data_7MHC # _entry.id 7MHC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7MHC pdb_00007mhc 10.2210/pdb7mhc/pdb WWPDB D_1000256260 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7MHC _pdbx_database_status.recvd_initial_deposition_date 2021-04-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Lesburg, C.A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0001-7245-7331 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 603 _citation.language ? _citation.page_first 439 _citation.page_last 444 _citation.title 'A kinase-cGAS cascade to synthesize a therapeutic STING activator.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-022-04422-9 _citation.pdbx_database_id_PubMed 35296845 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McIntosh, J.A.' 1 0000-0002-9487-490X primary 'Liu, Z.' 2 ? primary 'Andresen, B.M.' 3 0000-0002-9645-3359 primary 'Marzijarani, N.S.' 4 0000-0001-8940-4674 primary 'Moore, J.C.' 5 0000-0002-9807-6315 primary 'Marshall, N.M.' 6 ? primary 'Borra-Garske, M.' 7 ? primary 'Obligacion, J.V.' 8 ? primary 'Fier, P.S.' 9 ? primary 'Peng, F.' 10 ? primary 'Forstater, J.H.' 11 ? primary 'Winston, M.S.' 12 ? primary 'An, C.' 13 ? primary 'Chang, W.' 14 ? primary 'Lim, J.' 15 ? primary 'Huffman, M.A.' 16 ? primary 'Miller, S.P.' 17 0000-0001-8615-274X primary 'Tsay, F.R.' 18 ? primary 'Altman, M.D.' 19 ? primary 'Lesburg, C.A.' 20 0000-0001-7245-7331 primary 'Steinhuebel, D.' 21 ? primary 'Trotter, B.W.' 22 0000-0002-6780-0358 primary 'Cumming, J.N.' 23 ? primary 'Northrup, A.' 24 ? primary 'Bu, X.' 25 ? primary 'Mann, B.F.' 26 ? primary 'Biba, M.' 27 ? primary 'Hiraga, K.' 28 ? primary 'Murphy, G.S.' 29 0000-0003-0388-0309 primary 'Kolev, J.N.' 30 ? primary 'Makarewicz, A.' 31 ? primary 'Pan, W.' 32 ? primary 'Farasat, I.' 33 ? primary 'Bade, R.S.' 34 0000-0002-5384-9687 primary 'Stone, K.' 35 ? primary 'Duan, D.' 36 ? primary 'Alvizo, O.' 37 ? primary 'Adpressa, D.' 38 ? primary 'Guetschow, E.' 39 ? primary 'Hoyt, E.' 40 ? primary 'Regalado, E.L.' 41 0000-0002-7352-6391 primary 'Castro, S.' 42 ? primary 'Rivera, N.' 43 ? primary 'Smith, J.P.' 44 0000-0002-0062-2534 primary 'Wang, F.' 45 ? primary 'Crespo, A.' 46 ? primary 'Verma, D.' 47 0000-0003-0740-0624 primary 'Axnanda, S.' 48 0000-0002-7239-9220 primary 'Dance, Z.E.X.' 49 0000-0003-1807-7930 primary 'Devine, P.N.' 50 ? primary 'Tschaen, D.' 51 ? primary 'Canada, K.A.' 52 ? primary 'Bulger, P.G.' 53 ? primary 'Sherry, B.D.' 54 ? primary 'Truppo, M.D.' 55 ? primary 'Ruck, R.T.' 56 0000-0001-9980-9675 primary 'Campeau, L.C.' 57 0000-0002-2373-802X primary 'Bennett, D.J.' 58 0000-0003-0163-7479 primary 'Humphrey, G.R.' 59 ? primary 'Campos, K.R.' 60 ? primary 'Maddess, M.L.' 61 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 100.970 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7MHC _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.120 _cell.length_a_esd ? _cell.length_b 72.740 _cell.length_b_esd ? _cell.length_c 36.370 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7MHC _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stimulator of interferon genes protein' 21555.191 1 ? 'G230A, H232R, R293Q' ? ? 2 non-polymer nat ;(2R,5R,7R,8S,10R,12aR,14R,15S,15aR,16R)-7-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-15,16-difluoro-2,10-bis(sulfanyl)octahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione ; 708.509 1 ? ? ? ? 3 water nat water 18.015 28 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hSTING,Endoplasmic reticulum interferon stimulator,ERIS,Mediator of IRF3 activation,hMITA,Transmembrane protein 173' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRA GIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCRLIA YQEPADDSSFSLSQEVLRHLRQEEKEEV ; _entity_poly.pdbx_seq_one_letter_code_can ;NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRA GIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCRLIA YQEPADDSSFSLSQEVLRHLRQEEKEEV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 VAL n 1 3 ALA n 1 4 HIS n 1 5 GLY n 1 6 LEU n 1 7 ALA n 1 8 TRP n 1 9 SER n 1 10 TYR n 1 11 TYR n 1 12 ILE n 1 13 GLY n 1 14 TYR n 1 15 LEU n 1 16 ARG n 1 17 LEU n 1 18 ILE n 1 19 LEU n 1 20 PRO n 1 21 GLU n 1 22 LEU n 1 23 GLN n 1 24 ALA n 1 25 ARG n 1 26 ILE n 1 27 ARG n 1 28 THR n 1 29 TYR n 1 30 ASN n 1 31 GLN n 1 32 HIS n 1 33 TYR n 1 34 ASN n 1 35 ASN n 1 36 LEU n 1 37 LEU n 1 38 ARG n 1 39 GLY n 1 40 ALA n 1 41 VAL n 1 42 SER n 1 43 GLN n 1 44 ARG n 1 45 LEU n 1 46 TYR n 1 47 ILE n 1 48 LEU n 1 49 LEU n 1 50 PRO n 1 51 LEU n 1 52 ASP n 1 53 CYS n 1 54 GLY n 1 55 VAL n 1 56 PRO n 1 57 ASP n 1 58 ASN n 1 59 LEU n 1 60 SER n 1 61 MET n 1 62 ALA n 1 63 ASP n 1 64 PRO n 1 65 ASN n 1 66 ILE n 1 67 ARG n 1 68 PHE n 1 69 LEU n 1 70 ASP n 1 71 LYS n 1 72 LEU n 1 73 PRO n 1 74 GLN n 1 75 GLN n 1 76 THR n 1 77 ALA n 1 78 ASP n 1 79 ARG n 1 80 ALA n 1 81 GLY n 1 82 ILE n 1 83 LYS n 1 84 ASP n 1 85 ARG n 1 86 VAL n 1 87 TYR n 1 88 SER n 1 89 ASN n 1 90 SER n 1 91 ILE n 1 92 TYR n 1 93 GLU n 1 94 LEU n 1 95 LEU n 1 96 GLU n 1 97 ASN n 1 98 GLY n 1 99 GLN n 1 100 ARG n 1 101 ALA n 1 102 GLY n 1 103 THR n 1 104 CYS n 1 105 VAL n 1 106 LEU n 1 107 GLU n 1 108 TYR n 1 109 ALA n 1 110 THR n 1 111 PRO n 1 112 LEU n 1 113 GLN n 1 114 THR n 1 115 LEU n 1 116 PHE n 1 117 ALA n 1 118 MET n 1 119 SER n 1 120 GLN n 1 121 TYR n 1 122 SER n 1 123 GLN n 1 124 ALA n 1 125 GLY n 1 126 PHE n 1 127 SER n 1 128 ARG n 1 129 GLU n 1 130 ASP n 1 131 ARG n 1 132 LEU n 1 133 GLU n 1 134 GLN n 1 135 ALA n 1 136 LYS n 1 137 LEU n 1 138 PHE n 1 139 CYS n 1 140 GLN n 1 141 THR n 1 142 LEU n 1 143 GLU n 1 144 ASP n 1 145 ILE n 1 146 LEU n 1 147 ALA n 1 148 ASP n 1 149 ALA n 1 150 PRO n 1 151 GLU n 1 152 SER n 1 153 GLN n 1 154 ASN n 1 155 ASN n 1 156 CYS n 1 157 ARG n 1 158 LEU n 1 159 ILE n 1 160 ALA n 1 161 TYR n 1 162 GLN n 1 163 GLU n 1 164 PRO n 1 165 ALA n 1 166 ASP n 1 167 ASP n 1 168 SER n 1 169 SER n 1 170 PHE n 1 171 SER n 1 172 LEU n 1 173 SER n 1 174 GLN n 1 175 GLU n 1 176 VAL n 1 177 LEU n 1 178 ARG n 1 179 HIS n 1 180 LEU n 1 181 ARG n 1 182 GLN n 1 183 GLU n 1 184 GLU n 1 185 LYS n 1 186 GLU n 1 187 GLU n 1 188 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 188 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STING1, ERIS, MITA, TMEM173' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STING_HUMAN _struct_ref.pdbx_db_accession Q86WV6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHA GIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIA YQEPADDSSFSLSQEVLRHLRQEEKEEV ; _struct_ref.pdbx_align_begin 154 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7MHC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 188 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q86WV6 _struct_ref_seq.db_align_beg 154 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 341 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 154 _struct_ref_seq.pdbx_auth_seq_align_end 341 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7MHC ALA A 77 ? UNP Q86WV6 GLY 230 'engineered mutation' 230 1 1 7MHC ARG A 79 ? UNP Q86WV6 HIS 232 'engineered mutation' 232 2 1 7MHC GLN A 140 ? UNP Q86WV6 ARG 293 'engineered mutation' 293 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZEV non-polymer . ;(2R,5R,7R,8S,10R,12aR,14R,15S,15aR,16R)-7-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-15,16-difluoro-2,10-bis(sulfanyl)octahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione ; ? 'C20 H20 F2 N10 O9 P2 S2 -2' 708.509 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7MHC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M TRIS; 0.2 M NaCl; 28.0 w/v PEG 6K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 62.710 _reflns.entry_id 7MHC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.32 _reflns.d_resolution_low 35.700 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9280 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.300 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.052 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.321 _reflns_shell.d_res_low 2.329 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.100 _reflns_shell.number_measured_all 4931 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1422 _reflns_shell.percent_possible_all 98.000 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.400 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.900 _reflns_shell.pdbx_Rrim_I_all 0.586 _reflns_shell.pdbx_Rpim_I_all 0.309 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.894 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 4.4208 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -15.1166 _refine.aniso_B[2][2] -4.5729 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.1521 _refine.B_iso_max 185.780 _refine.B_iso_mean 72.53 _refine.B_iso_min 36.330 _refine.correlation_coeff_Fo_to_Fc 0.9439 _refine.correlation_coeff_Fo_to_Fc_free 0.9261 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7MHC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3200 _refine.ls_d_res_low 35.7000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9279 _refine.ls_number_reflns_R_free 488 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.3700 _refine.ls_percent_reflns_R_free 5.2600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1935 _refine.ls_R_factor_R_free 0.2243 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1919 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 4ksy _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.2140 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.2080 _refine.pdbx_overall_SU_R_Blow_DPI 0.2980 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.3150 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7MHC _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.330 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3200 _refine_hist.d_res_low 35.7000 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 1538 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 179 _refine_hist.pdbx_B_iso_mean_ligand 45.29 _refine_hist.pdbx_B_iso_mean_solvent 64.02 _refine_hist.pdbx_number_atoms_protein 1445 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 65 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 545 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 45 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 250 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1543 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 194 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 1631 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 1543 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.090 ? 2123 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.960 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 19.020 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.3200 _refine_ls_shell.d_res_low 2.5900 _refine_ls_shell.number_reflns_all 2762 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 143 _refine_ls_shell.number_reflns_R_work 2619 _refine_ls_shell.percent_reflns_obs 99.0300 _refine_ls_shell.percent_reflns_R_free 5.1800 _refine_ls_shell.R_factor_all 0.2166 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3075 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2121 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7MHC _struct.title 'Structure of human STING in complex with MK-1454' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7MHC _struct_keywords.text 'STING, RECEPTOR, LIGAND COMPLEX, AGONIST, CLOSED CONFORMATION, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 1 ? GLY A 13 ? ASN A 154 GLY A 166 1 ? 13 HELX_P HELX_P2 AA2 TYR A 14 ? GLN A 31 ? TYR A 167 GLN A 184 1 ? 18 HELX_P HELX_P3 AA3 ASN A 58 ? ALA A 62 ? ASN A 211 ALA A 215 5 ? 5 HELX_P HELX_P4 AA4 ALA A 109 ? TYR A 121 ? ALA A 262 TYR A 274 1 ? 13 HELX_P HELX_P5 AA5 SER A 122 ? GLY A 125 ? SER A 275 GLY A 278 5 ? 4 HELX_P HELX_P6 AA6 SER A 127 ? ASP A 148 ? SER A 280 ASP A 301 1 ? 22 HELX_P HELX_P7 AA7 SER A 171 ? GLN A 182 ? SER A 324 GLN A 335 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 66 ? LYS A 71 ? ILE A 219 LYS A 224 AA1 2 SER A 90 ? GLU A 96 ? SER A 243 GLU A 249 AA1 3 GLN A 99 ? TYR A 108 ? GLN A 252 TYR A 261 AA1 4 LEU A 45 ? PRO A 50 ? LEU A 198 PRO A 203 AA1 5 CYS A 156 ? TYR A 161 ? CYS A 309 TYR A 314 AA2 1 GLN A 75 ? ARG A 79 ? GLN A 228 ARG A 232 AA2 2 ILE A 82 ? TYR A 87 ? ILE A 235 TYR A 240 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 70 ? N ASP A 223 O ILE A 91 ? O ILE A 244 AA1 2 3 N LEU A 94 ? N LEU A 247 O ALA A 101 ? O ALA A 254 AA1 3 4 O GLU A 107 ? O GLU A 260 N LEU A 48 ? N LEU A 201 AA1 4 5 N LEU A 45 ? N LEU A 198 O ARG A 157 ? O ARG A 310 AA2 1 2 N ARG A 79 ? N ARG A 232 O ILE A 82 ? O ILE A 235 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZEV _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 18 _struct_site.details 'binding site for residue ZEV A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 18 SER A 9 ? SER A 162 . ? 2_654 ? 2 AC1 18 SER A 9 ? SER A 162 . ? 1_555 ? 3 AC1 18 TYR A 10 ? TYR A 163 . ? 1_555 ? 4 AC1 18 TYR A 14 ? TYR A 167 . ? 2_654 ? 5 AC1 18 TYR A 14 ? TYR A 167 . ? 1_555 ? 6 AC1 18 ARG A 85 ? ARG A 238 . ? 2_654 ? 7 AC1 18 ARG A 85 ? ARG A 238 . ? 1_555 ? 8 AC1 18 TYR A 87 ? TYR A 240 . ? 2_654 ? 9 AC1 18 TYR A 87 ? TYR A 240 . ? 1_555 ? 10 AC1 18 GLU A 107 ? GLU A 260 . ? 1_555 ? 11 AC1 18 THR A 110 ? THR A 263 . ? 2_654 ? 12 AC1 18 THR A 110 ? THR A 263 . ? 1_555 ? 13 AC1 18 PRO A 111 ? PRO A 264 . ? 1_555 ? 14 AC1 18 THR A 114 ? THR A 267 . ? 1_555 ? 15 AC1 18 THR A 114 ? THR A 267 . ? 2_654 ? 16 AC1 18 HOH C . ? HOH A 505 . ? 1_555 ? 17 AC1 18 HOH C . ? HOH A 505 . ? 2_654 ? 18 AC1 18 HOH C . ? HOH A 520 . ? 1_555 ? # _atom_sites.entry_id 7MHC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011348 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002200 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013748 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.028007 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 154 154 ASN ASN A . n A 1 2 VAL 2 155 155 VAL VAL A . n A 1 3 ALA 3 156 156 ALA ALA A . n A 1 4 HIS 4 157 157 HIS HIS A . n A 1 5 GLY 5 158 158 GLY GLY A . n A 1 6 LEU 6 159 159 LEU LEU A . n A 1 7 ALA 7 160 160 ALA ALA A . n A 1 8 TRP 8 161 161 TRP TRP A . n A 1 9 SER 9 162 162 SER SER A . n A 1 10 TYR 10 163 163 TYR TYR A . n A 1 11 TYR 11 164 164 TYR TYR A . n A 1 12 ILE 12 165 165 ILE ILE A . n A 1 13 GLY 13 166 166 GLY GLY A . n A 1 14 TYR 14 167 167 TYR TYR A . n A 1 15 LEU 15 168 168 LEU LEU A . n A 1 16 ARG 16 169 169 ARG ARG A . n A 1 17 LEU 17 170 170 LEU LEU A . n A 1 18 ILE 18 171 171 ILE ILE A . n A 1 19 LEU 19 172 172 LEU LEU A . n A 1 20 PRO 20 173 173 PRO PRO A . n A 1 21 GLU 21 174 174 GLU GLU A . n A 1 22 LEU 22 175 175 LEU LEU A . n A 1 23 GLN 23 176 176 GLN GLN A . n A 1 24 ALA 24 177 177 ALA ALA A . n A 1 25 ARG 25 178 178 ARG ARG A . n A 1 26 ILE 26 179 179 ILE ILE A . n A 1 27 ARG 27 180 180 ARG ARG A . n A 1 28 THR 28 181 181 THR THR A . n A 1 29 TYR 29 182 182 TYR TYR A . n A 1 30 ASN 30 183 183 ASN ASN A . n A 1 31 GLN 31 184 184 GLN GLN A . n A 1 32 HIS 32 185 185 HIS HIS A . n A 1 33 TYR 33 186 186 TYR TYR A . n A 1 34 ASN 34 187 187 ASN ASN A . n A 1 35 ASN 35 188 188 ASN ASN A . n A 1 36 LEU 36 189 189 LEU LEU A . n A 1 37 LEU 37 190 190 LEU LEU A . n A 1 38 ARG 38 191 191 ARG ARG A . n A 1 39 GLY 39 192 192 GLY GLY A . n A 1 40 ALA 40 193 193 ALA ALA A . n A 1 41 VAL 41 194 194 VAL VAL A . n A 1 42 SER 42 195 195 SER SER A . n A 1 43 GLN 43 196 196 GLN GLN A . n A 1 44 ARG 44 197 197 ARG ARG A . n A 1 45 LEU 45 198 198 LEU LEU A . n A 1 46 TYR 46 199 199 TYR TYR A . n A 1 47 ILE 47 200 200 ILE ILE A . n A 1 48 LEU 48 201 201 LEU LEU A . n A 1 49 LEU 49 202 202 LEU LEU A . n A 1 50 PRO 50 203 203 PRO PRO A . n A 1 51 LEU 51 204 204 LEU LEU A . n A 1 52 ASP 52 205 205 ASP ASP A . n A 1 53 CYS 53 206 206 CYS CYS A . n A 1 54 GLY 54 207 207 GLY GLY A . n A 1 55 VAL 55 208 208 VAL VAL A . n A 1 56 PRO 56 209 209 PRO PRO A . n A 1 57 ASP 57 210 210 ASP ASP A . n A 1 58 ASN 58 211 211 ASN ASN A . n A 1 59 LEU 59 212 212 LEU LEU A . n A 1 60 SER 60 213 213 SER SER A . n A 1 61 MET 61 214 214 MET MET A . n A 1 62 ALA 62 215 215 ALA ALA A . n A 1 63 ASP 63 216 216 ASP ASP A . n A 1 64 PRO 64 217 217 PRO PRO A . n A 1 65 ASN 65 218 218 ASN ASN A . n A 1 66 ILE 66 219 219 ILE ILE A . n A 1 67 ARG 67 220 220 ARG ARG A . n A 1 68 PHE 68 221 221 PHE PHE A . n A 1 69 LEU 69 222 222 LEU LEU A . n A 1 70 ASP 70 223 223 ASP ASP A . n A 1 71 LYS 71 224 224 LYS LYS A . n A 1 72 LEU 72 225 225 LEU LEU A . n A 1 73 PRO 73 226 226 PRO PRO A . n A 1 74 GLN 74 227 227 GLN GLN A . n A 1 75 GLN 75 228 228 GLN GLN A . n A 1 76 THR 76 229 229 THR THR A . n A 1 77 ALA 77 230 230 ALA ALA A . n A 1 78 ASP 78 231 231 ASP ASP A . n A 1 79 ARG 79 232 232 ARG ARG A . n A 1 80 ALA 80 233 233 ALA ALA A . n A 1 81 GLY 81 234 234 GLY GLY A . n A 1 82 ILE 82 235 235 ILE ILE A . n A 1 83 LYS 83 236 236 LYS LYS A . n A 1 84 ASP 84 237 237 ASP ASP A . n A 1 85 ARG 85 238 238 ARG ARG A . n A 1 86 VAL 86 239 239 VAL VAL A . n A 1 87 TYR 87 240 240 TYR TYR A . n A 1 88 SER 88 241 241 SER SER A . n A 1 89 ASN 89 242 242 ASN ASN A . n A 1 90 SER 90 243 243 SER SER A . n A 1 91 ILE 91 244 244 ILE ILE A . n A 1 92 TYR 92 245 245 TYR TYR A . n A 1 93 GLU 93 246 246 GLU GLU A . n A 1 94 LEU 94 247 247 LEU LEU A . n A 1 95 LEU 95 248 248 LEU LEU A . n A 1 96 GLU 96 249 249 GLU GLU A . n A 1 97 ASN 97 250 250 ASN ASN A . n A 1 98 GLY 98 251 251 GLY GLY A . n A 1 99 GLN 99 252 252 GLN GLN A . n A 1 100 ARG 100 253 253 ARG ARG A . n A 1 101 ALA 101 254 254 ALA ALA A . n A 1 102 GLY 102 255 255 GLY GLY A . n A 1 103 THR 103 256 256 THR THR A . n A 1 104 CYS 104 257 257 CYS CYS A . n A 1 105 VAL 105 258 258 VAL VAL A . n A 1 106 LEU 106 259 259 LEU LEU A . n A 1 107 GLU 107 260 260 GLU GLU A . n A 1 108 TYR 108 261 261 TYR TYR A . n A 1 109 ALA 109 262 262 ALA ALA A . n A 1 110 THR 110 263 263 THR THR A . n A 1 111 PRO 111 264 264 PRO PRO A . n A 1 112 LEU 112 265 265 LEU LEU A . n A 1 113 GLN 113 266 266 GLN GLN A . n A 1 114 THR 114 267 267 THR THR A . n A 1 115 LEU 115 268 268 LEU LEU A . n A 1 116 PHE 116 269 269 PHE PHE A . n A 1 117 ALA 117 270 270 ALA ALA A . n A 1 118 MET 118 271 271 MET MET A . n A 1 119 SER 119 272 272 SER SER A . n A 1 120 GLN 120 273 273 GLN GLN A . n A 1 121 TYR 121 274 274 TYR TYR A . n A 1 122 SER 122 275 275 SER SER A . n A 1 123 GLN 123 276 276 GLN GLN A . n A 1 124 ALA 124 277 277 ALA ALA A . n A 1 125 GLY 125 278 278 GLY GLY A . n A 1 126 PHE 126 279 279 PHE PHE A . n A 1 127 SER 127 280 280 SER SER A . n A 1 128 ARG 128 281 281 ARG ARG A . n A 1 129 GLU 129 282 282 GLU GLU A . n A 1 130 ASP 130 283 283 ASP ASP A . n A 1 131 ARG 131 284 284 ARG ARG A . n A 1 132 LEU 132 285 285 LEU LEU A . n A 1 133 GLU 133 286 286 GLU GLU A . n A 1 134 GLN 134 287 287 GLN GLN A . n A 1 135 ALA 135 288 288 ALA ALA A . n A 1 136 LYS 136 289 289 LYS LYS A . n A 1 137 LEU 137 290 290 LEU LEU A . n A 1 138 PHE 138 291 291 PHE PHE A . n A 1 139 CYS 139 292 292 CYS CYS A . n A 1 140 GLN 140 293 293 GLN GLN A . n A 1 141 THR 141 294 294 THR THR A . n A 1 142 LEU 142 295 295 LEU LEU A . n A 1 143 GLU 143 296 296 GLU GLU A . n A 1 144 ASP 144 297 297 ASP ASP A . n A 1 145 ILE 145 298 298 ILE ILE A . n A 1 146 LEU 146 299 299 LEU LEU A . n A 1 147 ALA 147 300 300 ALA ALA A . n A 1 148 ASP 148 301 301 ASP ASP A . n A 1 149 ALA 149 302 302 ALA ALA A . n A 1 150 PRO 150 303 303 PRO PRO A . n A 1 151 GLU 151 304 304 GLU GLU A . n A 1 152 SER 152 305 305 SER SER A . n A 1 153 GLN 153 306 306 GLN GLN A . n A 1 154 ASN 154 307 307 ASN ASN A . n A 1 155 ASN 155 308 308 ASN ASN A . n A 1 156 CYS 156 309 309 CYS CYS A . n A 1 157 ARG 157 310 310 ARG ARG A . n A 1 158 LEU 158 311 311 LEU LEU A . n A 1 159 ILE 159 312 312 ILE ILE A . n A 1 160 ALA 160 313 313 ALA ALA A . n A 1 161 TYR 161 314 314 TYR TYR A . n A 1 162 GLN 162 315 315 GLN GLN A . n A 1 163 GLU 163 316 316 GLU GLU A . n A 1 164 PRO 164 317 317 PRO PRO A . n A 1 165 ALA 165 318 ? ? ? A . n A 1 166 ASP 166 319 ? ? ? A . n A 1 167 ASP 167 320 ? ? ? A . n A 1 168 SER 168 321 ? ? ? A . n A 1 169 SER 169 322 322 SER SER A . n A 1 170 PHE 170 323 323 PHE PHE A . n A 1 171 SER 171 324 324 SER SER A . n A 1 172 LEU 172 325 325 LEU LEU A . n A 1 173 SER 173 326 326 SER SER A . n A 1 174 GLN 174 327 327 GLN GLN A . n A 1 175 GLU 175 328 328 GLU GLU A . n A 1 176 VAL 176 329 329 VAL VAL A . n A 1 177 LEU 177 330 330 LEU LEU A . n A 1 178 ARG 178 331 331 ARG ARG A . n A 1 179 HIS 179 332 332 HIS HIS A . n A 1 180 LEU 180 333 333 LEU LEU A . n A 1 181 ARG 181 334 334 ARG ARG A . n A 1 182 GLN 182 335 335 GLN GLN A . n A 1 183 GLU 183 336 336 GLU GLU A . n A 1 184 GLU 184 337 ? ? ? A . n A 1 185 LYS 185 338 ? ? ? A . n A 1 186 GLU 186 339 ? ? ? A . n A 1 187 GLU 187 340 ? ? ? A . n A 1 188 VAL 188 341 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZEV 1 401 1 ZEV LIG A . C 3 HOH 1 501 7 HOH HOH A . C 3 HOH 2 502 4 HOH HOH A . C 3 HOH 3 503 13 HOH HOH A . C 3 HOH 4 504 11 HOH HOH A . C 3 HOH 5 505 1 HOH HOH A . C 3 HOH 6 506 14 HOH HOH A . C 3 HOH 7 507 5 HOH HOH A . C 3 HOH 8 508 10 HOH HOH A . C 3 HOH 9 509 22 HOH HOH A . C 3 HOH 10 510 21 HOH HOH A . C 3 HOH 11 511 15 HOH HOH A . C 3 HOH 12 512 3 HOH HOH A . C 3 HOH 13 513 16 HOH HOH A . C 3 HOH 14 514 9 HOH HOH A . C 3 HOH 15 515 17 HOH HOH A . C 3 HOH 16 516 8 HOH HOH A . C 3 HOH 17 517 28 HOH HOH A . C 3 HOH 18 518 6 HOH HOH A . C 3 HOH 19 519 12 HOH HOH A . C 3 HOH 20 520 2 HOH HOH A . C 3 HOH 21 521 23 HOH HOH A . C 3 HOH 22 522 20 HOH HOH A . C 3 HOH 23 523 18 HOH HOH A . C 3 HOH 24 524 27 HOH HOH A . C 3 HOH 25 525 24 HOH HOH A . C 3 HOH 26 526 26 HOH HOH A . C 3 HOH 27 527 19 HOH HOH A . C 3 HOH 28 528 1001 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4270 ? 1 MORE -21 ? 1 'SSA (A^2)' 16270 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_654 -x+1,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 95.0410288028 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -35.7054093985 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 517 ? C HOH . 2 1 A HOH 528 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-06 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 34.9860 _pdbx_refine_tls.origin_y 6.0780 _pdbx_refine_tls.origin_z -19.4144 _pdbx_refine_tls.T[1][1] -0.0764 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0161 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0552 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.0127 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0135 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.0990 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.3306 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.6178 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.2363 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.9913 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.0310 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.7955 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0244 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0835 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0537 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0056 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0185 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1434 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0295 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.2921 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0058 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 154 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 336 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.6 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.21 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? . 4 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 6 # _pdbx_entry_details.entry_id 7MHC _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 167 ? ? -147.19 -69.91 2 1 ARG A 197 ? ? 86.81 145.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 318 ? A ALA 165 2 1 Y 1 A ASP 319 ? A ASP 166 3 1 Y 1 A ASP 320 ? A ASP 167 4 1 Y 1 A SER 321 ? A SER 168 5 1 Y 1 A GLU 337 ? A GLU 184 6 1 Y 1 A LYS 338 ? A LYS 185 7 1 Y 1 A GLU 339 ? A GLU 186 8 1 Y 1 A GLU 340 ? A GLU 187 9 1 Y 1 A VAL 341 ? A VAL 188 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZEV N1 N Y N 391 ZEV N3 N Y N 392 ZEV C4 C Y N 393 ZEV C5 C Y N 394 ZEV C6 C Y N 395 ZEV C7 C Y N 396 ZEV C8 C Y N 397 ZEV C10 C N N 398 ZEV C13 C N R 399 ZEV C15 C Y N 400 ZEV C17 C Y N 401 ZEV O8 O N N 402 ZEV P P N R 403 ZEV O O N N 404 ZEV S S N N 405 ZEV O1 O N N 406 ZEV C1 C N R 407 ZEV C9 C N R 408 ZEV O2 O N N 409 ZEV C3 C N R 410 ZEV N N Y N 411 ZEV N2 N Y N 412 ZEV N4 N N N 413 ZEV C2 C N S 414 ZEV F1 F N N 415 ZEV O3 O N N 416 ZEV P1 P N R 417 ZEV S1 S N N 418 ZEV O7 O N N 419 ZEV O4 O N N 420 ZEV C11 C N S 421 ZEV C14 C N R 422 ZEV O5 O N N 423 ZEV C12 C N R 424 ZEV F F N N 425 ZEV C C N N 426 ZEV N5 N Y N 427 ZEV N6 N Y N 428 ZEV C16 C Y N 429 ZEV C18 C N N 430 ZEV O6 O N N 431 ZEV N7 N N N 432 ZEV C19 C N N 433 ZEV N9 N N N 434 ZEV N8 N N N 435 ZEV H11 H N N 436 ZEV H12 H N N 437 ZEV H15 H N N 438 ZEV H16 H N N 439 ZEV H6 H N N 440 ZEV H17 H N N 441 ZEV H H N N 442 ZEV H3 H N N 443 ZEV H2 H N N 444 ZEV H13 H N N 445 ZEV H14 H N N 446 ZEV H1 H N N 447 ZEV H4 H N N 448 ZEV H7 H N N 449 ZEV H5 H N N 450 ZEV H9 H N N 451 ZEV H10 H N N 452 ZEV H8 H N N 453 ZEV H19 H N N 454 ZEV H18 H N N 455 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 ZEV S1 P1 doub N N 376 ZEV O7 P1 sing N N 377 ZEV P1 O3 sing N N 378 ZEV P1 O4 sing N N 379 ZEV O3 C10 sing N N 380 ZEV C10 C9 sing N N 381 ZEV O2 C9 sing N N 382 ZEV O2 C3 sing N N 383 ZEV O4 C11 sing N N 384 ZEV C6 N1 doub Y N 385 ZEV C6 N sing Y N 386 ZEV N1 C5 sing Y N 387 ZEV N9 C19 sing N N 388 ZEV C9 C1 sing N N 389 ZEV N C3 sing N N 390 ZEV N C4 sing Y N 391 ZEV C3 C2 sing N N 392 ZEV C5 C4 doub Y N 393 ZEV C5 C7 sing Y N 394 ZEV C19 N8 doub N N 395 ZEV C19 N7 sing N N 396 ZEV N4 C7 sing N N 397 ZEV N8 C15 sing N N 398 ZEV C4 N3 sing Y N 399 ZEV F C12 sing N N 400 ZEV N7 C18 sing N N 401 ZEV C7 N2 doub Y N 402 ZEV C11 C12 sing N N 403 ZEV C11 C14 sing N N 404 ZEV C1 C2 sing N N 405 ZEV C1 O1 sing N N 406 ZEV C15 C16 doub Y N 407 ZEV C15 N5 sing Y N 408 ZEV N3 C8 doub Y N 409 ZEV C12 C13 sing N N 410 ZEV C18 O6 doub N N 411 ZEV C18 C16 sing N N 412 ZEV N2 C8 sing Y N 413 ZEV C14 N5 sing N N 414 ZEV C14 O5 sing N N 415 ZEV C2 F1 sing N N 416 ZEV C16 N6 sing Y N 417 ZEV N5 C17 sing Y N 418 ZEV O1 P sing N N 419 ZEV C17 N6 doub Y N 420 ZEV O5 C13 sing N N 421 ZEV C13 C sing N N 422 ZEV O P sing N N 423 ZEV O C sing N N 424 ZEV O8 P sing N N 425 ZEV P S doub N N 426 ZEV C6 H11 sing N N 427 ZEV C8 H12 sing N N 428 ZEV C10 H15 sing N N 429 ZEV C10 H16 sing N N 430 ZEV C13 H6 sing N N 431 ZEV C17 H17 sing N N 432 ZEV C1 H sing N N 433 ZEV C9 H3 sing N N 434 ZEV C3 H2 sing N N 435 ZEV N4 H13 sing N N 436 ZEV N4 H14 sing N N 437 ZEV C2 H1 sing N N 438 ZEV C11 H4 sing N N 439 ZEV C14 H7 sing N N 440 ZEV C12 H5 sing N N 441 ZEV C H9 sing N N 442 ZEV C H10 sing N N 443 ZEV N7 H8 sing N N 444 ZEV N9 H19 sing N N 445 ZEV N9 H18 sing N N 446 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZEV _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZEV _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2R,5R,7R,8S,10R,12aR,14R,15S,15aR,16R)-7-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-15,16-difluoro-2,10-bis(sulfanyl)octahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione ; ZEV 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4KSY _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #