data_7MHC
#
_entry.id 7MHC
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.380
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 7MHC pdb_00007mhc 10.2210/pdb7mhc/pdb
WWPDB D_1000256260 ? ?
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 7MHC
_pdbx_database_status.recvd_initial_deposition_date 2021-04-15
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site RCSB
_pdbx_database_status.process_site RCSB
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.status_code_nmr_data ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
#
_audit_author.name 'Lesburg, C.A.'
_audit_author.pdbx_ordinal 1
_audit_author.identifier_ORCID 0000-0001-7245-7331
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country UK
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev Nature
_citation.journal_id_ASTM NATUAS
_citation.journal_id_CSD 0006
_citation.journal_id_ISSN 1476-4687
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 603
_citation.language ?
_citation.page_first 439
_citation.page_last 444
_citation.title 'A kinase-cGAS cascade to synthesize a therapeutic STING activator.'
_citation.year 2022
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1038/s41586-022-04422-9
_citation.pdbx_database_id_PubMed 35296845
_citation.pdbx_database_id_patent ?
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'McIntosh, J.A.' 1 0000-0002-9487-490X
primary 'Liu, Z.' 2 ?
primary 'Andresen, B.M.' 3 0000-0002-9645-3359
primary 'Marzijarani, N.S.' 4 0000-0001-8940-4674
primary 'Moore, J.C.' 5 0000-0002-9807-6315
primary 'Marshall, N.M.' 6 ?
primary 'Borra-Garske, M.' 7 ?
primary 'Obligacion, J.V.' 8 ?
primary 'Fier, P.S.' 9 ?
primary 'Peng, F.' 10 ?
primary 'Forstater, J.H.' 11 ?
primary 'Winston, M.S.' 12 ?
primary 'An, C.' 13 ?
primary 'Chang, W.' 14 ?
primary 'Lim, J.' 15 ?
primary 'Huffman, M.A.' 16 ?
primary 'Miller, S.P.' 17 0000-0001-8615-274X
primary 'Tsay, F.R.' 18 ?
primary 'Altman, M.D.' 19 ?
primary 'Lesburg, C.A.' 20 0000-0001-7245-7331
primary 'Steinhuebel, D.' 21 ?
primary 'Trotter, B.W.' 22 0000-0002-6780-0358
primary 'Cumming, J.N.' 23 ?
primary 'Northrup, A.' 24 ?
primary 'Bu, X.' 25 ?
primary 'Mann, B.F.' 26 ?
primary 'Biba, M.' 27 ?
primary 'Hiraga, K.' 28 ?
primary 'Murphy, G.S.' 29 0000-0003-0388-0309
primary 'Kolev, J.N.' 30 ?
primary 'Makarewicz, A.' 31 ?
primary 'Pan, W.' 32 ?
primary 'Farasat, I.' 33 ?
primary 'Bade, R.S.' 34 0000-0002-5384-9687
primary 'Stone, K.' 35 ?
primary 'Duan, D.' 36 ?
primary 'Alvizo, O.' 37 ?
primary 'Adpressa, D.' 38 ?
primary 'Guetschow, E.' 39 ?
primary 'Hoyt, E.' 40 ?
primary 'Regalado, E.L.' 41 0000-0002-7352-6391
primary 'Castro, S.' 42 ?
primary 'Rivera, N.' 43 ?
primary 'Smith, J.P.' 44 0000-0002-0062-2534
primary 'Wang, F.' 45 ?
primary 'Crespo, A.' 46 ?
primary 'Verma, D.' 47 0000-0003-0740-0624
primary 'Axnanda, S.' 48 0000-0002-7239-9220
primary 'Dance, Z.E.X.' 49 0000-0003-1807-7930
primary 'Devine, P.N.' 50 ?
primary 'Tschaen, D.' 51 ?
primary 'Canada, K.A.' 52 ?
primary 'Bulger, P.G.' 53 ?
primary 'Sherry, B.D.' 54 ?
primary 'Truppo, M.D.' 55 ?
primary 'Ruck, R.T.' 56 0000-0001-9980-9675
primary 'Campeau, L.C.' 57 0000-0002-2373-802X
primary 'Bennett, D.J.' 58 0000-0003-0163-7479
primary 'Humphrey, G.R.' 59 ?
primary 'Campos, K.R.' 60 ?
primary 'Maddess, M.L.' 61 ?
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 100.970
_cell.angle_beta_esd ?
_cell.angle_gamma 90.000
_cell.angle_gamma_esd ?
_cell.entry_id 7MHC
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 88.120
_cell.length_a_esd ?
_cell.length_b 72.740
_cell.length_b_esd ?
_cell.length_c 36.370
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 4
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 7MHC
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 5
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'C 1 2 1'
_symmetry.pdbx_full_space_group_name_H-M ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Stimulator of interferon genes protein' 21555.191 1 ? 'G230A, H232R, R293Q' ? ?
2 non-polymer nat
;(2R,5R,7R,8S,10R,12aR,14R,15S,15aR,16R)-7-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-15,16-difluoro-2,10-bis(sulfanyl)octahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione
;
708.509 1 ? ? ? ?
3 water nat water 18.015 28 ? ? ? ?
#
_entity_name_com.entity_id 1
_entity_name_com.name
'hSTING,Endoplasmic reticulum interferon stimulator,ERIS,Mediator of IRF3 activation,hMITA,Transmembrane protein 173'
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRA
GIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCRLIA
YQEPADDSSFSLSQEVLRHLRQEEKEEV
;
_entity_poly.pdbx_seq_one_letter_code_can
;NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRA
GIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCRLIA
YQEPADDSSFSLSQEVLRHLRQEEKEEV
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 ASN n
1 2 VAL n
1 3 ALA n
1 4 HIS n
1 5 GLY n
1 6 LEU n
1 7 ALA n
1 8 TRP n
1 9 SER n
1 10 TYR n
1 11 TYR n
1 12 ILE n
1 13 GLY n
1 14 TYR n
1 15 LEU n
1 16 ARG n
1 17 LEU n
1 18 ILE n
1 19 LEU n
1 20 PRO n
1 21 GLU n
1 22 LEU n
1 23 GLN n
1 24 ALA n
1 25 ARG n
1 26 ILE n
1 27 ARG n
1 28 THR n
1 29 TYR n
1 30 ASN n
1 31 GLN n
1 32 HIS n
1 33 TYR n
1 34 ASN n
1 35 ASN n
1 36 LEU n
1 37 LEU n
1 38 ARG n
1 39 GLY n
1 40 ALA n
1 41 VAL n
1 42 SER n
1 43 GLN n
1 44 ARG n
1 45 LEU n
1 46 TYR n
1 47 ILE n
1 48 LEU n
1 49 LEU n
1 50 PRO n
1 51 LEU n
1 52 ASP n
1 53 CYS n
1 54 GLY n
1 55 VAL n
1 56 PRO n
1 57 ASP n
1 58 ASN n
1 59 LEU n
1 60 SER n
1 61 MET n
1 62 ALA n
1 63 ASP n
1 64 PRO n
1 65 ASN n
1 66 ILE n
1 67 ARG n
1 68 PHE n
1 69 LEU n
1 70 ASP n
1 71 LYS n
1 72 LEU n
1 73 PRO n
1 74 GLN n
1 75 GLN n
1 76 THR n
1 77 ALA n
1 78 ASP n
1 79 ARG n
1 80 ALA n
1 81 GLY n
1 82 ILE n
1 83 LYS n
1 84 ASP n
1 85 ARG n
1 86 VAL n
1 87 TYR n
1 88 SER n
1 89 ASN n
1 90 SER n
1 91 ILE n
1 92 TYR n
1 93 GLU n
1 94 LEU n
1 95 LEU n
1 96 GLU n
1 97 ASN n
1 98 GLY n
1 99 GLN n
1 100 ARG n
1 101 ALA n
1 102 GLY n
1 103 THR n
1 104 CYS n
1 105 VAL n
1 106 LEU n
1 107 GLU n
1 108 TYR n
1 109 ALA n
1 110 THR n
1 111 PRO n
1 112 LEU n
1 113 GLN n
1 114 THR n
1 115 LEU n
1 116 PHE n
1 117 ALA n
1 118 MET n
1 119 SER n
1 120 GLN n
1 121 TYR n
1 122 SER n
1 123 GLN n
1 124 ALA n
1 125 GLY n
1 126 PHE n
1 127 SER n
1 128 ARG n
1 129 GLU n
1 130 ASP n
1 131 ARG n
1 132 LEU n
1 133 GLU n
1 134 GLN n
1 135 ALA n
1 136 LYS n
1 137 LEU n
1 138 PHE n
1 139 CYS n
1 140 GLN n
1 141 THR n
1 142 LEU n
1 143 GLU n
1 144 ASP n
1 145 ILE n
1 146 LEU n
1 147 ALA n
1 148 ASP n
1 149 ALA n
1 150 PRO n
1 151 GLU n
1 152 SER n
1 153 GLN n
1 154 ASN n
1 155 ASN n
1 156 CYS n
1 157 ARG n
1 158 LEU n
1 159 ILE n
1 160 ALA n
1 161 TYR n
1 162 GLN n
1 163 GLU n
1 164 PRO n
1 165 ALA n
1 166 ASP n
1 167 ASP n
1 168 SER n
1 169 SER n
1 170 PHE n
1 171 SER n
1 172 LEU n
1 173 SER n
1 174 GLN n
1 175 GLU n
1 176 VAL n
1 177 LEU n
1 178 ARG n
1 179 HIS n
1 180 LEU n
1 181 ARG n
1 182 GLN n
1 183 GLU n
1 184 GLU n
1 185 LYS n
1 186 GLU n
1 187 GLU n
1 188 VAL n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 188
_entity_src_gen.gene_src_common_name Human
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene 'STING1, ERIS, MITA, TMEM173'
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code STING_HUMAN
_struct_ref.pdbx_db_accession Q86WV6
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;NVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHA
GIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIA
YQEPADDSSFSLSQEVLRHLRQEEKEEV
;
_struct_ref.pdbx_align_begin 154
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 7MHC
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 1
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 188
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession Q86WV6
_struct_ref_seq.db_align_beg 154
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 341
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 154
_struct_ref_seq.pdbx_auth_seq_align_end 341
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 7MHC ALA A 77 ? UNP Q86WV6 GLY 230 'engineered mutation' 230 1
1 7MHC ARG A 79 ? UNP Q86WV6 HIS 232 'engineered mutation' 232 2
1 7MHC GLN A 140 ? UNP Q86WV6 ARG 293 'engineered mutation' 293 3
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ? 'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
ZEV non-polymer .
;(2R,5R,7R,8S,10R,12aR,14R,15S,15aR,16R)-7-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-15,16-difluoro-2,10-bis(sulfanyl)octahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione
;
? 'C20 H20 F2 N10 O9 P2 S2 -2' 708.509
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 7MHC
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 2.65
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 53.66
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH 8.5
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 293
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '0.1 M TRIS; 0.2 M NaCl; 28.0 w/v PEG 6K'
_exptl_crystal_grow.pdbx_pH_range ?
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details ?
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS PILATUS 6M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2016-03-23
_diffrn_detector.pdbx_frequency ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 1.0
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'APS BEAMLINE 17-ID'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 1.0
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline 17-ID
_diffrn_source.pdbx_synchrotron_site APS
#
_reflns.B_iso_Wilson_estimate 62.710
_reflns.entry_id 7MHC
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 2.32
_reflns.d_resolution_low 35.700
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 9280
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 94.500
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 3.300
_reflns.pdbx_Rmerge_I_obs ?
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 13.400
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all 0.052
_reflns.pdbx_Rpim_I_all 0.028
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 0.999
_reflns.pdbx_CC_star ?
_reflns.pdbx_R_split ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_1 ?
_reflns.pdbx_aniso_diffraction_limit_2 ?
_reflns.pdbx_aniso_diffraction_limit_3 ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_1 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_2 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_3 ?
_reflns.pdbx_orthogonalization_convention ?
_reflns.pdbx_percent_possible_ellipsoidal ?
_reflns.pdbx_percent_possible_spherical ?
_reflns.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns.pdbx_percent_possible_spherical_anomalous ?
_reflns.pdbx_redundancy_anomalous ?
_reflns.pdbx_CC_half_anomalous ?
_reflns.pdbx_absDiff_over_sigma_anomalous ?
_reflns.pdbx_percent_possible_anomalous ?
_reflns.pdbx_observed_signal_threshold ?
_reflns.pdbx_signal_type ?
_reflns.pdbx_signal_details ?
_reflns.pdbx_signal_software_id ?
#
_reflns_shell.d_res_high 2.321
_reflns_shell.d_res_low 2.329
_reflns_shell.meanI_over_sigI_all ?
_reflns_shell.meanI_over_sigI_obs 2.100
_reflns_shell.number_measured_all 4931
_reflns_shell.number_measured_obs ?
_reflns_shell.number_possible ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_unique_obs 1422
_reflns_shell.percent_possible_all 98.000
_reflns_shell.percent_possible_obs ?
_reflns_shell.Rmerge_F_all ?
_reflns_shell.Rmerge_F_obs ?
_reflns_shell.Rmerge_I_all ?
_reflns_shell.Rmerge_I_obs ?
_reflns_shell.meanI_over_sigI_gt ?
_reflns_shell.meanI_over_uI_all ?
_reflns_shell.meanI_over_uI_gt ?
_reflns_shell.number_measured_gt ?
_reflns_shell.number_unique_gt ?
_reflns_shell.percent_possible_gt ?
_reflns_shell.Rmerge_F_gt ?
_reflns_shell.Rmerge_I_gt ?
_reflns_shell.pdbx_redundancy 3.400
_reflns_shell.pdbx_Rsym_value ?
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_netI_over_sigmaI_all ?
_reflns_shell.pdbx_netI_over_sigmaI_obs 1.900
_reflns_shell.pdbx_Rrim_I_all 0.586
_reflns_shell.pdbx_Rpim_I_all 0.309
_reflns_shell.pdbx_rejects ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
_reflns_shell.pdbx_CC_half 0.894
_reflns_shell.pdbx_CC_star ?
_reflns_shell.pdbx_R_split ?
_reflns_shell.pdbx_percent_possible_ellipsoidal ?
_reflns_shell.pdbx_percent_possible_spherical ?
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns_shell.pdbx_percent_possible_spherical_anomalous ?
_reflns_shell.pdbx_redundancy_anomalous ?
_reflns_shell.pdbx_CC_half_anomalous ?
_reflns_shell.pdbx_absDiff_over_sigma_anomalous ?
_reflns_shell.pdbx_percent_possible_anomalous ?
#
_refine.aniso_B[1][1] 4.4208
_refine.aniso_B[1][2] 0.0000
_refine.aniso_B[1][3] -15.1166
_refine.aniso_B[2][2] -4.5729
_refine.aniso_B[2][3] 0.0000
_refine.aniso_B[3][3] 0.1521
_refine.B_iso_max 185.780
_refine.B_iso_mean 72.53
_refine.B_iso_min 36.330
_refine.correlation_coeff_Fo_to_Fc 0.9439
_refine.correlation_coeff_Fo_to_Fc_free 0.9261
_refine.details ?
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 7MHC
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 2.3200
_refine.ls_d_res_low 35.7000
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 9279
_refine.ls_number_reflns_R_free 488
_refine.ls_number_reflns_R_work ?
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 94.3700
_refine.ls_percent_reflns_R_free 5.2600
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.1935
_refine.ls_R_factor_R_free 0.2243
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.1919
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details ?
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.pdbx_R_complete ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 0.000
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS'
_refine.pdbx_starting_model 4ksy
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details RANDOM
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free ?
_refine.pdbx_solvent_vdw_probe_radii ?
_refine.pdbx_solvent_ion_probe_radii ?
_refine.pdbx_solvent_shrinkage_radii ?
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.2140
_refine.pdbx_overall_SU_R_free_Blow_DPI 0.2080
_refine.pdbx_overall_SU_R_Blow_DPI 0.2980
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B ?
_refine.overall_SU_ML ?
_refine.overall_SU_R_Cruickshank_DPI 0.3150
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_analyze.entry_id 7MHC
_refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_analyze.Luzzati_coordinate_error_free ?
_refine_analyze.Luzzati_coordinate_error_obs 0.330
_refine_analyze.Luzzati_d_res_low_free ?
_refine_analyze.Luzzati_d_res_low_obs ?
_refine_analyze.Luzzati_sigma_a_free ?
_refine_analyze.Luzzati_sigma_a_free_details ?
_refine_analyze.Luzzati_sigma_a_obs ?
_refine_analyze.Luzzati_sigma_a_obs_details ?
_refine_analyze.number_disordered_residues ?
_refine_analyze.occupancy_sum_hydrogen ?
_refine_analyze.occupancy_sum_non_hydrogen ?
_refine_analyze.RG_d_res_high ?
_refine_analyze.RG_d_res_low ?
_refine_analyze.RG_free ?
_refine_analyze.RG_work ?
_refine_analyze.RG_free_work_ratio ?
_refine_analyze.pdbx_Luzzati_d_res_high_obs ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id final
_refine_hist.details ?
_refine_hist.d_res_high 2.3200
_refine_hist.d_res_low 35.7000
_refine_hist.number_atoms_solvent 28
_refine_hist.number_atoms_total 1538
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total 179
_refine_hist.pdbx_B_iso_mean_ligand 45.29
_refine_hist.pdbx_B_iso_mean_solvent 64.02
_refine_hist.pdbx_number_atoms_protein 1445
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 65
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? ? ? 545 ? t_dihedral_angle_d 2.000 SINUSOIDAL
'X-RAY DIFFRACTION' ? ? ? 45 ? t_trig_c_planes 2.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? 250 ? t_gen_planes 5.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? 1543 ? t_it 20.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? 194 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC
'X-RAY DIFFRACTION' ? ? ? 1631 ? t_ideal_dist_contact 4.000 SEMIHARMONIC
'X-RAY DIFFRACTION' ? 0.010 ? 1543 ? t_bond_d 2.000 HARMONIC
'X-RAY DIFFRACTION' ? 1.090 ? 2123 ? t_angle_deg 2.000 HARMONIC
'X-RAY DIFFRACTION' ? 2.960 ? ? ? t_omega_torsion ? ?
'X-RAY DIFFRACTION' ? 19.020 ? ? ? t_other_torsion ? ?
#
_refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_ls_shell.d_res_high 2.3200
_refine_ls_shell.d_res_low 2.5900
_refine_ls_shell.number_reflns_all 2762
_refine_ls_shell.number_reflns_obs ?
_refine_ls_shell.number_reflns_R_free 143
_refine_ls_shell.number_reflns_R_work 2619
_refine_ls_shell.percent_reflns_obs 99.0300
_refine_ls_shell.percent_reflns_R_free 5.1800
_refine_ls_shell.R_factor_all 0.2166
_refine_ls_shell.R_factor_obs ?
_refine_ls_shell.R_factor_R_free 0.3075
_refine_ls_shell.R_factor_R_free_error 0.0000
_refine_ls_shell.R_factor_R_work 0.2121
_refine_ls_shell.redundancy_reflns_all ?
_refine_ls_shell.redundancy_reflns_obs ?
_refine_ls_shell.wR_factor_all ?
_refine_ls_shell.wR_factor_obs ?
_refine_ls_shell.wR_factor_R_free ?
_refine_ls_shell.wR_factor_R_work ?
_refine_ls_shell.pdbx_R_complete ?
_refine_ls_shell.pdbx_total_number_of_bins_used 5
_refine_ls_shell.pdbx_phase_error ?
_refine_ls_shell.pdbx_fsc_work ?
_refine_ls_shell.pdbx_fsc_free ?
#
_struct.entry_id 7MHC
_struct.title 'Structure of human STING in complex with MK-1454'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 7MHC
_struct_keywords.text 'STING, RECEPTOR, LIGAND COMPLEX, AGONIST, CLOSED CONFORMATION, IMMUNE SYSTEM'
_struct_keywords.pdbx_keywords 'IMMUNE SYSTEM'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 ASN A 1 ? GLY A 13 ? ASN A 154 GLY A 166 1 ? 13
HELX_P HELX_P2 AA2 TYR A 14 ? GLN A 31 ? TYR A 167 GLN A 184 1 ? 18
HELX_P HELX_P3 AA3 ASN A 58 ? ALA A 62 ? ASN A 211 ALA A 215 5 ? 5
HELX_P HELX_P4 AA4 ALA A 109 ? TYR A 121 ? ALA A 262 TYR A 274 1 ? 13
HELX_P HELX_P5 AA5 SER A 122 ? GLY A 125 ? SER A 275 GLY A 278 5 ? 4
HELX_P HELX_P6 AA6 SER A 127 ? ASP A 148 ? SER A 280 ASP A 301 1 ? 22
HELX_P HELX_P7 AA7 SER A 171 ? GLN A 182 ? SER A 324 GLN A 335 1 ? 12
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 5 ?
AA2 ? 2 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA1 3 4 ? parallel
AA1 4 5 ? parallel
AA2 1 2 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 ILE A 66 ? LYS A 71 ? ILE A 219 LYS A 224
AA1 2 SER A 90 ? GLU A 96 ? SER A 243 GLU A 249
AA1 3 GLN A 99 ? TYR A 108 ? GLN A 252 TYR A 261
AA1 4 LEU A 45 ? PRO A 50 ? LEU A 198 PRO A 203
AA1 5 CYS A 156 ? TYR A 161 ? CYS A 309 TYR A 314
AA2 1 GLN A 75 ? ARG A 79 ? GLN A 228 ARG A 232
AA2 2 ILE A 82 ? TYR A 87 ? ILE A 235 TYR A 240
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N ASP A 70 ? N ASP A 223 O ILE A 91 ? O ILE A 244
AA1 2 3 N LEU A 94 ? N LEU A 247 O ALA A 101 ? O ALA A 254
AA1 3 4 O GLU A 107 ? O GLU A 260 N LEU A 48 ? N LEU A 201
AA1 4 5 N LEU A 45 ? N LEU A 198 O ARG A 157 ? O ARG A 310
AA2 1 2 N ARG A 79 ? N ARG A 232 O ILE A 82 ? O ILE A 235
#
_struct_site.id AC1
_struct_site.pdbx_evidence_code Software
_struct_site.pdbx_auth_asym_id A
_struct_site.pdbx_auth_comp_id ZEV
_struct_site.pdbx_auth_seq_id 401
_struct_site.pdbx_auth_ins_code ?
_struct_site.pdbx_num_residues 18
_struct_site.details 'binding site for residue ZEV A 401'
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 18 SER A 9 ? SER A 162 . ? 2_654 ?
2 AC1 18 SER A 9 ? SER A 162 . ? 1_555 ?
3 AC1 18 TYR A 10 ? TYR A 163 . ? 1_555 ?
4 AC1 18 TYR A 14 ? TYR A 167 . ? 2_654 ?
5 AC1 18 TYR A 14 ? TYR A 167 . ? 1_555 ?
6 AC1 18 ARG A 85 ? ARG A 238 . ? 2_654 ?
7 AC1 18 ARG A 85 ? ARG A 238 . ? 1_555 ?
8 AC1 18 TYR A 87 ? TYR A 240 . ? 2_654 ?
9 AC1 18 TYR A 87 ? TYR A 240 . ? 1_555 ?
10 AC1 18 GLU A 107 ? GLU A 260 . ? 1_555 ?
11 AC1 18 THR A 110 ? THR A 263 . ? 2_654 ?
12 AC1 18 THR A 110 ? THR A 263 . ? 1_555 ?
13 AC1 18 PRO A 111 ? PRO A 264 . ? 1_555 ?
14 AC1 18 THR A 114 ? THR A 267 . ? 1_555 ?
15 AC1 18 THR A 114 ? THR A 267 . ? 2_654 ?
16 AC1 18 HOH C . ? HOH A 505 . ? 1_555 ?
17 AC1 18 HOH C . ? HOH A 505 . ? 2_654 ?
18 AC1 18 HOH C . ? HOH A 520 . ? 1_555 ?
#
_atom_sites.entry_id 7MHC
_atom_sites.Cartn_transf_matrix[1][1] ?
_atom_sites.Cartn_transf_matrix[1][2] ?
_atom_sites.Cartn_transf_matrix[1][3] ?
_atom_sites.Cartn_transf_matrix[2][1] ?
_atom_sites.Cartn_transf_matrix[2][2] ?
_atom_sites.Cartn_transf_matrix[2][3] ?
_atom_sites.Cartn_transf_matrix[3][1] ?
_atom_sites.Cartn_transf_matrix[3][2] ?
_atom_sites.Cartn_transf_matrix[3][3] ?
_atom_sites.Cartn_transf_vector[1] ?
_atom_sites.Cartn_transf_vector[2] ?
_atom_sites.Cartn_transf_vector[3] ?
_atom_sites.fract_transf_matrix[1][1] 0.011348
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.002200
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.013748
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.028007
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
_atom_sites.solution_primary ?
_atom_sites.solution_secondary ?
_atom_sites.solution_hydrogens ?
_atom_sites.special_details ?
#
loop_
_atom_type.symbol
C
F
H
N
O
P
S
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 ASN 1 154 154 ASN ASN A . n
A 1 2 VAL 2 155 155 VAL VAL A . n
A 1 3 ALA 3 156 156 ALA ALA A . n
A 1 4 HIS 4 157 157 HIS HIS A . n
A 1 5 GLY 5 158 158 GLY GLY A . n
A 1 6 LEU 6 159 159 LEU LEU A . n
A 1 7 ALA 7 160 160 ALA ALA A . n
A 1 8 TRP 8 161 161 TRP TRP A . n
A 1 9 SER 9 162 162 SER SER A . n
A 1 10 TYR 10 163 163 TYR TYR A . n
A 1 11 TYR 11 164 164 TYR TYR A . n
A 1 12 ILE 12 165 165 ILE ILE A . n
A 1 13 GLY 13 166 166 GLY GLY A . n
A 1 14 TYR 14 167 167 TYR TYR A . n
A 1 15 LEU 15 168 168 LEU LEU A . n
A 1 16 ARG 16 169 169 ARG ARG A . n
A 1 17 LEU 17 170 170 LEU LEU A . n
A 1 18 ILE 18 171 171 ILE ILE A . n
A 1 19 LEU 19 172 172 LEU LEU A . n
A 1 20 PRO 20 173 173 PRO PRO A . n
A 1 21 GLU 21 174 174 GLU GLU A . n
A 1 22 LEU 22 175 175 LEU LEU A . n
A 1 23 GLN 23 176 176 GLN GLN A . n
A 1 24 ALA 24 177 177 ALA ALA A . n
A 1 25 ARG 25 178 178 ARG ARG A . n
A 1 26 ILE 26 179 179 ILE ILE A . n
A 1 27 ARG 27 180 180 ARG ARG A . n
A 1 28 THR 28 181 181 THR THR A . n
A 1 29 TYR 29 182 182 TYR TYR A . n
A 1 30 ASN 30 183 183 ASN ASN A . n
A 1 31 GLN 31 184 184 GLN GLN A . n
A 1 32 HIS 32 185 185 HIS HIS A . n
A 1 33 TYR 33 186 186 TYR TYR A . n
A 1 34 ASN 34 187 187 ASN ASN A . n
A 1 35 ASN 35 188 188 ASN ASN A . n
A 1 36 LEU 36 189 189 LEU LEU A . n
A 1 37 LEU 37 190 190 LEU LEU A . n
A 1 38 ARG 38 191 191 ARG ARG A . n
A 1 39 GLY 39 192 192 GLY GLY A . n
A 1 40 ALA 40 193 193 ALA ALA A . n
A 1 41 VAL 41 194 194 VAL VAL A . n
A 1 42 SER 42 195 195 SER SER A . n
A 1 43 GLN 43 196 196 GLN GLN A . n
A 1 44 ARG 44 197 197 ARG ARG A . n
A 1 45 LEU 45 198 198 LEU LEU A . n
A 1 46 TYR 46 199 199 TYR TYR A . n
A 1 47 ILE 47 200 200 ILE ILE A . n
A 1 48 LEU 48 201 201 LEU LEU A . n
A 1 49 LEU 49 202 202 LEU LEU A . n
A 1 50 PRO 50 203 203 PRO PRO A . n
A 1 51 LEU 51 204 204 LEU LEU A . n
A 1 52 ASP 52 205 205 ASP ASP A . n
A 1 53 CYS 53 206 206 CYS CYS A . n
A 1 54 GLY 54 207 207 GLY GLY A . n
A 1 55 VAL 55 208 208 VAL VAL A . n
A 1 56 PRO 56 209 209 PRO PRO A . n
A 1 57 ASP 57 210 210 ASP ASP A . n
A 1 58 ASN 58 211 211 ASN ASN A . n
A 1 59 LEU 59 212 212 LEU LEU A . n
A 1 60 SER 60 213 213 SER SER A . n
A 1 61 MET 61 214 214 MET MET A . n
A 1 62 ALA 62 215 215 ALA ALA A . n
A 1 63 ASP 63 216 216 ASP ASP A . n
A 1 64 PRO 64 217 217 PRO PRO A . n
A 1 65 ASN 65 218 218 ASN ASN A . n
A 1 66 ILE 66 219 219 ILE ILE A . n
A 1 67 ARG 67 220 220 ARG ARG A . n
A 1 68 PHE 68 221 221 PHE PHE A . n
A 1 69 LEU 69 222 222 LEU LEU A . n
A 1 70 ASP 70 223 223 ASP ASP A . n
A 1 71 LYS 71 224 224 LYS LYS A . n
A 1 72 LEU 72 225 225 LEU LEU A . n
A 1 73 PRO 73 226 226 PRO PRO A . n
A 1 74 GLN 74 227 227 GLN GLN A . n
A 1 75 GLN 75 228 228 GLN GLN A . n
A 1 76 THR 76 229 229 THR THR A . n
A 1 77 ALA 77 230 230 ALA ALA A . n
A 1 78 ASP 78 231 231 ASP ASP A . n
A 1 79 ARG 79 232 232 ARG ARG A . n
A 1 80 ALA 80 233 233 ALA ALA A . n
A 1 81 GLY 81 234 234 GLY GLY A . n
A 1 82 ILE 82 235 235 ILE ILE A . n
A 1 83 LYS 83 236 236 LYS LYS A . n
A 1 84 ASP 84 237 237 ASP ASP A . n
A 1 85 ARG 85 238 238 ARG ARG A . n
A 1 86 VAL 86 239 239 VAL VAL A . n
A 1 87 TYR 87 240 240 TYR TYR A . n
A 1 88 SER 88 241 241 SER SER A . n
A 1 89 ASN 89 242 242 ASN ASN A . n
A 1 90 SER 90 243 243 SER SER A . n
A 1 91 ILE 91 244 244 ILE ILE A . n
A 1 92 TYR 92 245 245 TYR TYR A . n
A 1 93 GLU 93 246 246 GLU GLU A . n
A 1 94 LEU 94 247 247 LEU LEU A . n
A 1 95 LEU 95 248 248 LEU LEU A . n
A 1 96 GLU 96 249 249 GLU GLU A . n
A 1 97 ASN 97 250 250 ASN ASN A . n
A 1 98 GLY 98 251 251 GLY GLY A . n
A 1 99 GLN 99 252 252 GLN GLN A . n
A 1 100 ARG 100 253 253 ARG ARG A . n
A 1 101 ALA 101 254 254 ALA ALA A . n
A 1 102 GLY 102 255 255 GLY GLY A . n
A 1 103 THR 103 256 256 THR THR A . n
A 1 104 CYS 104 257 257 CYS CYS A . n
A 1 105 VAL 105 258 258 VAL VAL A . n
A 1 106 LEU 106 259 259 LEU LEU A . n
A 1 107 GLU 107 260 260 GLU GLU A . n
A 1 108 TYR 108 261 261 TYR TYR A . n
A 1 109 ALA 109 262 262 ALA ALA A . n
A 1 110 THR 110 263 263 THR THR A . n
A 1 111 PRO 111 264 264 PRO PRO A . n
A 1 112 LEU 112 265 265 LEU LEU A . n
A 1 113 GLN 113 266 266 GLN GLN A . n
A 1 114 THR 114 267 267 THR THR A . n
A 1 115 LEU 115 268 268 LEU LEU A . n
A 1 116 PHE 116 269 269 PHE PHE A . n
A 1 117 ALA 117 270 270 ALA ALA A . n
A 1 118 MET 118 271 271 MET MET A . n
A 1 119 SER 119 272 272 SER SER A . n
A 1 120 GLN 120 273 273 GLN GLN A . n
A 1 121 TYR 121 274 274 TYR TYR A . n
A 1 122 SER 122 275 275 SER SER A . n
A 1 123 GLN 123 276 276 GLN GLN A . n
A 1 124 ALA 124 277 277 ALA ALA A . n
A 1 125 GLY 125 278 278 GLY GLY A . n
A 1 126 PHE 126 279 279 PHE PHE A . n
A 1 127 SER 127 280 280 SER SER A . n
A 1 128 ARG 128 281 281 ARG ARG A . n
A 1 129 GLU 129 282 282 GLU GLU A . n
A 1 130 ASP 130 283 283 ASP ASP A . n
A 1 131 ARG 131 284 284 ARG ARG A . n
A 1 132 LEU 132 285 285 LEU LEU A . n
A 1 133 GLU 133 286 286 GLU GLU A . n
A 1 134 GLN 134 287 287 GLN GLN A . n
A 1 135 ALA 135 288 288 ALA ALA A . n
A 1 136 LYS 136 289 289 LYS LYS A . n
A 1 137 LEU 137 290 290 LEU LEU A . n
A 1 138 PHE 138 291 291 PHE PHE A . n
A 1 139 CYS 139 292 292 CYS CYS A . n
A 1 140 GLN 140 293 293 GLN GLN A . n
A 1 141 THR 141 294 294 THR THR A . n
A 1 142 LEU 142 295 295 LEU LEU A . n
A 1 143 GLU 143 296 296 GLU GLU A . n
A 1 144 ASP 144 297 297 ASP ASP A . n
A 1 145 ILE 145 298 298 ILE ILE A . n
A 1 146 LEU 146 299 299 LEU LEU A . n
A 1 147 ALA 147 300 300 ALA ALA A . n
A 1 148 ASP 148 301 301 ASP ASP A . n
A 1 149 ALA 149 302 302 ALA ALA A . n
A 1 150 PRO 150 303 303 PRO PRO A . n
A 1 151 GLU 151 304 304 GLU GLU A . n
A 1 152 SER 152 305 305 SER SER A . n
A 1 153 GLN 153 306 306 GLN GLN A . n
A 1 154 ASN 154 307 307 ASN ASN A . n
A 1 155 ASN 155 308 308 ASN ASN A . n
A 1 156 CYS 156 309 309 CYS CYS A . n
A 1 157 ARG 157 310 310 ARG ARG A . n
A 1 158 LEU 158 311 311 LEU LEU A . n
A 1 159 ILE 159 312 312 ILE ILE A . n
A 1 160 ALA 160 313 313 ALA ALA A . n
A 1 161 TYR 161 314 314 TYR TYR A . n
A 1 162 GLN 162 315 315 GLN GLN A . n
A 1 163 GLU 163 316 316 GLU GLU A . n
A 1 164 PRO 164 317 317 PRO PRO A . n
A 1 165 ALA 165 318 ? ? ? A . n
A 1 166 ASP 166 319 ? ? ? A . n
A 1 167 ASP 167 320 ? ? ? A . n
A 1 168 SER 168 321 ? ? ? A . n
A 1 169 SER 169 322 322 SER SER A . n
A 1 170 PHE 170 323 323 PHE PHE A . n
A 1 171 SER 171 324 324 SER SER A . n
A 1 172 LEU 172 325 325 LEU LEU A . n
A 1 173 SER 173 326 326 SER SER A . n
A 1 174 GLN 174 327 327 GLN GLN A . n
A 1 175 GLU 175 328 328 GLU GLU A . n
A 1 176 VAL 176 329 329 VAL VAL A . n
A 1 177 LEU 177 330 330 LEU LEU A . n
A 1 178 ARG 178 331 331 ARG ARG A . n
A 1 179 HIS 179 332 332 HIS HIS A . n
A 1 180 LEU 180 333 333 LEU LEU A . n
A 1 181 ARG 181 334 334 ARG ARG A . n
A 1 182 GLN 182 335 335 GLN GLN A . n
A 1 183 GLU 183 336 336 GLU GLU A . n
A 1 184 GLU 184 337 ? ? ? A . n
A 1 185 LYS 185 338 ? ? ? A . n
A 1 186 GLU 186 339 ? ? ? A . n
A 1 187 GLU 187 340 ? ? ? A . n
A 1 188 VAL 188 341 ? ? ? A . n
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 ZEV 1 401 1 ZEV LIG A .
C 3 HOH 1 501 7 HOH HOH A .
C 3 HOH 2 502 4 HOH HOH A .
C 3 HOH 3 503 13 HOH HOH A .
C 3 HOH 4 504 11 HOH HOH A .
C 3 HOH 5 505 1 HOH HOH A .
C 3 HOH 6 506 14 HOH HOH A .
C 3 HOH 7 507 5 HOH HOH A .
C 3 HOH 8 508 10 HOH HOH A .
C 3 HOH 9 509 22 HOH HOH A .
C 3 HOH 10 510 21 HOH HOH A .
C 3 HOH 11 511 15 HOH HOH A .
C 3 HOH 12 512 3 HOH HOH A .
C 3 HOH 13 513 16 HOH HOH A .
C 3 HOH 14 514 9 HOH HOH A .
C 3 HOH 15 515 17 HOH HOH A .
C 3 HOH 16 516 8 HOH HOH A .
C 3 HOH 17 517 28 HOH HOH A .
C 3 HOH 18 518 6 HOH HOH A .
C 3 HOH 19 519 12 HOH HOH A .
C 3 HOH 20 520 2 HOH HOH A .
C 3 HOH 21 521 23 HOH HOH A .
C 3 HOH 22 522 20 HOH HOH A .
C 3 HOH 23 523 18 HOH HOH A .
C 3 HOH 24 524 27 HOH HOH A .
C 3 HOH 25 525 24 HOH HOH A .
C 3 HOH 26 526 26 HOH HOH A .
C 3 HOH 27 527 19 HOH HOH A .
C 3 HOH 28 528 1001 HOH HOH A .
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_and_software_defined_assembly
_pdbx_struct_assembly.method_details PISA
_pdbx_struct_assembly.oligomeric_details dimeric
_pdbx_struct_assembly.oligomeric_count 2
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1,2
_pdbx_struct_assembly_gen.asym_id_list A,B,C
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 4270 ?
1 MORE -21 ?
1 'SSA (A^2)' 16270 ?
#
loop_
_pdbx_struct_oper_list.id
_pdbx_struct_oper_list.type
_pdbx_struct_oper_list.name
_pdbx_struct_oper_list.symmetry_operation
_pdbx_struct_oper_list.matrix[1][1]
_pdbx_struct_oper_list.matrix[1][2]
_pdbx_struct_oper_list.matrix[1][3]
_pdbx_struct_oper_list.vector[1]
_pdbx_struct_oper_list.matrix[2][1]
_pdbx_struct_oper_list.matrix[2][2]
_pdbx_struct_oper_list.matrix[2][3]
_pdbx_struct_oper_list.vector[2]
_pdbx_struct_oper_list.matrix[3][1]
_pdbx_struct_oper_list.matrix[3][2]
_pdbx_struct_oper_list.matrix[3][3]
_pdbx_struct_oper_list.vector[3]
1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
2 'crystal symmetry operation' 2_654 -x+1,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 95.0410288028 0.0000000000 1.0000000000
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -35.7054093985
#
loop_
_pdbx_struct_special_symmetry.id
_pdbx_struct_special_symmetry.PDB_model_num
_pdbx_struct_special_symmetry.auth_asym_id
_pdbx_struct_special_symmetry.auth_comp_id
_pdbx_struct_special_symmetry.auth_seq_id
_pdbx_struct_special_symmetry.PDB_ins_code
_pdbx_struct_special_symmetry.label_asym_id
_pdbx_struct_special_symmetry.label_comp_id
_pdbx_struct_special_symmetry.label_seq_id
1 1 A HOH 517 ? C HOH .
2 1 A HOH 528 ? C HOH .
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2022-04-06
2 'Structure model' 1 1 2023-10-18
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Data collection'
2 2 'Structure model' 'Refinement description'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' chem_comp_atom
2 2 'Structure model' chem_comp_bond
3 2 'Structure model' pdbx_initial_refinement_model
#
_pdbx_refine_tls.id 1
_pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION'
_pdbx_refine_tls.details ?
_pdbx_refine_tls.method refined
_pdbx_refine_tls.origin_x 34.9860
_pdbx_refine_tls.origin_y 6.0780
_pdbx_refine_tls.origin_z -19.4144
_pdbx_refine_tls.T[1][1] -0.0764
_pdbx_refine_tls.T[1][1]_esd ?
_pdbx_refine_tls.T[1][2] 0.0161
_pdbx_refine_tls.T[1][2]_esd ?
_pdbx_refine_tls.T[1][3] 0.0552
_pdbx_refine_tls.T[1][3]_esd ?
_pdbx_refine_tls.T[2][2] -0.0127
_pdbx_refine_tls.T[2][2]_esd ?
_pdbx_refine_tls.T[2][3] -0.0135
_pdbx_refine_tls.T[2][3]_esd ?
_pdbx_refine_tls.T[3][3] -0.0990
_pdbx_refine_tls.T[3][3]_esd ?
_pdbx_refine_tls.L[1][1] 1.3306
_pdbx_refine_tls.L[1][1]_esd ?
_pdbx_refine_tls.L[1][2] -0.6178
_pdbx_refine_tls.L[1][2]_esd ?
_pdbx_refine_tls.L[1][3] -0.2363
_pdbx_refine_tls.L[1][3]_esd ?
_pdbx_refine_tls.L[2][2] 1.9913
_pdbx_refine_tls.L[2][2]_esd ?
_pdbx_refine_tls.L[2][3] -0.0310
_pdbx_refine_tls.L[2][3]_esd ?
_pdbx_refine_tls.L[3][3] 1.7955
_pdbx_refine_tls.L[3][3]_esd ?
_pdbx_refine_tls.S[1][1] -0.0244
_pdbx_refine_tls.S[1][1]_esd ?
_pdbx_refine_tls.S[1][2] 0.0835
_pdbx_refine_tls.S[1][2]_esd ?
_pdbx_refine_tls.S[1][3] 0.0537
_pdbx_refine_tls.S[1][3]_esd ?
_pdbx_refine_tls.S[2][1] -0.0056
_pdbx_refine_tls.S[2][1]_esd ?
_pdbx_refine_tls.S[2][2] 0.0185
_pdbx_refine_tls.S[2][2]_esd ?
_pdbx_refine_tls.S[2][3] 0.1434
_pdbx_refine_tls.S[2][3]_esd ?
_pdbx_refine_tls.S[3][1] -0.0295
_pdbx_refine_tls.S[3][1]_esd ?
_pdbx_refine_tls.S[3][2] -0.2921
_pdbx_refine_tls.S[3][2]_esd ?
_pdbx_refine_tls.S[3][3] 0.0058
_pdbx_refine_tls.S[3][3]_esd ?
#
_pdbx_refine_tls_group.id 1
_pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION'
_pdbx_refine_tls_group.refine_tls_id 1
_pdbx_refine_tls_group.beg_label_asym_id ?
_pdbx_refine_tls_group.beg_label_seq_id ?
_pdbx_refine_tls_group.beg_auth_asym_id A
_pdbx_refine_tls_group.beg_auth_seq_id 154
_pdbx_refine_tls_group.beg_PDB_ins_code ?
_pdbx_refine_tls_group.end_label_asym_id ?
_pdbx_refine_tls_group.end_label_seq_id ?
_pdbx_refine_tls_group.end_auth_asym_id A
_pdbx_refine_tls_group.end_auth_seq_id 336
_pdbx_refine_tls_group.end_PDB_ins_code ?
_pdbx_refine_tls_group.selection ?
_pdbx_refine_tls_group.selection_details '{ A|* }'
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.6 1
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.21 2
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3
? phasing ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? . 4
? 'data processing' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 6
#
_pdbx_entry_details.entry_id 7MHC
_pdbx_entry_details.has_ligand_of_interest Y
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 TYR A 167 ? ? -147.19 -69.91
2 1 ARG A 197 ? ? 86.81 145.59
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A ALA 318 ? A ALA 165
2 1 Y 1 A ASP 319 ? A ASP 166
3 1 Y 1 A ASP 320 ? A ASP 167
4 1 Y 1 A SER 321 ? A SER 168
5 1 Y 1 A GLU 337 ? A GLU 184
6 1 Y 1 A LYS 338 ? A LYS 185
7 1 Y 1 A GLU 339 ? A GLU 186
8 1 Y 1 A GLU 340 ? A GLU 187
9 1 Y 1 A VAL 341 ? A VAL 188
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
ALA N N N N 1
ALA CA C N S 2
ALA C C N N 3
ALA O O N N 4
ALA CB C N N 5
ALA OXT O N N 6
ALA H H N N 7
ALA H2 H N N 8
ALA HA H N N 9
ALA HB1 H N N 10
ALA HB2 H N N 11
ALA HB3 H N N 12
ALA HXT H N N 13
ARG N N N N 14
ARG CA C N S 15
ARG C C N N 16
ARG O O N N 17
ARG CB C N N 18
ARG CG C N N 19
ARG CD C N N 20
ARG NE N N N 21
ARG CZ C N N 22
ARG NH1 N N N 23
ARG NH2 N N N 24
ARG OXT O N N 25
ARG H H N N 26
ARG H2 H N N 27
ARG HA H N N 28
ARG HB2 H N N 29
ARG HB3 H N N 30
ARG HG2 H N N 31
ARG HG3 H N N 32
ARG HD2 H N N 33
ARG HD3 H N N 34
ARG HE H N N 35
ARG HH11 H N N 36
ARG HH12 H N N 37
ARG HH21 H N N 38
ARG HH22 H N N 39
ARG HXT H N N 40
ASN N N N N 41
ASN CA C N S 42
ASN C C N N 43
ASN O O N N 44
ASN CB C N N 45
ASN CG C N N 46
ASN OD1 O N N 47
ASN ND2 N N N 48
ASN OXT O N N 49
ASN H H N N 50
ASN H2 H N N 51
ASN HA H N N 52
ASN HB2 H N N 53
ASN HB3 H N N 54
ASN HD21 H N N 55
ASN HD22 H N N 56
ASN HXT H N N 57
ASP N N N N 58
ASP CA C N S 59
ASP C C N N 60
ASP O O N N 61
ASP CB C N N 62
ASP CG C N N 63
ASP OD1 O N N 64
ASP OD2 O N N 65
ASP OXT O N N 66
ASP H H N N 67
ASP H2 H N N 68
ASP HA H N N 69
ASP HB2 H N N 70
ASP HB3 H N N 71
ASP HD2 H N N 72
ASP HXT H N N 73
CYS N N N N 74
CYS CA C N R 75
CYS C C N N 76
CYS O O N N 77
CYS CB C N N 78
CYS SG S N N 79
CYS OXT O N N 80
CYS H H N N 81
CYS H2 H N N 82
CYS HA H N N 83
CYS HB2 H N N 84
CYS HB3 H N N 85
CYS HG H N N 86
CYS HXT H N N 87
GLN N N N N 88
GLN CA C N S 89
GLN C C N N 90
GLN O O N N 91
GLN CB C N N 92
GLN CG C N N 93
GLN CD C N N 94
GLN OE1 O N N 95
GLN NE2 N N N 96
GLN OXT O N N 97
GLN H H N N 98
GLN H2 H N N 99
GLN HA H N N 100
GLN HB2 H N N 101
GLN HB3 H N N 102
GLN HG2 H N N 103
GLN HG3 H N N 104
GLN HE21 H N N 105
GLN HE22 H N N 106
GLN HXT H N N 107
GLU N N N N 108
GLU CA C N S 109
GLU C C N N 110
GLU O O N N 111
GLU CB C N N 112
GLU CG C N N 113
GLU CD C N N 114
GLU OE1 O N N 115
GLU OE2 O N N 116
GLU OXT O N N 117
GLU H H N N 118
GLU H2 H N N 119
GLU HA H N N 120
GLU HB2 H N N 121
GLU HB3 H N N 122
GLU HG2 H N N 123
GLU HG3 H N N 124
GLU HE2 H N N 125
GLU HXT H N N 126
GLY N N N N 127
GLY CA C N N 128
GLY C C N N 129
GLY O O N N 130
GLY OXT O N N 131
GLY H H N N 132
GLY H2 H N N 133
GLY HA2 H N N 134
GLY HA3 H N N 135
GLY HXT H N N 136
HIS N N N N 137
HIS CA C N S 138
HIS C C N N 139
HIS O O N N 140
HIS CB C N N 141
HIS CG C Y N 142
HIS ND1 N Y N 143
HIS CD2 C Y N 144
HIS CE1 C Y N 145
HIS NE2 N Y N 146
HIS OXT O N N 147
HIS H H N N 148
HIS H2 H N N 149
HIS HA H N N 150
HIS HB2 H N N 151
HIS HB3 H N N 152
HIS HD1 H N N 153
HIS HD2 H N N 154
HIS HE1 H N N 155
HIS HE2 H N N 156
HIS HXT H N N 157
HOH O O N N 158
HOH H1 H N N 159
HOH H2 H N N 160
ILE N N N N 161
ILE CA C N S 162
ILE C C N N 163
ILE O O N N 164
ILE CB C N S 165
ILE CG1 C N N 166
ILE CG2 C N N 167
ILE CD1 C N N 168
ILE OXT O N N 169
ILE H H N N 170
ILE H2 H N N 171
ILE HA H N N 172
ILE HB H N N 173
ILE HG12 H N N 174
ILE HG13 H N N 175
ILE HG21 H N N 176
ILE HG22 H N N 177
ILE HG23 H N N 178
ILE HD11 H N N 179
ILE HD12 H N N 180
ILE HD13 H N N 181
ILE HXT H N N 182
LEU N N N N 183
LEU CA C N S 184
LEU C C N N 185
LEU O O N N 186
LEU CB C N N 187
LEU CG C N N 188
LEU CD1 C N N 189
LEU CD2 C N N 190
LEU OXT O N N 191
LEU H H N N 192
LEU H2 H N N 193
LEU HA H N N 194
LEU HB2 H N N 195
LEU HB3 H N N 196
LEU HG H N N 197
LEU HD11 H N N 198
LEU HD12 H N N 199
LEU HD13 H N N 200
LEU HD21 H N N 201
LEU HD22 H N N 202
LEU HD23 H N N 203
LEU HXT H N N 204
LYS N N N N 205
LYS CA C N S 206
LYS C C N N 207
LYS O O N N 208
LYS CB C N N 209
LYS CG C N N 210
LYS CD C N N 211
LYS CE C N N 212
LYS NZ N N N 213
LYS OXT O N N 214
LYS H H N N 215
LYS H2 H N N 216
LYS HA H N N 217
LYS HB2 H N N 218
LYS HB3 H N N 219
LYS HG2 H N N 220
LYS HG3 H N N 221
LYS HD2 H N N 222
LYS HD3 H N N 223
LYS HE2 H N N 224
LYS HE3 H N N 225
LYS HZ1 H N N 226
LYS HZ2 H N N 227
LYS HZ3 H N N 228
LYS HXT H N N 229
MET N N N N 230
MET CA C N S 231
MET C C N N 232
MET O O N N 233
MET CB C N N 234
MET CG C N N 235
MET SD S N N 236
MET CE C N N 237
MET OXT O N N 238
MET H H N N 239
MET H2 H N N 240
MET HA H N N 241
MET HB2 H N N 242
MET HB3 H N N 243
MET HG2 H N N 244
MET HG3 H N N 245
MET HE1 H N N 246
MET HE2 H N N 247
MET HE3 H N N 248
MET HXT H N N 249
PHE N N N N 250
PHE CA C N S 251
PHE C C N N 252
PHE O O N N 253
PHE CB C N N 254
PHE CG C Y N 255
PHE CD1 C Y N 256
PHE CD2 C Y N 257
PHE CE1 C Y N 258
PHE CE2 C Y N 259
PHE CZ C Y N 260
PHE OXT O N N 261
PHE H H N N 262
PHE H2 H N N 263
PHE HA H N N 264
PHE HB2 H N N 265
PHE HB3 H N N 266
PHE HD1 H N N 267
PHE HD2 H N N 268
PHE HE1 H N N 269
PHE HE2 H N N 270
PHE HZ H N N 271
PHE HXT H N N 272
PRO N N N N 273
PRO CA C N S 274
PRO C C N N 275
PRO O O N N 276
PRO CB C N N 277
PRO CG C N N 278
PRO CD C N N 279
PRO OXT O N N 280
PRO H H N N 281
PRO HA H N N 282
PRO HB2 H N N 283
PRO HB3 H N N 284
PRO HG2 H N N 285
PRO HG3 H N N 286
PRO HD2 H N N 287
PRO HD3 H N N 288
PRO HXT H N N 289
SER N N N N 290
SER CA C N S 291
SER C C N N 292
SER O O N N 293
SER CB C N N 294
SER OG O N N 295
SER OXT O N N 296
SER H H N N 297
SER H2 H N N 298
SER HA H N N 299
SER HB2 H N N 300
SER HB3 H N N 301
SER HG H N N 302
SER HXT H N N 303
THR N N N N 304
THR CA C N S 305
THR C C N N 306
THR O O N N 307
THR CB C N R 308
THR OG1 O N N 309
THR CG2 C N N 310
THR OXT O N N 311
THR H H N N 312
THR H2 H N N 313
THR HA H N N 314
THR HB H N N 315
THR HG1 H N N 316
THR HG21 H N N 317
THR HG22 H N N 318
THR HG23 H N N 319
THR HXT H N N 320
TRP N N N N 321
TRP CA C N S 322
TRP C C N N 323
TRP O O N N 324
TRP CB C N N 325
TRP CG C Y N 326
TRP CD1 C Y N 327
TRP CD2 C Y N 328
TRP NE1 N Y N 329
TRP CE2 C Y N 330
TRP CE3 C Y N 331
TRP CZ2 C Y N 332
TRP CZ3 C Y N 333
TRP CH2 C Y N 334
TRP OXT O N N 335
TRP H H N N 336
TRP H2 H N N 337
TRP HA H N N 338
TRP HB2 H N N 339
TRP HB3 H N N 340
TRP HD1 H N N 341
TRP HE1 H N N 342
TRP HE3 H N N 343
TRP HZ2 H N N 344
TRP HZ3 H N N 345
TRP HH2 H N N 346
TRP HXT H N N 347
TYR N N N N 348
TYR CA C N S 349
TYR C C N N 350
TYR O O N N 351
TYR CB C N N 352
TYR CG C Y N 353
TYR CD1 C Y N 354
TYR CD2 C Y N 355
TYR CE1 C Y N 356
TYR CE2 C Y N 357
TYR CZ C Y N 358
TYR OH O N N 359
TYR OXT O N N 360
TYR H H N N 361
TYR H2 H N N 362
TYR HA H N N 363
TYR HB2 H N N 364
TYR HB3 H N N 365
TYR HD1 H N N 366
TYR HD2 H N N 367
TYR HE1 H N N 368
TYR HE2 H N N 369
TYR HH H N N 370
TYR HXT H N N 371
VAL N N N N 372
VAL CA C N S 373
VAL C C N N 374
VAL O O N N 375
VAL CB C N N 376
VAL CG1 C N N 377
VAL CG2 C N N 378
VAL OXT O N N 379
VAL H H N N 380
VAL H2 H N N 381
VAL HA H N N 382
VAL HB H N N 383
VAL HG11 H N N 384
VAL HG12 H N N 385
VAL HG13 H N N 386
VAL HG21 H N N 387
VAL HG22 H N N 388
VAL HG23 H N N 389
VAL HXT H N N 390
ZEV N1 N Y N 391
ZEV N3 N Y N 392
ZEV C4 C Y N 393
ZEV C5 C Y N 394
ZEV C6 C Y N 395
ZEV C7 C Y N 396
ZEV C8 C Y N 397
ZEV C10 C N N 398
ZEV C13 C N R 399
ZEV C15 C Y N 400
ZEV C17 C Y N 401
ZEV O8 O N N 402
ZEV P P N R 403
ZEV O O N N 404
ZEV S S N N 405
ZEV O1 O N N 406
ZEV C1 C N R 407
ZEV C9 C N R 408
ZEV O2 O N N 409
ZEV C3 C N R 410
ZEV N N Y N 411
ZEV N2 N Y N 412
ZEV N4 N N N 413
ZEV C2 C N S 414
ZEV F1 F N N 415
ZEV O3 O N N 416
ZEV P1 P N R 417
ZEV S1 S N N 418
ZEV O7 O N N 419
ZEV O4 O N N 420
ZEV C11 C N S 421
ZEV C14 C N R 422
ZEV O5 O N N 423
ZEV C12 C N R 424
ZEV F F N N 425
ZEV C C N N 426
ZEV N5 N Y N 427
ZEV N6 N Y N 428
ZEV C16 C Y N 429
ZEV C18 C N N 430
ZEV O6 O N N 431
ZEV N7 N N N 432
ZEV C19 C N N 433
ZEV N9 N N N 434
ZEV N8 N N N 435
ZEV H11 H N N 436
ZEV H12 H N N 437
ZEV H15 H N N 438
ZEV H16 H N N 439
ZEV H6 H N N 440
ZEV H17 H N N 441
ZEV H H N N 442
ZEV H3 H N N 443
ZEV H2 H N N 444
ZEV H13 H N N 445
ZEV H14 H N N 446
ZEV H1 H N N 447
ZEV H4 H N N 448
ZEV H7 H N N 449
ZEV H5 H N N 450
ZEV H9 H N N 451
ZEV H10 H N N 452
ZEV H8 H N N 453
ZEV H19 H N N 454
ZEV H18 H N N 455
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
ALA N CA sing N N 1
ALA N H sing N N 2
ALA N H2 sing N N 3
ALA CA C sing N N 4
ALA CA CB sing N N 5
ALA CA HA sing N N 6
ALA C O doub N N 7
ALA C OXT sing N N 8
ALA CB HB1 sing N N 9
ALA CB HB2 sing N N 10
ALA CB HB3 sing N N 11
ALA OXT HXT sing N N 12
ARG N CA sing N N 13
ARG N H sing N N 14
ARG N H2 sing N N 15
ARG CA C sing N N 16
ARG CA CB sing N N 17
ARG CA HA sing N N 18
ARG C O doub N N 19
ARG C OXT sing N N 20
ARG CB CG sing N N 21
ARG CB HB2 sing N N 22
ARG CB HB3 sing N N 23
ARG CG CD sing N N 24
ARG CG HG2 sing N N 25
ARG CG HG3 sing N N 26
ARG CD NE sing N N 27
ARG CD HD2 sing N N 28
ARG CD HD3 sing N N 29
ARG NE CZ sing N N 30
ARG NE HE sing N N 31
ARG CZ NH1 sing N N 32
ARG CZ NH2 doub N N 33
ARG NH1 HH11 sing N N 34
ARG NH1 HH12 sing N N 35
ARG NH2 HH21 sing N N 36
ARG NH2 HH22 sing N N 37
ARG OXT HXT sing N N 38
ASN N CA sing N N 39
ASN N H sing N N 40
ASN N H2 sing N N 41
ASN CA C sing N N 42
ASN CA CB sing N N 43
ASN CA HA sing N N 44
ASN C O doub N N 45
ASN C OXT sing N N 46
ASN CB CG sing N N 47
ASN CB HB2 sing N N 48
ASN CB HB3 sing N N 49
ASN CG OD1 doub N N 50
ASN CG ND2 sing N N 51
ASN ND2 HD21 sing N N 52
ASN ND2 HD22 sing N N 53
ASN OXT HXT sing N N 54
ASP N CA sing N N 55
ASP N H sing N N 56
ASP N H2 sing N N 57
ASP CA C sing N N 58
ASP CA CB sing N N 59
ASP CA HA sing N N 60
ASP C O doub N N 61
ASP C OXT sing N N 62
ASP CB CG sing N N 63
ASP CB HB2 sing N N 64
ASP CB HB3 sing N N 65
ASP CG OD1 doub N N 66
ASP CG OD2 sing N N 67
ASP OD2 HD2 sing N N 68
ASP OXT HXT sing N N 69
CYS N CA sing N N 70
CYS N H sing N N 71
CYS N H2 sing N N 72
CYS CA C sing N N 73
CYS CA CB sing N N 74
CYS CA HA sing N N 75
CYS C O doub N N 76
CYS C OXT sing N N 77
CYS CB SG sing N N 78
CYS CB HB2 sing N N 79
CYS CB HB3 sing N N 80
CYS SG HG sing N N 81
CYS OXT HXT sing N N 82
GLN N CA sing N N 83
GLN N H sing N N 84
GLN N H2 sing N N 85
GLN CA C sing N N 86
GLN CA CB sing N N 87
GLN CA HA sing N N 88
GLN C O doub N N 89
GLN C OXT sing N N 90
GLN CB CG sing N N 91
GLN CB HB2 sing N N 92
GLN CB HB3 sing N N 93
GLN CG CD sing N N 94
GLN CG HG2 sing N N 95
GLN CG HG3 sing N N 96
GLN CD OE1 doub N N 97
GLN CD NE2 sing N N 98
GLN NE2 HE21 sing N N 99
GLN NE2 HE22 sing N N 100
GLN OXT HXT sing N N 101
GLU N CA sing N N 102
GLU N H sing N N 103
GLU N H2 sing N N 104
GLU CA C sing N N 105
GLU CA CB sing N N 106
GLU CA HA sing N N 107
GLU C O doub N N 108
GLU C OXT sing N N 109
GLU CB CG sing N N 110
GLU CB HB2 sing N N 111
GLU CB HB3 sing N N 112
GLU CG CD sing N N 113
GLU CG HG2 sing N N 114
GLU CG HG3 sing N N 115
GLU CD OE1 doub N N 116
GLU CD OE2 sing N N 117
GLU OE2 HE2 sing N N 118
GLU OXT HXT sing N N 119
GLY N CA sing N N 120
GLY N H sing N N 121
GLY N H2 sing N N 122
GLY CA C sing N N 123
GLY CA HA2 sing N N 124
GLY CA HA3 sing N N 125
GLY C O doub N N 126
GLY C OXT sing N N 127
GLY OXT HXT sing N N 128
HIS N CA sing N N 129
HIS N H sing N N 130
HIS N H2 sing N N 131
HIS CA C sing N N 132
HIS CA CB sing N N 133
HIS CA HA sing N N 134
HIS C O doub N N 135
HIS C OXT sing N N 136
HIS CB CG sing N N 137
HIS CB HB2 sing N N 138
HIS CB HB3 sing N N 139
HIS CG ND1 sing Y N 140
HIS CG CD2 doub Y N 141
HIS ND1 CE1 doub Y N 142
HIS ND1 HD1 sing N N 143
HIS CD2 NE2 sing Y N 144
HIS CD2 HD2 sing N N 145
HIS CE1 NE2 sing Y N 146
HIS CE1 HE1 sing N N 147
HIS NE2 HE2 sing N N 148
HIS OXT HXT sing N N 149
HOH O H1 sing N N 150
HOH O H2 sing N N 151
ILE N CA sing N N 152
ILE N H sing N N 153
ILE N H2 sing N N 154
ILE CA C sing N N 155
ILE CA CB sing N N 156
ILE CA HA sing N N 157
ILE C O doub N N 158
ILE C OXT sing N N 159
ILE CB CG1 sing N N 160
ILE CB CG2 sing N N 161
ILE CB HB sing N N 162
ILE CG1 CD1 sing N N 163
ILE CG1 HG12 sing N N 164
ILE CG1 HG13 sing N N 165
ILE CG2 HG21 sing N N 166
ILE CG2 HG22 sing N N 167
ILE CG2 HG23 sing N N 168
ILE CD1 HD11 sing N N 169
ILE CD1 HD12 sing N N 170
ILE CD1 HD13 sing N N 171
ILE OXT HXT sing N N 172
LEU N CA sing N N 173
LEU N H sing N N 174
LEU N H2 sing N N 175
LEU CA C sing N N 176
LEU CA CB sing N N 177
LEU CA HA sing N N 178
LEU C O doub N N 179
LEU C OXT sing N N 180
LEU CB CG sing N N 181
LEU CB HB2 sing N N 182
LEU CB HB3 sing N N 183
LEU CG CD1 sing N N 184
LEU CG CD2 sing N N 185
LEU CG HG sing N N 186
LEU CD1 HD11 sing N N 187
LEU CD1 HD12 sing N N 188
LEU CD1 HD13 sing N N 189
LEU CD2 HD21 sing N N 190
LEU CD2 HD22 sing N N 191
LEU CD2 HD23 sing N N 192
LEU OXT HXT sing N N 193
LYS N CA sing N N 194
LYS N H sing N N 195
LYS N H2 sing N N 196
LYS CA C sing N N 197
LYS CA CB sing N N 198
LYS CA HA sing N N 199
LYS C O doub N N 200
LYS C OXT sing N N 201
LYS CB CG sing N N 202
LYS CB HB2 sing N N 203
LYS CB HB3 sing N N 204
LYS CG CD sing N N 205
LYS CG HG2 sing N N 206
LYS CG HG3 sing N N 207
LYS CD CE sing N N 208
LYS CD HD2 sing N N 209
LYS CD HD3 sing N N 210
LYS CE NZ sing N N 211
LYS CE HE2 sing N N 212
LYS CE HE3 sing N N 213
LYS NZ HZ1 sing N N 214
LYS NZ HZ2 sing N N 215
LYS NZ HZ3 sing N N 216
LYS OXT HXT sing N N 217
MET N CA sing N N 218
MET N H sing N N 219
MET N H2 sing N N 220
MET CA C sing N N 221
MET CA CB sing N N 222
MET CA HA sing N N 223
MET C O doub N N 224
MET C OXT sing N N 225
MET CB CG sing N N 226
MET CB HB2 sing N N 227
MET CB HB3 sing N N 228
MET CG SD sing N N 229
MET CG HG2 sing N N 230
MET CG HG3 sing N N 231
MET SD CE sing N N 232
MET CE HE1 sing N N 233
MET CE HE2 sing N N 234
MET CE HE3 sing N N 235
MET OXT HXT sing N N 236
PHE N CA sing N N 237
PHE N H sing N N 238
PHE N H2 sing N N 239
PHE CA C sing N N 240
PHE CA CB sing N N 241
PHE CA HA sing N N 242
PHE C O doub N N 243
PHE C OXT sing N N 244
PHE CB CG sing N N 245
PHE CB HB2 sing N N 246
PHE CB HB3 sing N N 247
PHE CG CD1 doub Y N 248
PHE CG CD2 sing Y N 249
PHE CD1 CE1 sing Y N 250
PHE CD1 HD1 sing N N 251
PHE CD2 CE2 doub Y N 252
PHE CD2 HD2 sing N N 253
PHE CE1 CZ doub Y N 254
PHE CE1 HE1 sing N N 255
PHE CE2 CZ sing Y N 256
PHE CE2 HE2 sing N N 257
PHE CZ HZ sing N N 258
PHE OXT HXT sing N N 259
PRO N CA sing N N 260
PRO N CD sing N N 261
PRO N H sing N N 262
PRO CA C sing N N 263
PRO CA CB sing N N 264
PRO CA HA sing N N 265
PRO C O doub N N 266
PRO C OXT sing N N 267
PRO CB CG sing N N 268
PRO CB HB2 sing N N 269
PRO CB HB3 sing N N 270
PRO CG CD sing N N 271
PRO CG HG2 sing N N 272
PRO CG HG3 sing N N 273
PRO CD HD2 sing N N 274
PRO CD HD3 sing N N 275
PRO OXT HXT sing N N 276
SER N CA sing N N 277
SER N H sing N N 278
SER N H2 sing N N 279
SER CA C sing N N 280
SER CA CB sing N N 281
SER CA HA sing N N 282
SER C O doub N N 283
SER C OXT sing N N 284
SER CB OG sing N N 285
SER CB HB2 sing N N 286
SER CB HB3 sing N N 287
SER OG HG sing N N 288
SER OXT HXT sing N N 289
THR N CA sing N N 290
THR N H sing N N 291
THR N H2 sing N N 292
THR CA C sing N N 293
THR CA CB sing N N 294
THR CA HA sing N N 295
THR C O doub N N 296
THR C OXT sing N N 297
THR CB OG1 sing N N 298
THR CB CG2 sing N N 299
THR CB HB sing N N 300
THR OG1 HG1 sing N N 301
THR CG2 HG21 sing N N 302
THR CG2 HG22 sing N N 303
THR CG2 HG23 sing N N 304
THR OXT HXT sing N N 305
TRP N CA sing N N 306
TRP N H sing N N 307
TRP N H2 sing N N 308
TRP CA C sing N N 309
TRP CA CB sing N N 310
TRP CA HA sing N N 311
TRP C O doub N N 312
TRP C OXT sing N N 313
TRP CB CG sing N N 314
TRP CB HB2 sing N N 315
TRP CB HB3 sing N N 316
TRP CG CD1 doub Y N 317
TRP CG CD2 sing Y N 318
TRP CD1 NE1 sing Y N 319
TRP CD1 HD1 sing N N 320
TRP CD2 CE2 doub Y N 321
TRP CD2 CE3 sing Y N 322
TRP NE1 CE2 sing Y N 323
TRP NE1 HE1 sing N N 324
TRP CE2 CZ2 sing Y N 325
TRP CE3 CZ3 doub Y N 326
TRP CE3 HE3 sing N N 327
TRP CZ2 CH2 doub Y N 328
TRP CZ2 HZ2 sing N N 329
TRP CZ3 CH2 sing Y N 330
TRP CZ3 HZ3 sing N N 331
TRP CH2 HH2 sing N N 332
TRP OXT HXT sing N N 333
TYR N CA sing N N 334
TYR N H sing N N 335
TYR N H2 sing N N 336
TYR CA C sing N N 337
TYR CA CB sing N N 338
TYR CA HA sing N N 339
TYR C O doub N N 340
TYR C OXT sing N N 341
TYR CB CG sing N N 342
TYR CB HB2 sing N N 343
TYR CB HB3 sing N N 344
TYR CG CD1 doub Y N 345
TYR CG CD2 sing Y N 346
TYR CD1 CE1 sing Y N 347
TYR CD1 HD1 sing N N 348
TYR CD2 CE2 doub Y N 349
TYR CD2 HD2 sing N N 350
TYR CE1 CZ doub Y N 351
TYR CE1 HE1 sing N N 352
TYR CE2 CZ sing Y N 353
TYR CE2 HE2 sing N N 354
TYR CZ OH sing N N 355
TYR OH HH sing N N 356
TYR OXT HXT sing N N 357
VAL N CA sing N N 358
VAL N H sing N N 359
VAL N H2 sing N N 360
VAL CA C sing N N 361
VAL CA CB sing N N 362
VAL CA HA sing N N 363
VAL C O doub N N 364
VAL C OXT sing N N 365
VAL CB CG1 sing N N 366
VAL CB CG2 sing N N 367
VAL CB HB sing N N 368
VAL CG1 HG11 sing N N 369
VAL CG1 HG12 sing N N 370
VAL CG1 HG13 sing N N 371
VAL CG2 HG21 sing N N 372
VAL CG2 HG22 sing N N 373
VAL CG2 HG23 sing N N 374
VAL OXT HXT sing N N 375
ZEV S1 P1 doub N N 376
ZEV O7 P1 sing N N 377
ZEV P1 O3 sing N N 378
ZEV P1 O4 sing N N 379
ZEV O3 C10 sing N N 380
ZEV C10 C9 sing N N 381
ZEV O2 C9 sing N N 382
ZEV O2 C3 sing N N 383
ZEV O4 C11 sing N N 384
ZEV C6 N1 doub Y N 385
ZEV C6 N sing Y N 386
ZEV N1 C5 sing Y N 387
ZEV N9 C19 sing N N 388
ZEV C9 C1 sing N N 389
ZEV N C3 sing N N 390
ZEV N C4 sing Y N 391
ZEV C3 C2 sing N N 392
ZEV C5 C4 doub Y N 393
ZEV C5 C7 sing Y N 394
ZEV C19 N8 doub N N 395
ZEV C19 N7 sing N N 396
ZEV N4 C7 sing N N 397
ZEV N8 C15 sing N N 398
ZEV C4 N3 sing Y N 399
ZEV F C12 sing N N 400
ZEV N7 C18 sing N N 401
ZEV C7 N2 doub Y N 402
ZEV C11 C12 sing N N 403
ZEV C11 C14 sing N N 404
ZEV C1 C2 sing N N 405
ZEV C1 O1 sing N N 406
ZEV C15 C16 doub Y N 407
ZEV C15 N5 sing Y N 408
ZEV N3 C8 doub Y N 409
ZEV C12 C13 sing N N 410
ZEV C18 O6 doub N N 411
ZEV C18 C16 sing N N 412
ZEV N2 C8 sing Y N 413
ZEV C14 N5 sing N N 414
ZEV C14 O5 sing N N 415
ZEV C2 F1 sing N N 416
ZEV C16 N6 sing Y N 417
ZEV N5 C17 sing Y N 418
ZEV O1 P sing N N 419
ZEV C17 N6 doub Y N 420
ZEV O5 C13 sing N N 421
ZEV C13 C sing N N 422
ZEV O P sing N N 423
ZEV O C sing N N 424
ZEV O8 P sing N N 425
ZEV P S doub N N 426
ZEV C6 H11 sing N N 427
ZEV C8 H12 sing N N 428
ZEV C10 H15 sing N N 429
ZEV C10 H16 sing N N 430
ZEV C13 H6 sing N N 431
ZEV C17 H17 sing N N 432
ZEV C1 H sing N N 433
ZEV C9 H3 sing N N 434
ZEV C3 H2 sing N N 435
ZEV N4 H13 sing N N 436
ZEV N4 H14 sing N N 437
ZEV C2 H1 sing N N 438
ZEV C11 H4 sing N N 439
ZEV C14 H7 sing N N 440
ZEV C12 H5 sing N N 441
ZEV C H9 sing N N 442
ZEV C H10 sing N N 443
ZEV N7 H8 sing N N 444
ZEV N9 H19 sing N N 445
ZEV N9 H18 sing N N 446
#
_pdbx_entity_instance_feature.ordinal 1
_pdbx_entity_instance_feature.comp_id ZEV
_pdbx_entity_instance_feature.asym_id ?
_pdbx_entity_instance_feature.seq_num ?
_pdbx_entity_instance_feature.auth_comp_id ZEV
_pdbx_entity_instance_feature.auth_asym_id ?
_pdbx_entity_instance_feature.auth_seq_num ?
_pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION'
_pdbx_entity_instance_feature.details ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2
;(2R,5R,7R,8S,10R,12aR,14R,15S,15aR,16R)-7-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-15,16-difluoro-2,10-bis(sulfanyl)octahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione
;
ZEV
3 water HOH
#
_pdbx_initial_refinement_model.id 1
_pdbx_initial_refinement_model.entity_id_list ?
_pdbx_initial_refinement_model.type 'experimental model'
_pdbx_initial_refinement_model.source_name PDB
_pdbx_initial_refinement_model.accession_code 4KSY
_pdbx_initial_refinement_model.details ?
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support none
_pdbx_struct_assembly_auth_evidence.details ?
#