.059 0.009 ? 20 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 152.890 _refine.B_iso_mean 50.1146 _refine.B_iso_min 7.010 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7MH7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6100 _refine.ls_d_res_low 40.6200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10100 _refine.ls_number_reflns_R_free 509 _refine.ls_number_reflns_R_work 9591 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 89.1100 _refine.ls_percent_reflns_R_free 5.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2179 _refine.ls_R_factor_R_free 0.2597 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2157 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2AN1.pdb _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.3400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6100 _refine_hist.d_res_low 40.6200 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 2280 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 290 _refine_hist.pdbx_B_iso_mean_ligand 33.55 _refine_hist.pdbx_B_iso_mean_solvent 32.91 _refine_hist.pdbx_number_atoms_protein 2192 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6100 2.8700 1514 . 68 1446 55.0000 . . . 0.3241 0.0000 0.2641 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.8700 3.2800 2783 . 162 2621 100.0000 . . . 0.3122 0.0000 0.2478 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.2800 4.1400 2815 . 131 2684 100.0000 . . . 0.2599 0.0000 0.2075 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 4.1400 40.6200 2988 . 148 2840 100.0000 . . . 0.2238 0.0000 0.1981 . . . . . . . 4 . . . # _struct.entry_id 7MH7 _struct.title 'crystal structure of NAD kinase from Pseudomonas aeruginosa PAO1' _struct.pdbx_descriptor 'NAD kinase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7MH7 _struct_keywords.text 'NAD KINASE, CSGID, structural genomics, Center for Structural Genomics of Infectious Diseases, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 15 ? ARG A 32 ? SER A 15 ARG A 32 1 ? 18 HELX_P HELX_P2 AA2 ASP A 40 ? GLU A 44 ? ASP A 40 GLU A 44 1 ? 5 HELX_P HELX_P3 AA3 ILE A 58 ? CYS A 63 ? ILE A 58 CYS A 63 1 ? 6 HELX_P HELX_P4 AA4 GLY A 71 ? ALA A 83 ? GLY A 71 ALA A 83 1 ? 13 HELX_P HELX_P5 AA5 ARG A 104 ? ASP A 106 ? ARG A 104 ASP A 106 5 ? 3 HELX_P HELX_P6 AA6 GLU A 107 ? ASP A 117 ? GLU A 107 ASP A 117 1 ? 11 HELX_P HELX_P7 AA7 THR A 184 ? THR A 187 ? THR A 184 THR A 187 5 ? 4 HELX_P HELX_P8 AA8 ALA A 188 ? ALA A 193 ? ALA A 188 ALA A 193 1 ? 6 HELX_P HELX_P9 AA9 ASN A 276 ? GLY A 286 ? ASN A 276 GLY A 286 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 6 ? AA3 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 53 ? CYS A 54 ? THR A 53 CYS A 54 AA1 2 VAL A 36 ? GLU A 39 ? VAL A 36 GLU A 39 AA1 3 ILE A 7 ? ILE A 10 ? ILE A 7 ILE A 10 AA1 4 LEU A 65 ? VAL A 69 ? LEU A 65 VAL A 69 AA1 5 VAL A 89 ? ILE A 92 ? VAL A 89 ILE A 92 AA2 1 ASP A 137 ? ALA A 144 ? ASP A 137 ALA A 144 AA2 2 ILE A 121 ? ARG A 134 ? ILE A 121 ARG A 134 AA2 3 THR A 257 ? HIS A 271 ? THR A 257 HIS A 271 AA2 4 LEU A 228 ? VAL A 232 ? LEU A 228 VAL A 232 AA2 5 ILE A 159 ? ILE A 165 ? ILE A 159 ILE A 165 AA2 6 GLN A 168 ? ALA A 175 ? GLN A 168 ALA A 175 AA3 1 ILE A 220 ? ASP A 223 ? ILE A 220 ASP A 223 AA3 2 ALA A 204 ? MET A 210 ? ALA A 204 MET A 210 AA3 3 GLY A 177 ? ALA A 181 ? GLY A 177 ALA A 181 AA3 4 ASP A 147 ? HIS A 151 ? ASP A 147 HIS A 151 AA3 5 GLN A 241 ? CYS A 244 ? GLN A 241 CYS A 244 AA3 6 ASN A 248 ? THR A 251 ? ASN A 248 THR A 251 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O CYS A 54 ? O CYS A 54 N LEU A 38 ? N LEU A 38 AA1 2 3 O ILE A 37 ? O ILE A 37 N ILE A 7 ? N ILE A 7 AA1 3 4 N GLY A 8 ? N GLY A 8 O LEU A 65 ? O LEU A 65 AA1 4 5 N VAL A 68 ? N VAL A 68 O LEU A 90 ? O LEU A 90 AA2 1 2 O ALA A 144 ? O ALA A 144 N LEU A 128 ? N LEU A 128 AA2 2 3 N ASP A 129 ? N ASP A 129 O SER A 261 ? O SER A 261 AA2 3 4 O ILE A 260 ? O ILE A 260 N LEU A 228 ? N LEU A 228 AA2 4 5 O LYS A 229 ? O LYS A 229 N TYR A 164 ? N TYR A 164 AA2 5 6 N ILE A 159 ? N ILE A 159 O ALA A 175 ? O ALA A 175 AA3 1 2 O ILE A 220 ? O ILE A 220 N ILE A 207 ? N ILE A 207 AA3 2 3 O VAL A 208 ? O VAL A 208 N ILE A 179 ? N ILE A 179 AA3 3 4 O LEU A 178 ? O LEU A 178 N LEU A 150 ? N LEU A 150 AA3 4 5 N HIS A 151 ? N HIS A 151 O GLN A 241 ? O GLN A 241 AA3 5 6 N VAL A 242 ? N VAL A 242 O PHE A 250 ? O PHE A 250 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NAP _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 22 _struct_site.details 'binding site for residue NAP A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 22 ASP A 72 ? ASP A 72 . ? 1_555 ? 2 AC1 22 GLY A 73 ? GLY A 73 . ? 1_555 ? 3 AC1 22 ARG A 94 ? ARG A 94 . ? 1_555 ? 4 AC1 22 PHE A 99 ? PHE A 99 . ? 1_555 ? 5 AC1 22 ASN A 146 ? ASN A 146 . ? 1_555 ? 6 AC1 22 ASP A 147 ? ASP A 147 . ? 1_555 ? 7 AC1 22 THR A 156 ? THR A 156 . ? 8_556 ? 8 AC1 22 ARG A 157 ? ARG A 157 . ? 8_556 ? 9 AC1 22 MET A 158 ? MET A 158 . ? 8_556 ? 10 AC1 22 LYS A 174 ? LYS A 174 . ? 8_556 ? 11 AC1 22 ASP A 176 ? ASP A 176 . ? 8_556 ? 12 AC1 22 THR A 184 ? THR A 184 . ? 1_555 ? 13 AC1 22 THR A 187 ? THR A 187 . ? 1_555 ? 14 AC1 22 ALA A 188 ? ALA A 188 . ? 1_555 ? 15 AC1 22 TYR A 189 ? TYR A 189 . ? 1_555 ? 16 AC1 22 SER A 192 ? SER A 192 . ? 1_555 ? 17 AC1 22 TYR A 211 ? TYR A 211 . ? 8_556 ? 18 AC1 22 HIS A 213 ? HIS A 213 . ? 8_556 ? 19 AC1 22 ASP A 245 ? ASP A 245 . ? 1_555 ? 20 AC1 22 GLN A 247 ? GLN A 247 . ? 1_555 ? 21 AC1 22 LYS A 284 ? LYS A 284 . ? 1_555 ? 22 AC1 22 HOH C . ? HOH A 413 . ? 1_555 ? # _atom_sites.entry_id 7MH7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010084 _atom_sites.fract_transf_matrix[1][2] 0.005822 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011644 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008206 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU ALA A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY ALA A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 MET 139 139 139 MET MET A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 MET 210 210 210 MET MET A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 PRO 212 212 212 PRO PRO A . n A 1 213 HIS 213 213 213 HIS HIS A . n A 1 214 MET 214 214 214 MET MET A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 PRO 219 219 219 PRO PRO A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 ASN 225 225 225 ASN ASN A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 ASN 235 235 235 ASN ASN A . n A 1 236 MET 236 236 236 MET MET A . n A 1 237 GLN 237 237 237 GLN GLN A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 TYR 239 239 239 TYR TYR A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 CYS 244 244 244 CYS CYS A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 GLN 247 247 247 GLN GLN A . n A 1 248 ASN 248 248 248 ASN ASN A . n A 1 249 HIS 249 249 249 HIS HIS A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 THR 251 251 251 THR THR A . n A 1 252 CYS 252 252 252 CYS CYS A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 PRO 254 254 254 PRO PRO A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 LYS 262 262 262 LYS LYS A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 PRO 264 264 264 PRO PRO A . n A 1 265 GLN 265 265 265 GLN GLN A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 ILE 270 270 270 ILE ILE A . n A 1 271 HIS 271 271 271 HIS HIS A . n A 1 272 PRO 272 272 272 PRO PRO A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 HIS 275 275 275 HIS HIS A . n A 1 276 ASN 276 276 276 ASN ASN A . n A 1 277 TYR 277 277 277 TYR TYR A . n A 1 278 TYR 278 278 278 TYR TYR A . n A 1 279 GLU 279 279 279 GLU GLU A . n A 1 280 ILE 280 280 280 ILE ILE A . n A 1 281 CYS 281 281 281 CYS CYS A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 THR 283 283 283 THR THR A . n A 1 284 LYS 284 284 284 LYS LYS A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 GLY 286 286 286 GLY GLY A . n A 1 287 TRP 287 287 287 TRP TRP A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 SER 289 289 289 SER SER A . n A 1 290 ARG 290 290 290 ARG ARG A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 GLY 292 292 ? ? ? A . n A 1 293 GLY 293 293 ? ? ? A . n A 1 294 GLY 294 294 ? ? ? A . n A 1 295 ASP 295 295 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAP 1 301 301 NAP NAP A . C 3 HOH 1 401 38 HOH HOH A . C 3 HOH 2 402 11 HOH HOH A . C 3 HOH 3 403 39 HOH HOH A . C 3 HOH 4 404 16 HOH HOH A . C 3 HOH 5 405 37 HOH HOH A . C 3 HOH 6 406 4 HOH HOH A . C 3 HOH 7 407 5 HOH HOH A . C 3 HOH 8 408 3 HOH HOH A . C 3 HOH 9 409 21 HOH HOH A . C 3 HOH 10 410 14 HOH HOH A . C 3 HOH 11 411 36 HOH HOH A . C 3 HOH 12 412 17 HOH HOH A . C 3 HOH 13 413 29 HOH HOH A . C 3 HOH 14 414 28 HOH HOH A . C 3 HOH 15 415 8 HOH HOH A . C 3 HOH 16 416 18 HOH HOH A . C 3 HOH 17 417 10 HOH HOH A . C 3 HOH 18 418 7 HOH HOH A . C 3 HOH 19 419 2 HOH HOH A . C 3 HOH 20 420 40 HOH HOH A . C 3 HOH 21 421 22 HOH HOH A . C 3 HOH 22 422 15 HOH HOH A . C 3 HOH 23 423 24 HOH HOH A . C 3 HOH 24 424 31 HOH HOH A . C 3 HOH 25 425 12 HOH HOH A . C 3 HOH 26 426 30 HOH HOH A . C 3 HOH 27 427 25 HOH HOH A . C 3 HOH 28 428 20 HOH HOH A . C 3 HOH 29 429 1 HOH HOH A . C 3 HOH 30 430 9 HOH HOH A . C 3 HOH 31 431 26 HOH HOH A . C 3 HOH 32 432 27 HOH HOH A . C 3 HOH 33 433 33 HOH HOH A . C 3 HOH 34 434 19 HOH HOH A . C 3 HOH 35 435 32 HOH HOH A . C 3 HOH 36 436 6 HOH HOH A . C 3 HOH 37 437 23 HOH HOH A . C 3 HOH 38 438 35 HOH HOH A . C 3 HOH 39 439 34 HOH HOH A . C 3 HOH 40 440 13 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 16030 ? 1 MORE -79 ? 1 'SSA (A^2)' 41570 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 99.1650000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 8_556 x-y,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 121.8670000000 4 'crystal symmetry operation' 11_656 -x+y+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 99.1650000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 121.8670000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 425 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2021-04-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 34.3958 _pdbx_refine_tls.origin_y 16.9980 _pdbx_refine_tls.origin_z 70.8981 _pdbx_refine_tls.T[1][1] 0.1307 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0788 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0046 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1781 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0621 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2275 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.2821 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.1499 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.1880 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.6850 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 1.3745 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.9289 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.2262 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.2139 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.2013 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.2674 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.1457 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.6110 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0315 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.3197 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0077 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 291 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ;(chain 'A' and resid 2 through 291) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19_4092 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 5 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? SBC-Collect ? ? ? . 6 # _pdbx_entry_details.entry_id 7MH7 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 5 ? ? -113.18 -74.16 2 1 HIS A 49 ? ? 66.99 -4.16 3 1 LEU A 51 ? ? -107.39 -143.88 4 1 ILE A 136 ? ? -133.28 -35.47 5 1 ASN A 146 ? ? -93.05 -67.65 6 1 VAL A 170 ? ? -97.19 -65.03 7 1 ALA A 188 ? ? -97.66 -119.64 8 1 TYR A 211 ? A 40.79 71.50 9 1 SER A 289 ? ? -85.99 -157.04 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 2 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 2 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 2 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 2 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A ARG 12 ? CG ? A ARG 12 CG 6 1 Y 1 A ARG 12 ? CD ? A ARG 12 CD 7 1 Y 1 A ARG 12 ? NE ? A ARG 12 NE 8 1 Y 1 A ARG 12 ? CZ ? A ARG 12 CZ 9 1 Y 1 A ARG 12 ? NH1 ? A ARG 12 NH1 10 1 Y 1 A ARG 12 ? NH2 ? A ARG 12 NH2 11 1 Y 1 A LEU 13 ? CG ? A LEU 13 CG 12 1 Y 1 A LEU 13 ? CD1 ? A LEU 13 CD1 13 1 Y 1 A LEU 13 ? CD2 ? A LEU 13 CD2 14 1 Y 1 A LYS 57 ? CG ? A LYS 57 CG 15 1 Y 1 A LYS 57 ? CD ? A LYS 57 CD 16 1 Y 1 A LYS 57 ? CE ? A LYS 57 CE 17 1 Y 1 A LYS 57 ? NZ ? A LYS 57 NZ 18 1 Y 1 A ARG 84 ? CG ? A ARG 84 CG 19 1 Y 1 A ARG 84 ? CD ? A ARG 84 CD 20 1 Y 1 A ARG 84 ? NE ? A ARG 84 NE 21 1 Y 1 A ARG 84 ? CZ ? A ARG 84 CZ 22 1 Y 1 A ARG 84 ? NH1 ? A ARG 84 NH1 23 1 Y 1 A ARG 84 ? NH2 ? A ARG 84 NH2 24 1 Y 1 A ILE 136 ? CG1 ? A ILE 136 CG1 25 1 Y 1 A ILE 136 ? CG2 ? A ILE 136 CG2 26 1 Y 1 A ILE 136 ? CD1 ? A ILE 136 CD1 27 1 Y 1 A ASP 137 ? CG ? A ASP 137 CG 28 1 Y 1 A ASP 137 ? OD1 ? A ASP 137 OD1 29 1 Y 1 A ASP 137 ? OD2 ? A ASP 137 OD2 30 1 Y 1 A GLN 237 ? CG ? A GLN 237 CG 31 1 Y 1 A GLN 237 ? CD ? A GLN 237 CD 32 1 Y 1 A GLN 237 ? OE1 ? A GLN 237 OE1 33 1 Y 1 A GLN 237 ? NE2 ? A GLN 237 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 292 ? A GLY 292 3 1 Y 1 A GLY 293 ? A GLY 293 4 1 Y 1 A GLY 294 ? A GLY 294 5 1 Y 1 A ASP 295 ? A ASP 295 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NAP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NAP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NAP 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #