data_7MPH # _entry.id 7MPH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7MPH pdb_00007mph 10.2210/pdb7mph/pdb WWPDB D_1000256629 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7MPH _pdbx_database_status.recvd_initial_deposition_date 2021-05-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sun, L.' 1 ? 'Schonbrunn, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 51 _citation.language ? _citation.page_first 128354 _citation.page_last 128354 _citation.title 'Synthesis and structural characterization of a monocarboxylic inhibitor for GRB2 SH2 domain.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2021.128354 _citation.pdbx_database_id_PubMed 34506932 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xiao, T.' 1 ? primary 'Sun, L.' 2 ? primary 'Zhang, M.' 3 ? primary 'Li, Z.' 4 ? primary 'Haura, E.B.' 5 ? primary 'Schonbrunn, E.' 6 ? primary 'Ji, H.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7MPH _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.885 _cell.length_a_esd ? _cell.length_b 87.102 _cell.length_b_esd ? _cell.length_c 136.413 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7MPH _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth factor receptor-bound protein 2' 11008.441 6 ? ? ? ? 2 non-polymer syn ;(4-{(10R,11E,14S,18S)-18-(2-amino-2-oxoethyl)-14-[(naphthalen-1-yl)methyl]-8,17,20-trioxo-7,16,19-triazaspiro[5.14]icos-11-en-10-yl}phenyl)acetic acid ; 652.779 6 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 13 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 11 ? ? ? ? 5 water nat water 18.015 111 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adapter protein GRB2,Protein Ash,SH2/SH3 adapter GRB2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRS TSVSRNQQIFLRDIE ; _entity_poly.pdbx_seq_one_letter_code_can ;GPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRS TSVSRNQQIFLRDIE ; _entity_poly.pdbx_strand_id A,B,C,D,E,F _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 TRP n 1 4 PHE n 1 5 PHE n 1 6 GLY n 1 7 LYS n 1 8 ILE n 1 9 PRO n 1 10 ARG n 1 11 ALA n 1 12 LYS n 1 13 ALA n 1 14 GLU n 1 15 GLU n 1 16 MET n 1 17 LEU n 1 18 SER n 1 19 LYS n 1 20 GLN n 1 21 ARG n 1 22 HIS n 1 23 ASP n 1 24 GLY n 1 25 ALA n 1 26 PHE n 1 27 LEU n 1 28 ILE n 1 29 ARG n 1 30 GLU n 1 31 SER n 1 32 GLU n 1 33 SER n 1 34 ALA n 1 35 PRO n 1 36 GLY n 1 37 ASP n 1 38 PHE n 1 39 SER n 1 40 LEU n 1 41 SER n 1 42 VAL n 1 43 LYS n 1 44 PHE n 1 45 GLY n 1 46 ASN n 1 47 ASP n 1 48 VAL n 1 49 GLN n 1 50 HIS n 1 51 PHE n 1 52 LYS n 1 53 VAL n 1 54 LEU n 1 55 ARG n 1 56 ASP n 1 57 GLY n 1 58 ALA n 1 59 GLY n 1 60 LYS n 1 61 TYR n 1 62 PHE n 1 63 LEU n 1 64 TRP n 1 65 VAL n 1 66 VAL n 1 67 LYS n 1 68 PHE n 1 69 ASN n 1 70 SER n 1 71 LEU n 1 72 ASN n 1 73 GLU n 1 74 LEU n 1 75 VAL n 1 76 ASP n 1 77 TYR n 1 78 HIS n 1 79 ARG n 1 80 SER n 1 81 THR n 1 82 SER n 1 83 VAL n 1 84 SER n 1 85 ARG n 1 86 ASN n 1 87 GLN n 1 88 GLN n 1 89 ILE n 1 90 PHE n 1 91 LEU n 1 92 ARG n 1 93 ASP n 1 94 ILE n 1 95 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 95 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GRB2, ASH' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GRB2_HUMAN _struct_ref.pdbx_db_accession P62993 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRST SVSRNQQIFLRDIE ; _struct_ref.pdbx_align_begin 59 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7MPH A 2 ? 95 ? P62993 59 ? 152 ? 59 152 2 1 7MPH B 2 ? 95 ? P62993 59 ? 152 ? 59 152 3 1 7MPH C 2 ? 95 ? P62993 59 ? 152 ? 59 152 4 1 7MPH D 2 ? 95 ? P62993 59 ? 152 ? 59 152 5 1 7MPH E 2 ? 95 ? P62993 59 ? 152 ? 59 152 6 1 7MPH F 2 ? 95 ? P62993 59 ? 152 ? 59 152 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7MPH GLY A 1 ? UNP P62993 ? ? 'expression tag' 58 1 2 7MPH GLY B 1 ? UNP P62993 ? ? 'expression tag' 58 2 3 7MPH GLY C 1 ? UNP P62993 ? ? 'expression tag' 58 3 4 7MPH GLY D 1 ? UNP P62993 ? ? 'expression tag' 58 4 5 7MPH GLY E 1 ? UNP P62993 ? ? 'expression tag' 58 5 6 7MPH GLY F 1 ? UNP P62993 ? ? 'expression tag' 58 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZLY non-polymer . ;(4-{(10R,11E,14S,18S)-18-(2-amino-2-oxoethyl)-14-[(naphthalen-1-yl)methyl]-8,17,20-trioxo-7,16,19-triazaspiro[5.14]icos-11-en-10-yl}phenyl)acetic acid ; ? 'C38 H44 N4 O6' 652.779 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7MPH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '12.4mg/mL GRB2 SH2 domain, 0.1mM Bis-Tris pH 5.5, 2M Ammonium Sulphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 291 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-08-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7MPH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 47.320 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 50672 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.600 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 101 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.103 _reflns.pdbx_Rpim_I_all 0.040 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 336368 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.000 2.050 ? ? 24984 ? ? ? 3702 100.000 ? ? ? ? 3.289 ? ? ? ? ? ? ? ? 6.700 ? ? ? 0.600 3.565 1.366 ? 1 1 0.445 ? ? ? ? ? ? ? ? ? ? 8.940 47.320 ? ? 3888 ? ? ? 659 99.500 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 5.900 ? ? ? 40.700 0.035 0.014 ? 2 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 153.380 _refine.B_iso_mean 66.3428 _refine.B_iso_min 37.390 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7MPH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0000 _refine.ls_d_res_low 45.8300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 50497 _refine.ls_number_reflns_R_free 1996 _refine.ls_number_reflns_R_work 48501 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7900 _refine.ls_percent_reflns_R_free 3.9500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2331 _refine.ls_R_factor_R_free 0.2773 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2313 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1CJ1 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.2400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0000 _refine_hist.d_res_low 45.8300 _refine_hist.number_atoms_solvent 111 _refine_hist.number_atoms_total 4976 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 563 _refine_hist.pdbx_B_iso_mean_ligand 60.52 _refine_hist.pdbx_B_iso_mean_solvent 55.15 _refine_hist.pdbx_number_atoms_protein 4471 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 394 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2359 15.480 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2359 15.480 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 2359 15.480 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 2359 15.480 ? 1 'X-RAY DIFFRACTION' 5 ? ? ? ? ? 5 TORSIONAL ? E 2359 15.480 ? 1 'X-RAY DIFFRACTION' 6 ? ? ? ? ? 6 TORSIONAL ? F 2359 15.480 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0000 2.0500 3545 . 140 3405 99.0000 . . . 0.4730 0.0000 0.4445 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.0500 2.1100 3532 . 139 3393 100.0000 . . . 0.4222 0.0000 0.4076 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.1100 2.1700 3566 . 140 3426 100.0000 . . . 0.3916 0.0000 0.3697 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.1700 2.2400 3552 . 142 3410 100.0000 . . . 0.4245 0.0000 0.3334 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.2400 2.3200 3551 . 140 3411 100.0000 . . . 0.3228 0.0000 0.3032 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.3200 2.4100 3569 . 141 3428 100.0000 . . . 0.3730 0.0000 0.2930 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.4100 2.5200 3583 . 143 3440 100.0000 . . . 0.3153 0.0000 0.2879 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.5200 2.6500 3573 . 141 3432 100.0000 . . . 0.3460 0.0000 0.2755 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.6500 2.8200 3617 . 143 3474 100.0000 . . . 0.3102 0.0000 0.2791 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.8200 3.0400 3592 . 142 3450 100.0000 . . . 0.3228 0.0000 0.2649 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.0400 3.3400 3631 . 142 3489 100.0000 . . . 0.2831 0.0000 0.2416 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.3400 3.8300 3652 . 145 3507 100.0000 . . . 0.2648 0.0000 0.2087 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.8300 4.8200 3687 . 146 3541 100.0000 . . . 0.2195 0.0000 0.1709 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 4.8200 45.8300 3847 . 152 3695 100.0000 . . . 0.2351 0.0000 0.1993 . . . . . . . 14 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 59 through 70 or (resid 71 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 2 ;(chain B and (resid 59 through 68 or (resid 69 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 3 ;(chain C and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 4 ;(chain D and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 77 or (resid 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 5 ;(chain E and (resid 59 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 6 ;(chain F and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A PRO 2 . A ALA 13 . A PRO 59 A ALA 70 ? ;(chain A and (resid 59 through 70 or (resid 71 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 1 2 A GLU 14 . A GLU 15 . A GLU 71 A GLU 72 ? ;(chain A and (resid 59 through 70 or (resid 71 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 1 3 A GLY 1 . A PHE 90 . A GLY 58 A PHE 147 ? ;(chain A and (resid 59 through 70 or (resid 71 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 1 4 A GLY 1 . A PHE 90 . A GLY 58 A PHE 147 ? ;(chain A and (resid 59 through 70 or (resid 71 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 1 5 A GLY 1 . A PHE 90 . A GLY 58 A PHE 147 ? ;(chain A and (resid 59 through 70 or (resid 71 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 1 6 A GLY 1 . A PHE 90 . A GLY 58 A PHE 147 ? ;(chain A and (resid 59 through 70 or (resid 71 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 2 1 B PRO 2 . B ALA 11 . B PRO 59 B ALA 68 ? ;(chain B and (resid 59 through 68 or (resid 69 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 2 2 B LYS 12 . B GLU 15 . B LYS 69 B GLU 72 ? ;(chain B and (resid 59 through 68 or (resid 69 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 2 3 B GLY 1 . B ILE 94 . B GLY 58 B ILE 151 ? ;(chain B and (resid 59 through 68 or (resid 69 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 2 4 B GLY 1 . B ILE 94 . B GLY 58 B ILE 151 ? ;(chain B and (resid 59 through 68 or (resid 69 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 2 5 B GLY 1 . B ILE 94 . B GLY 58 B ILE 151 ? ;(chain B and (resid 59 through 68 or (resid 69 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 2 6 B GLY 1 . B ILE 94 . B GLY 58 B ILE 151 ? ;(chain B and (resid 59 through 68 or (resid 69 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 3 1 C PRO 2 . C PRO 9 . C PRO 59 C PRO 66 ? ;(chain C and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 3 2 C ARG 10 . C GLU 15 . C ARG 67 C GLU 72 ? ;(chain C and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 3 3 C GLY 1 . C GLU 95 . C GLY 58 C GLU 152 ? ;(chain C and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 3 4 C GLY 1 . C GLU 95 . C GLY 58 C GLU 152 ? ;(chain C and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 3 5 C GLY 1 . C GLU 95 . C GLY 58 C GLU 152 ? ;(chain C and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 3 6 C GLY 1 . C GLU 95 . C GLY 58 C GLU 152 ? ;(chain C and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 4 1 D PRO 2 . D PRO 9 . D PRO 59 D PRO 66 ? ;(chain D and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 77 or (resid 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 4 2 D ARG 10 . D GLU 15 . D ARG 67 D GLU 72 ? ;(chain D and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 77 or (resid 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 4 3 D GLY 1 . D GLU 95 . D GLY 58 D GLU 152 ? ;(chain D and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 77 or (resid 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 4 4 D GLY 1 . D GLU 95 . D GLY 58 D GLU 152 ? ;(chain D and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 77 or (resid 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 4 5 D GLY 1 . D GLU 95 . D GLY 58 D GLU 152 ? ;(chain D and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 77 or (resid 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 4 6 D GLY 1 . D GLU 95 . D GLY 58 D GLU 152 ? ;(chain D and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 77 or (resid 78 and (name N or name CA or name C or name O or name CB )) or resid 79 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 5 1 E PRO 2 . E GLU 14 . E PRO 59 E GLU 71 ? ;(chain E and (resid 59 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 5 2 E GLU 15 . E GLU 15 . E GLU 72 E GLU 72 ? ;(chain E and (resid 59 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 5 3 E GLY 1 . E GLU 95 . E GLY 58 E GLU 152 ? ;(chain E and (resid 59 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 5 4 E GLY 1 . E GLU 95 . E GLY 58 E GLU 152 ? ;(chain E and (resid 59 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 5 5 E GLY 1 . E GLU 95 . E GLY 58 E GLU 152 ? ;(chain E and (resid 59 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 5 6 E GLY 1 . E GLU 95 . E GLY 58 E GLU 152 ? ;(chain E and (resid 59 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 142 or (resid 143 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 6 1 F PRO 2 . F PRO 9 . F PRO 59 F PRO 66 ? ;(chain F and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 6 2 F ARG 10 . F GLU 15 . F ARG 67 F GLU 72 ? ;(chain F and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 6 3 F PRO 2 . F GLU 95 . F PRO 59 F GLU 152 ? ;(chain F and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 6 4 F PRO 2 . F GLU 95 . F PRO 59 F GLU 152 ? ;(chain F and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 6 5 F PRO 2 . F GLU 95 . F PRO 59 F GLU 152 ? ;(chain F and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; 1 6 6 F PRO 2 . F GLU 95 . F PRO 59 F GLU 152 ? ;(chain F and (resid 59 through 66 or (resid 67 through 72 and (name N or name CA or name C or name O or name CB )) or resid 73 through 75 or (resid 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 88 or (resid 89 and (name N or name CA or name C or name O or name CB )) or resid 90 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 135 or (resid 136 and (name N or name CA or name C or name O or name CB )) or resid 137 through 141 or (resid 142 through 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 147)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7MPH _struct.title 'GRB2 SH2 Domain with Compound 7' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7MPH _struct_keywords.text 'Inhibitor, Complex, growth factor receptor, Ras-MAPK signaling cascade, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 2 ? H N N 3 ? I N N 4 ? J N N 4 ? K N N 4 ? L N N 2 ? M N N 3 ? N N N 4 ? O N N 4 ? P N N 4 ? Q N N 4 ? R N N 2 ? S N N 3 ? T N N 3 ? U N N 3 ? V N N 3 ? W N N 3 ? X N N 4 ? Y N N 2 ? Z N N 4 ? AA N N 4 ? BA N N 4 ? CA N N 2 ? DA N N 3 ? EA N N 3 ? FA N N 2 ? GA N N 3 ? HA N N 3 ? IA N N 3 ? JA N N 3 ? KA N N 5 ? LA N N 5 ? MA N N 5 ? NA N N 5 ? OA N N 5 ? PA N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 9 ? LYS A 19 ? PRO A 66 LYS A 76 1 ? 11 HELX_P HELX_P2 AA2 SER A 70 ? HIS A 78 ? SER A 127 HIS A 135 1 ? 9 HELX_P HELX_P3 AA3 PRO B 9 ? LYS B 19 ? PRO B 66 LYS B 76 1 ? 11 HELX_P HELX_P4 AA4 SER B 70 ? ARG B 79 ? SER B 127 ARG B 136 1 ? 10 HELX_P HELX_P5 AA5 PRO C 9 ? LYS C 19 ? PRO C 66 LYS C 76 1 ? 11 HELX_P HELX_P6 AA6 SER C 70 ? THR C 81 ? SER C 127 THR C 138 1 ? 12 HELX_P HELX_P7 AA7 PRO D 9 ? LYS D 19 ? PRO D 66 LYS D 76 1 ? 11 HELX_P HELX_P8 AA8 SER D 70 ? HIS D 78 ? SER D 127 HIS D 135 1 ? 9 HELX_P HELX_P9 AA9 ARG E 10 ? LEU E 17 ? ARG E 67 LEU E 74 1 ? 8 HELX_P HELX_P10 AB1 SER E 70 ? HIS E 78 ? SER E 127 HIS E 135 1 ? 9 HELX_P HELX_P11 AB2 PRO F 9 ? LYS F 19 ? PRO F 66 LYS F 76 1 ? 11 HELX_P HELX_P12 AB3 SER F 70 ? THR F 81 ? SER F 127 THR F 138 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 10 ? AA4 ? 3 ? AA5 ? 5 ? AA6 ? 3 ? AA7 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel AA3 8 9 ? anti-parallel AA3 9 10 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 26 ? GLU A 30 ? PHE A 83 GLU A 87 AA1 2 PHE A 38 ? PHE A 44 ? PHE A 95 PHE A 101 AA1 3 ASP A 47 ? ARG A 55 ? ASP A 104 ARG A 112 AA1 4 TYR A 61 ? PHE A 62 ? TYR A 118 PHE A 119 AA2 1 PHE B 26 ? GLU B 30 ? PHE B 83 GLU B 87 AA2 2 PHE B 38 ? PHE B 44 ? PHE B 95 PHE B 101 AA2 3 ASP B 47 ? ARG B 55 ? ASP B 104 ARG B 112 AA2 4 TYR B 61 ? PHE B 62 ? TYR B 118 PHE B 119 AA3 1 ASP C 47 ? LYS C 52 ? ASP C 104 LYS C 109 AA3 2 PHE C 38 ? PHE C 44 ? PHE C 95 PHE C 101 AA3 3 PHE C 26 ? GLU C 30 ? PHE C 83 GLU C 87 AA3 4 TRP D 3 ? GLY D 6 ? TRP D 60 GLY D 63 AA3 5 TRP C 3 ? GLY C 6 ? TRP C 60 GLY C 63 AA3 6 PHE D 26 ? GLU D 30 ? PHE D 83 GLU D 87 AA3 7 PHE D 38 ? PHE D 44 ? PHE D 95 PHE D 101 AA3 8 ASP D 47 ? ARG D 55 ? ASP D 104 ARG D 112 AA3 9 TYR D 61 ? PHE D 62 ? TYR D 118 PHE D 119 AA3 10 LYS D 67 ? PHE D 68 ? LYS D 124 PHE D 125 AA4 1 LEU C 54 ? ARG C 55 ? LEU C 111 ARG C 112 AA4 2 TYR C 61 ? PHE C 62 ? TYR C 118 PHE C 119 AA4 3 LYS C 67 ? PHE C 68 ? LYS C 124 PHE C 125 AA5 1 PHE E 26 ? GLU E 30 ? PHE E 83 GLU E 87 AA5 2 PHE E 38 ? PHE E 44 ? PHE E 95 PHE E 101 AA5 3 ASP E 47 ? ARG E 55 ? ASP E 104 ARG E 112 AA5 4 TYR E 61 ? PHE E 62 ? TYR E 118 PHE E 119 AA5 5 LYS E 67 ? PHE E 68 ? LYS E 124 PHE E 125 AA6 1 PHE F 26 ? GLU F 30 ? PHE F 83 GLU F 87 AA6 2 PHE F 38 ? PHE F 44 ? PHE F 95 PHE F 101 AA6 3 ASP F 47 ? LYS F 52 ? ASP F 104 LYS F 109 AA7 1 LEU F 54 ? ARG F 55 ? LEU F 111 ARG F 112 AA7 2 TYR F 61 ? PHE F 62 ? TYR F 118 PHE F 119 AA7 3 LYS F 67 ? PHE F 68 ? LYS F 124 PHE F 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 27 ? N LEU A 84 O SER A 41 ? O SER A 98 AA1 2 3 N LEU A 40 ? N LEU A 97 O PHE A 51 ? O PHE A 108 AA1 3 4 N LEU A 54 ? N LEU A 111 O PHE A 62 ? O PHE A 119 AA2 1 2 N LEU B 27 ? N LEU B 84 O SER B 41 ? O SER B 98 AA2 2 3 N LEU B 40 ? N LEU B 97 O PHE B 51 ? O PHE B 108 AA2 3 4 N LEU B 54 ? N LEU B 111 O PHE B 62 ? O PHE B 119 AA3 1 2 O PHE C 51 ? O PHE C 108 N LEU C 40 ? N LEU C 97 AA3 2 3 O SER C 39 ? O SER C 96 N ARG C 29 ? N ARG C 86 AA3 3 4 N ILE C 28 ? N ILE C 85 O PHE D 5 ? O PHE D 62 AA3 4 5 O PHE D 4 ? O PHE D 61 N GLY C 6 ? N GLY C 63 AA3 5 6 N PHE C 5 ? N PHE C 62 O ILE D 28 ? O ILE D 85 AA3 6 7 N ARG D 29 ? N ARG D 86 O SER D 39 ? O SER D 96 AA3 7 8 N VAL D 42 ? N VAL D 99 O GLN D 49 ? O GLN D 106 AA3 8 9 N LEU D 54 ? N LEU D 111 O PHE D 62 ? O PHE D 119 AA3 9 10 N TYR D 61 ? N TYR D 118 O PHE D 68 ? O PHE D 125 AA4 1 2 N LEU C 54 ? N LEU C 111 O PHE C 62 ? O PHE C 119 AA4 2 3 N TYR C 61 ? N TYR C 118 O PHE C 68 ? O PHE C 125 AA5 1 2 N LEU E 27 ? N LEU E 84 O SER E 41 ? O SER E 98 AA5 2 3 N PHE E 38 ? N PHE E 95 O VAL E 53 ? O VAL E 110 AA5 3 4 N LEU E 54 ? N LEU E 111 O PHE E 62 ? O PHE E 119 AA5 4 5 N TYR E 61 ? N TYR E 118 O PHE E 68 ? O PHE E 125 AA6 1 2 N ARG F 29 ? N ARG F 86 O SER F 39 ? O SER F 96 AA6 2 3 N VAL F 42 ? N VAL F 99 O GLN F 49 ? O GLN F 106 AA7 1 2 N LEU F 54 ? N LEU F 111 O PHE F 62 ? O PHE F 119 AA7 2 3 N TYR F 61 ? N TYR F 118 O PHE F 68 ? O PHE F 125 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZLY 201 ? 11 'binding site for residue ZLY A 201' AC2 Software A EDO 202 ? 7 'binding site for residue EDO A 202' AC3 Software A SO4 203 ? 5 'binding site for residue SO4 A 203' AC4 Software A SO4 204 ? 6 'binding site for residue SO4 A 204' AC5 Software A SO4 205 ? 5 'binding site for residue SO4 A 205' AC6 Software B ZLY 201 ? 12 'binding site for residue ZLY B 201' AC7 Software B EDO 202 ? 1 'binding site for residue EDO B 202' AC8 Software B SO4 203 ? 3 'binding site for residue SO4 B 203' AC9 Software B SO4 204 ? 2 'binding site for residue SO4 B 204' AD1 Software B SO4 205 ? 7 'binding site for residue SO4 B 205' AD2 Software B SO4 206 ? 6 'binding site for residue SO4 B 206' AD3 Software C ZLY 201 ? 17 'binding site for residue ZLY C 201' AD4 Software C EDO 202 ? 5 'binding site for residue EDO C 202' AD5 Software C EDO 203 ? 5 'binding site for residue EDO C 203' AD6 Software C EDO 204 ? 2 'binding site for residue EDO C 204' AD7 Software C EDO 205 ? 6 'binding site for residue EDO C 205' AD8 Software C EDO 206 ? 2 'binding site for residue EDO C 206' AD9 Software C SO4 207 ? 2 'binding site for residue SO4 C 207' AE1 Software D ZLY 201 ? 9 'binding site for residue ZLY D 201' AE2 Software D SO4 202 ? 2 'binding site for residue SO4 D 202' AE3 Software D SO4 203 ? 4 'binding site for residue SO4 D 203' AE4 Software D SO4 204 ? 2 'binding site for residue SO4 D 204' AE5 Software E ZLY 201 ? 13 'binding site for residue ZLY E 201' AE6 Software E EDO 202 ? 4 'binding site for residue EDO E 202' AE7 Software E EDO 203 ? 5 'binding site for residue EDO E 203' AE8 Software F ZLY 201 ? 17 'binding site for residue ZLY F 201' AE9 Software F EDO 202 ? 3 'binding site for residue EDO F 202' AF1 Software F EDO 203 ? 5 'binding site for residue EDO F 203' AF2 Software F EDO 204 ? 8 'binding site for residue EDO F 204' AF3 Software F EDO 205 ? 8 'binding site for residue EDO F 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 SER A 39 ? SER A 96 . ? 1_555 ? 2 AC1 11 GLN A 49 ? GLN A 106 . ? 1_555 ? 3 AC1 11 HIS A 50 ? HIS A 107 . ? 1_555 ? 4 AC1 11 PHE A 51 ? PHE A 108 . ? 1_555 ? 5 AC1 11 LYS A 52 ? LYS A 109 . ? 1_555 ? 6 AC1 11 LEU A 63 ? LEU A 120 . ? 1_555 ? 7 AC1 11 TRP A 64 ? TRP A 121 . ? 1_555 ? 8 AC1 11 EDO H . ? EDO A 202 . ? 1_555 ? 9 AC1 11 HOH KA . ? HOH A 309 . ? 1_555 ? 10 AC1 11 GLY F 57 ? GLY F 114 . ? 1_545 ? 11 AC1 11 ALA F 58 ? ALA F 115 . ? 1_545 ? 12 AC2 7 TRP A 64 ? TRP A 121 . ? 1_555 ? 13 AC2 7 ZLY G . ? ZLY A 201 . ? 1_555 ? 14 AC2 7 HOH KA . ? HOH A 305 . ? 1_555 ? 15 AC2 7 HOH KA . ? HOH A 308 . ? 1_555 ? 16 AC2 7 PHE C 62 ? PHE C 119 . ? 4_555 ? 17 AC2 7 TRP C 64 ? TRP C 121 . ? 4_555 ? 18 AC2 7 LYS C 67 ? LYS C 124 . ? 4_555 ? 19 AC3 5 SER A 70 ? SER A 127 . ? 1_555 ? 20 AC3 5 ASN A 72 ? ASN A 129 . ? 1_555 ? 21 AC3 5 GLU A 73 ? GLU A 130 . ? 1_555 ? 22 AC3 5 ASN E 46 ? ASN E 103 . ? 1_555 ? 23 AC3 5 LYS E 60 ? LYS E 117 . ? 3_645 ? 24 AC4 6 TRP A 64 ? TRP A 121 . ? 1_555 ? 25 AC4 6 VAL A 65 ? VAL A 122 . ? 1_555 ? 26 AC4 6 VAL A 66 ? VAL A 123 . ? 1_555 ? 27 AC4 6 TYR A 77 ? TYR A 134 . ? 1_555 ? 28 AC4 6 HIS A 78 ? HIS A 135 . ? 1_555 ? 29 AC4 6 HOH KA . ? HOH A 302 . ? 1_555 ? 30 AC5 5 ARG A 29 ? ARG A 86 . ? 1_555 ? 31 AC5 5 SER A 31 ? SER A 88 . ? 1_555 ? 32 AC5 5 GLU A 32 ? GLU A 89 . ? 1_555 ? 33 AC5 5 SER A 33 ? SER A 90 . ? 1_555 ? 34 AC5 5 SER F 70 ? SER F 127 . ? 1_545 ? 35 AC6 12 SER B 39 ? SER B 96 . ? 1_555 ? 36 AC6 12 GLN B 49 ? GLN B 106 . ? 1_555 ? 37 AC6 12 HIS B 50 ? HIS B 107 . ? 1_555 ? 38 AC6 12 PHE B 51 ? PHE B 108 . ? 1_555 ? 39 AC6 12 LYS B 52 ? LYS B 109 . ? 1_555 ? 40 AC6 12 LEU B 54 ? LEU B 111 . ? 1_555 ? 41 AC6 12 LEU B 63 ? LEU B 120 . ? 1_555 ? 42 AC6 12 TRP B 64 ? TRP B 121 . ? 1_555 ? 43 AC6 12 HOH LA . ? HOH B 308 . ? 1_555 ? 44 AC6 12 GLY C 57 ? GLY C 114 . ? 1_655 ? 45 AC6 12 ALA C 58 ? ALA C 115 . ? 1_655 ? 46 AC6 12 EDO JA . ? EDO F 205 . ? 4_565 ? 47 AC7 1 ARG B 92 ? ARG B 149 . ? 1_555 ? 48 AC8 3 SER B 70 ? SER B 127 . ? 1_555 ? 49 AC8 3 ASN B 72 ? ASN B 129 . ? 1_555 ? 50 AC8 3 LYS D 60 ? LYS D 117 . ? 1_655 ? 51 AC9 2 ASN B 69 ? ASN B 126 . ? 1_555 ? 52 AC9 2 GLU B 73 ? GLU B 130 . ? 1_555 ? 53 AD1 7 TRP B 64 ? TRP B 121 . ? 1_555 ? 54 AD1 7 VAL B 65 ? VAL B 122 . ? 1_555 ? 55 AD1 7 VAL B 66 ? VAL B 123 . ? 1_555 ? 56 AD1 7 TYR B 77 ? TYR B 134 . ? 1_555 ? 57 AD1 7 HIS B 78 ? HIS B 135 . ? 1_555 ? 58 AD1 7 ARG B 85 ? ARG B 142 . ? 1_555 ? 59 AD1 7 HOH LA . ? HOH B 313 . ? 1_555 ? 60 AD2 6 ARG B 29 ? ARG B 86 . ? 1_555 ? 61 AD2 6 SER B 31 ? SER B 88 . ? 1_555 ? 62 AD2 6 GLU B 32 ? GLU B 89 . ? 1_555 ? 63 AD2 6 SER B 33 ? SER B 90 . ? 1_555 ? 64 AD2 6 SER C 70 ? SER C 127 . ? 1_655 ? 65 AD2 6 HOH MA . ? HOH C 314 . ? 1_655 ? 66 AD3 17 ARG A 55 ? ARG A 112 . ? 4_455 ? 67 AD3 17 ASP A 56 ? ASP A 113 . ? 4_455 ? 68 AD3 17 GLY A 57 ? GLY A 114 . ? 4_455 ? 69 AD3 17 PHE A 62 ? PHE A 119 . ? 4_455 ? 70 AD3 17 LYS A 67 ? LYS A 124 . ? 4_455 ? 71 AD3 17 SER C 39 ? SER C 96 . ? 1_555 ? 72 AD3 17 HIS C 50 ? HIS C 107 . ? 1_555 ? 73 AD3 17 PHE C 51 ? PHE C 108 . ? 1_555 ? 74 AD3 17 LYS C 52 ? LYS C 109 . ? 1_555 ? 75 AD3 17 LEU C 54 ? LEU C 111 . ? 1_555 ? 76 AD3 17 LEU C 63 ? LEU C 120 . ? 1_555 ? 77 AD3 17 TRP C 64 ? TRP C 121 . ? 1_555 ? 78 AD3 17 HOH MA . ? HOH C 312 . ? 1_555 ? 79 AD3 17 SER F 33 ? SER F 90 . ? 4_465 ? 80 AD3 17 ALA F 34 ? ALA F 91 . ? 4_465 ? 81 AD3 17 GLY F 36 ? GLY F 93 . ? 4_465 ? 82 AD3 17 EDO IA . ? EDO F 204 . ? 4_465 ? 83 AD4 5 PRO B 35 ? PRO B 92 . ? 1_455 ? 84 AD4 5 GLU C 30 ? GLU C 87 . ? 1_555 ? 85 AD4 5 HOH MA . ? HOH C 305 . ? 1_555 ? 86 AD4 5 TRP D 3 ? TRP D 60 . ? 1_555 ? 87 AD4 5 ASN D 72 ? ASN D 129 . ? 1_555 ? 88 AD5 5 TRP C 64 ? TRP C 121 . ? 1_555 ? 89 AD5 5 VAL C 65 ? VAL C 122 . ? 1_555 ? 90 AD5 5 VAL C 66 ? VAL C 123 . ? 1_555 ? 91 AD5 5 HIS C 78 ? HIS C 135 . ? 1_555 ? 92 AD5 5 HOH MA . ? HOH C 302 . ? 1_555 ? 93 AD6 2 HIS C 22 ? HIS C 79 . ? 1_555 ? 94 AD6 2 ASP C 23 ? ASP C 80 . ? 1_555 ? 95 AD7 6 ARG C 55 ? ARG C 112 . ? 1_555 ? 96 AD7 6 PHE C 62 ? PHE C 119 . ? 1_555 ? 97 AD7 6 HOH MA . ? HOH C 313 . ? 1_555 ? 98 AD7 6 ARG F 55 ? ARG F 112 . ? 4_465 ? 99 AD7 6 EDO IA . ? EDO F 204 . ? 4_465 ? 100 AD7 6 EDO JA . ? EDO F 205 . ? 4_465 ? 101 AD8 2 ASP B 37 ? ASP B 94 . ? 1_455 ? 102 AD8 2 ARG C 55 ? ARG C 112 . ? 1_555 ? 103 AD9 2 ARG C 10 ? ARG C 67 . ? 1_555 ? 104 AD9 2 ARG C 29 ? ARG C 86 . ? 1_555 ? 105 AE1 9 PHE A 5 ? PHE A 62 . ? 3_555 ? 106 AE1 9 ARG D 29 ? ARG D 86 . ? 1_555 ? 107 AE1 9 HIS D 50 ? HIS D 107 . ? 1_555 ? 108 AE1 9 PHE D 51 ? PHE D 108 . ? 1_555 ? 109 AE1 9 LYS D 52 ? LYS D 109 . ? 1_555 ? 110 AE1 9 LEU D 63 ? LEU D 120 . ? 1_555 ? 111 AE1 9 TRP D 64 ? TRP D 121 . ? 1_555 ? 112 AE1 9 ARG E 55 ? ARG E 112 . ? 1_455 ? 113 AE1 9 EDO DA . ? EDO E 202 . ? 1_455 ? 114 AE2 2 PRO D 9 ? PRO D 66 . ? 1_555 ? 115 AE2 2 ARG D 10 ? ARG D 67 . ? 1_555 ? 116 AE3 4 LYS A 19 ? LYS A 76 . ? 3_555 ? 117 AE3 4 PHE D 44 ? PHE D 101 . ? 1_555 ? 118 AE3 4 GLN D 87 ? GLN D 144 . ? 1_555 ? 119 AE3 4 ARG F 92 ? ARG F 149 . ? 1_555 ? 120 AE4 2 GLN A 87 ? GLN A 144 . ? 1_555 ? 121 AE4 2 LYS D 12 ? LYS D 69 . ? 1_555 ? 122 AE5 13 PHE B 5 ? PHE B 62 . ? 1_555 ? 123 AE5 13 ARG D 55 ? ARG D 112 . ? 1_655 ? 124 AE5 13 ASP D 56 ? ASP D 113 . ? 1_655 ? 125 AE5 13 GLY D 57 ? GLY D 114 . ? 1_655 ? 126 AE5 13 SER E 39 ? SER E 96 . ? 1_555 ? 127 AE5 13 GLN E 49 ? GLN E 106 . ? 1_555 ? 128 AE5 13 HIS E 50 ? HIS E 107 . ? 1_555 ? 129 AE5 13 PHE E 51 ? PHE E 108 . ? 1_555 ? 130 AE5 13 LYS E 52 ? LYS E 109 . ? 1_555 ? 131 AE5 13 LEU E 54 ? LEU E 111 . ? 1_555 ? 132 AE5 13 LEU E 63 ? LEU E 120 . ? 1_555 ? 133 AE5 13 TRP E 64 ? TRP E 121 . ? 1_555 ? 134 AE5 13 EDO DA . ? EDO E 202 . ? 1_555 ? 135 AE6 4 ARG D 55 ? ARG D 112 . ? 1_655 ? 136 AE6 4 ZLY Y . ? ZLY D 201 . ? 1_655 ? 137 AE6 4 ARG E 55 ? ARG E 112 . ? 1_555 ? 138 AE6 4 ZLY CA . ? ZLY E 201 . ? 1_555 ? 139 AE7 5 PRO A 35 ? PRO A 92 . ? 3_655 ? 140 AE7 5 ASN E 72 ? ASN E 129 . ? 1_555 ? 141 AE7 5 HOH OA . ? HOH E 305 . ? 1_555 ? 142 AE7 5 PHE F 5 ? PHE F 62 . ? 3_645 ? 143 AE7 5 GLU F 30 ? GLU F 87 . ? 3_645 ? 144 AE8 17 ARG B 55 ? ARG B 112 . ? 4_465 ? 145 AE8 17 ASP B 56 ? ASP B 113 . ? 4_465 ? 146 AE8 17 GLY B 57 ? GLY B 114 . ? 4_465 ? 147 AE8 17 PHE B 62 ? PHE B 119 . ? 4_465 ? 148 AE8 17 LYS B 67 ? LYS B 124 . ? 4_465 ? 149 AE8 17 ALA C 34 ? ALA C 91 . ? 4_565 ? 150 AE8 17 GLY C 36 ? GLY C 93 . ? 4_565 ? 151 AE8 17 ASP C 37 ? ASP C 94 . ? 4_565 ? 152 AE8 17 ARG F 29 ? ARG F 86 . ? 1_555 ? 153 AE8 17 SER F 39 ? SER F 96 . ? 1_555 ? 154 AE8 17 HIS F 50 ? HIS F 107 . ? 1_555 ? 155 AE8 17 PHE F 51 ? PHE F 108 . ? 1_555 ? 156 AE8 17 LYS F 52 ? LYS F 109 . ? 1_555 ? 157 AE8 17 LEU F 54 ? LEU F 111 . ? 1_555 ? 158 AE8 17 LEU F 63 ? LEU F 120 . ? 1_555 ? 159 AE8 17 TRP F 64 ? TRP F 121 . ? 1_555 ? 160 AE8 17 EDO JA . ? EDO F 205 . ? 1_555 ? 161 AE9 3 PRO E 2 ? PRO E 59 . ? 3_655 ? 162 AE9 3 PRO F 9 ? PRO F 66 . ? 1_555 ? 163 AE9 3 ARG F 10 ? ARG F 67 . ? 1_555 ? 164 AF1 5 TRP F 64 ? TRP F 121 . ? 1_555 ? 165 AF1 5 VAL F 65 ? VAL F 122 . ? 1_555 ? 166 AF1 5 VAL F 66 ? VAL F 123 . ? 1_555 ? 167 AF1 5 HIS F 78 ? HIS F 135 . ? 1_555 ? 168 AF1 5 HOH PA . ? HOH F 301 . ? 1_555 ? 169 AF2 8 ZLY R . ? ZLY C 201 . ? 4_565 ? 170 AF2 8 EDO V . ? EDO C 205 . ? 4_565 ? 171 AF2 8 ASP F 37 ? ASP F 94 . ? 1_555 ? 172 AF2 8 LYS F 52 ? LYS F 109 . ? 1_555 ? 173 AF2 8 VAL F 53 ? VAL F 110 . ? 1_555 ? 174 AF2 8 LEU F 54 ? LEU F 111 . ? 1_555 ? 175 AF2 8 ARG F 55 ? ARG F 112 . ? 1_555 ? 176 AF2 8 EDO JA . ? EDO F 205 . ? 1_555 ? 177 AF3 8 ZLY L . ? ZLY B 201 . ? 4_465 ? 178 AF3 8 ARG C 55 ? ARG C 112 . ? 4_565 ? 179 AF3 8 EDO V . ? EDO C 205 . ? 4_565 ? 180 AF3 8 ARG F 55 ? ARG F 112 . ? 1_555 ? 181 AF3 8 PHE F 62 ? PHE F 119 . ? 1_555 ? 182 AF3 8 ZLY FA . ? ZLY F 201 . ? 1_555 ? 183 AF3 8 EDO IA . ? EDO F 204 . ? 1_555 ? 184 AF3 8 HOH PA . ? HOH F 314 . ? 1_555 ? # _atom_sites.entry_id 7MPH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016159 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011481 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007331 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 58 58 GLY GLY A . n A 1 2 PRO 2 59 59 PRO PRO A . n A 1 3 TRP 3 60 60 TRP TRP A . n A 1 4 PHE 4 61 61 PHE PHE A . n A 1 5 PHE 5 62 62 PHE PHE A . n A 1 6 GLY 6 63 63 GLY GLY A . n A 1 7 LYS 7 64 64 LYS LYS A . n A 1 8 ILE 8 65 65 ILE ILE A . n A 1 9 PRO 9 66 66 PRO PRO A . n A 1 10 ARG 10 67 67 ARG ARG A . n A 1 11 ALA 11 68 68 ALA ALA A . n A 1 12 LYS 12 69 69 LYS LYS A . n A 1 13 ALA 13 70 70 ALA ALA A . n A 1 14 GLU 14 71 71 GLU GLU A . n A 1 15 GLU 15 72 72 GLU GLU A . n A 1 16 MET 16 73 73 MET MET A . n A 1 17 LEU 17 74 74 LEU LEU A . n A 1 18 SER 18 75 75 SER SER A . n A 1 19 LYS 19 76 76 LYS LYS A . n A 1 20 GLN 20 77 77 GLN GLN A . n A 1 21 ARG 21 78 78 ARG ARG A . n A 1 22 HIS 22 79 79 HIS HIS A . n A 1 23 ASP 23 80 80 ASP ASP A . n A 1 24 GLY 24 81 81 GLY GLY A . n A 1 25 ALA 25 82 82 ALA ALA A . n A 1 26 PHE 26 83 83 PHE PHE A . n A 1 27 LEU 27 84 84 LEU LEU A . n A 1 28 ILE 28 85 85 ILE ILE A . n A 1 29 ARG 29 86 86 ARG ARG A . n A 1 30 GLU 30 87 87 GLU GLU A . n A 1 31 SER 31 88 88 SER SER A . n A 1 32 GLU 32 89 89 GLU GLU A . n A 1 33 SER 33 90 90 SER SER A . n A 1 34 ALA 34 91 91 ALA ALA A . n A 1 35 PRO 35 92 92 PRO PRO A . n A 1 36 GLY 36 93 93 GLY GLY A . n A 1 37 ASP 37 94 94 ASP ASP A . n A 1 38 PHE 38 95 95 PHE PHE A . n A 1 39 SER 39 96 96 SER SER A . n A 1 40 LEU 40 97 97 LEU LEU A . n A 1 41 SER 41 98 98 SER SER A . n A 1 42 VAL 42 99 99 VAL VAL A . n A 1 43 LYS 43 100 100 LYS LYS A . n A 1 44 PHE 44 101 101 PHE PHE A . n A 1 45 GLY 45 102 102 GLY GLY A . n A 1 46 ASN 46 103 103 ASN ASN A . n A 1 47 ASP 47 104 104 ASP ASP A . n A 1 48 VAL 48 105 105 VAL VAL A . n A 1 49 GLN 49 106 106 GLN GLN A . n A 1 50 HIS 50 107 107 HIS HIS A . n A 1 51 PHE 51 108 108 PHE PHE A . n A 1 52 LYS 52 109 109 LYS LYS A . n A 1 53 VAL 53 110 110 VAL VAL A . n A 1 54 LEU 54 111 111 LEU LEU A . n A 1 55 ARG 55 112 112 ARG ARG A . n A 1 56 ASP 56 113 113 ASP ASP A . n A 1 57 GLY 57 114 114 GLY GLY A . n A 1 58 ALA 58 115 115 ALA ALA A . n A 1 59 GLY 59 116 116 GLY GLY A . n A 1 60 LYS 60 117 117 LYS LYS A . n A 1 61 TYR 61 118 118 TYR TYR A . n A 1 62 PHE 62 119 119 PHE PHE A . n A 1 63 LEU 63 120 120 LEU LEU A . n A 1 64 TRP 64 121 121 TRP TRP A . n A 1 65 VAL 65 122 122 VAL VAL A . n A 1 66 VAL 66 123 123 VAL VAL A . n A 1 67 LYS 67 124 124 LYS LYS A . n A 1 68 PHE 68 125 125 PHE PHE A . n A 1 69 ASN 69 126 126 ASN ASN A . n A 1 70 SER 70 127 127 SER SER A . n A 1 71 LEU 71 128 128 LEU LEU A . n A 1 72 ASN 72 129 129 ASN ASN A . n A 1 73 GLU 73 130 130 GLU GLU A . n A 1 74 LEU 74 131 131 LEU LEU A . n A 1 75 VAL 75 132 132 VAL VAL A . n A 1 76 ASP 76 133 133 ASP ASP A . n A 1 77 TYR 77 134 134 TYR TYR A . n A 1 78 HIS 78 135 135 HIS HIS A . n A 1 79 ARG 79 136 136 ARG ARG A . n A 1 80 SER 80 137 137 SER SER A . n A 1 81 THR 81 138 138 THR THR A . n A 1 82 SER 82 139 139 SER SER A . n A 1 83 VAL 83 140 140 VAL VAL A . n A 1 84 SER 84 141 141 SER SER A . n A 1 85 ARG 85 142 142 ARG ARG A . n A 1 86 ASN 86 143 143 ASN ASN A . n A 1 87 GLN 87 144 144 GLN GLN A . n A 1 88 GLN 88 145 145 GLN GLN A . n A 1 89 ILE 89 146 146 ILE ILE A . n A 1 90 PHE 90 147 147 PHE PHE A . n A 1 91 LEU 91 148 ? ? ? A . n A 1 92 ARG 92 149 ? ? ? A . n A 1 93 ASP 93 150 ? ? ? A . n A 1 94 ILE 94 151 ? ? ? A . n A 1 95 GLU 95 152 ? ? ? A . n B 1 1 GLY 1 58 58 GLY GLY B . n B 1 2 PRO 2 59 59 PRO PRO B . n B 1 3 TRP 3 60 60 TRP TRP B . n B 1 4 PHE 4 61 61 PHE PHE B . n B 1 5 PHE 5 62 62 PHE PHE B . n B 1 6 GLY 6 63 63 GLY GLY B . n B 1 7 LYS 7 64 64 LYS LYS B . n B 1 8 ILE 8 65 65 ILE ILE B . n B 1 9 PRO 9 66 66 PRO PRO B . n B 1 10 ARG 10 67 67 ARG ARG B . n B 1 11 ALA 11 68 68 ALA ALA B . n B 1 12 LYS 12 69 69 LYS LYS B . n B 1 13 ALA 13 70 70 ALA ALA B . n B 1 14 GLU 14 71 71 GLU GLU B . n B 1 15 GLU 15 72 72 GLU GLU B . n B 1 16 MET 16 73 73 MET MET B . n B 1 17 LEU 17 74 74 LEU LEU B . n B 1 18 SER 18 75 75 SER SER B . n B 1 19 LYS 19 76 76 LYS LYS B . n B 1 20 GLN 20 77 77 GLN GLN B . n B 1 21 ARG 21 78 78 ARG ARG B . n B 1 22 HIS 22 79 79 HIS HIS B . n B 1 23 ASP 23 80 80 ASP ASP B . n B 1 24 GLY 24 81 81 GLY GLY B . n B 1 25 ALA 25 82 82 ALA ALA B . n B 1 26 PHE 26 83 83 PHE PHE B . n B 1 27 LEU 27 84 84 LEU LEU B . n B 1 28 ILE 28 85 85 ILE ILE B . n B 1 29 ARG 29 86 86 ARG ARG B . n B 1 30 GLU 30 87 87 GLU GLU B . n B 1 31 SER 31 88 88 SER SER B . n B 1 32 GLU 32 89 89 GLU GLU B . n B 1 33 SER 33 90 90 SER SER B . n B 1 34 ALA 34 91 91 ALA ALA B . n B 1 35 PRO 35 92 92 PRO PRO B . n B 1 36 GLY 36 93 93 GLY GLY B . n B 1 37 ASP 37 94 94 ASP ASP B . n B 1 38 PHE 38 95 95 PHE PHE B . n B 1 39 SER 39 96 96 SER SER B . n B 1 40 LEU 40 97 97 LEU LEU B . n B 1 41 SER 41 98 98 SER SER B . n B 1 42 VAL 42 99 99 VAL VAL B . n B 1 43 LYS 43 100 100 LYS LYS B . n B 1 44 PHE 44 101 101 PHE PHE B . n B 1 45 GLY 45 102 102 GLY GLY B . n B 1 46 ASN 46 103 103 ASN ASN B . n B 1 47 ASP 47 104 104 ASP ASP B . n B 1 48 VAL 48 105 105 VAL VAL B . n B 1 49 GLN 49 106 106 GLN GLN B . n B 1 50 HIS 50 107 107 HIS HIS B . n B 1 51 PHE 51 108 108 PHE PHE B . n B 1 52 LYS 52 109 109 LYS LYS B . n B 1 53 VAL 53 110 110 VAL VAL B . n B 1 54 LEU 54 111 111 LEU LEU B . n B 1 55 ARG 55 112 112 ARG ARG B . n B 1 56 ASP 56 113 113 ASP ASP B . n B 1 57 GLY 57 114 114 GLY GLY B . n B 1 58 ALA 58 115 115 ALA ALA B . n B 1 59 GLY 59 116 116 GLY GLY B . n B 1 60 LYS 60 117 117 LYS LYS B . n B 1 61 TYR 61 118 118 TYR TYR B . n B 1 62 PHE 62 119 119 PHE PHE B . n B 1 63 LEU 63 120 120 LEU LEU B . n B 1 64 TRP 64 121 121 TRP TRP B . n B 1 65 VAL 65 122 122 VAL VAL B . n B 1 66 VAL 66 123 123 VAL VAL B . n B 1 67 LYS 67 124 124 LYS LYS B . n B 1 68 PHE 68 125 125 PHE PHE B . n B 1 69 ASN 69 126 126 ASN ASN B . n B 1 70 SER 70 127 127 SER SER B . n B 1 71 LEU 71 128 128 LEU LEU B . n B 1 72 ASN 72 129 129 ASN ASN B . n B 1 73 GLU 73 130 130 GLU GLU B . n B 1 74 LEU 74 131 131 LEU LEU B . n B 1 75 VAL 75 132 132 VAL VAL B . n B 1 76 ASP 76 133 133 ASP ASP B . n B 1 77 TYR 77 134 134 TYR TYR B . n B 1 78 HIS 78 135 135 HIS HIS B . n B 1 79 ARG 79 136 136 ARG ARG B . n B 1 80 SER 80 137 137 SER SER B . n B 1 81 THR 81 138 138 THR THR B . n B 1 82 SER 82 139 139 SER SER B . n B 1 83 VAL 83 140 140 VAL VAL B . n B 1 84 SER 84 141 141 SER SER B . n B 1 85 ARG 85 142 142 ARG ARG B . n B 1 86 ASN 86 143 143 ASN ASN B . n B 1 87 GLN 87 144 144 GLN GLN B . n B 1 88 GLN 88 145 145 GLN GLN B . n B 1 89 ILE 89 146 146 ILE ILE B . n B 1 90 PHE 90 147 147 PHE PHE B . n B 1 91 LEU 91 148 148 LEU LEU B . n B 1 92 ARG 92 149 149 ARG ARG B . n B 1 93 ASP 93 150 150 ASP ASP B . n B 1 94 ILE 94 151 151 ILE ILE B . n B 1 95 GLU 95 152 ? ? ? B . n C 1 1 GLY 1 58 58 GLY GLY C . n C 1 2 PRO 2 59 59 PRO PRO C . n C 1 3 TRP 3 60 60 TRP TRP C . n C 1 4 PHE 4 61 61 PHE PHE C . n C 1 5 PHE 5 62 62 PHE PHE C . n C 1 6 GLY 6 63 63 GLY GLY C . n C 1 7 LYS 7 64 64 LYS LYS C . n C 1 8 ILE 8 65 65 ILE ILE C . n C 1 9 PRO 9 66 66 PRO PRO C . n C 1 10 ARG 10 67 67 ARG ARG C . n C 1 11 ALA 11 68 68 ALA ALA C . n C 1 12 LYS 12 69 69 LYS LYS C . n C 1 13 ALA 13 70 70 ALA ALA C . n C 1 14 GLU 14 71 71 GLU GLU C . n C 1 15 GLU 15 72 72 GLU GLU C . n C 1 16 MET 16 73 73 MET MET C . n C 1 17 LEU 17 74 74 LEU LEU C . n C 1 18 SER 18 75 75 SER SER C . n C 1 19 LYS 19 76 76 LYS LYS C . n C 1 20 GLN 20 77 77 GLN GLN C . n C 1 21 ARG 21 78 78 ARG ARG C . n C 1 22 HIS 22 79 79 HIS HIS C . n C 1 23 ASP 23 80 80 ASP ASP C . n C 1 24 GLY 24 81 81 GLY GLY C . n C 1 25 ALA 25 82 82 ALA ALA C . n C 1 26 PHE 26 83 83 PHE PHE C . n C 1 27 LEU 27 84 84 LEU LEU C . n C 1 28 ILE 28 85 85 ILE ILE C . n C 1 29 ARG 29 86 86 ARG ARG C . n C 1 30 GLU 30 87 87 GLU GLU C . n C 1 31 SER 31 88 88 SER SER C . n C 1 32 GLU 32 89 89 GLU GLU C . n C 1 33 SER 33 90 90 SER SER C . n C 1 34 ALA 34 91 91 ALA ALA C . n C 1 35 PRO 35 92 92 PRO PRO C . n C 1 36 GLY 36 93 93 GLY GLY C . n C 1 37 ASP 37 94 94 ASP ASP C . n C 1 38 PHE 38 95 95 PHE PHE C . n C 1 39 SER 39 96 96 SER SER C . n C 1 40 LEU 40 97 97 LEU LEU C . n C 1 41 SER 41 98 98 SER SER C . n C 1 42 VAL 42 99 99 VAL VAL C . n C 1 43 LYS 43 100 100 LYS LYS C . n C 1 44 PHE 44 101 101 PHE PHE C . n C 1 45 GLY 45 102 102 GLY GLY C . n C 1 46 ASN 46 103 103 ASN ASN C . n C 1 47 ASP 47 104 104 ASP ASP C . n C 1 48 VAL 48 105 105 VAL VAL C . n C 1 49 GLN 49 106 106 GLN GLN C . n C 1 50 HIS 50 107 107 HIS HIS C . n C 1 51 PHE 51 108 108 PHE PHE C . n C 1 52 LYS 52 109 109 LYS LYS C . n C 1 53 VAL 53 110 110 VAL VAL C . n C 1 54 LEU 54 111 111 LEU LEU C . n C 1 55 ARG 55 112 112 ARG ARG C . n C 1 56 ASP 56 113 113 ASP ASP C . n C 1 57 GLY 57 114 114 GLY GLY C . n C 1 58 ALA 58 115 115 ALA ALA C . n C 1 59 GLY 59 116 116 GLY GLY C . n C 1 60 LYS 60 117 117 LYS LYS C . n C 1 61 TYR 61 118 118 TYR TYR C . n C 1 62 PHE 62 119 119 PHE PHE C . n C 1 63 LEU 63 120 120 LEU LEU C . n C 1 64 TRP 64 121 121 TRP TRP C . n C 1 65 VAL 65 122 122 VAL VAL C . n C 1 66 VAL 66 123 123 VAL VAL C . n C 1 67 LYS 67 124 124 LYS LYS C . n C 1 68 PHE 68 125 125 PHE PHE C . n C 1 69 ASN 69 126 126 ASN ASN C . n C 1 70 SER 70 127 127 SER SER C . n C 1 71 LEU 71 128 128 LEU LEU C . n C 1 72 ASN 72 129 129 ASN ASN C . n C 1 73 GLU 73 130 130 GLU GLU C . n C 1 74 LEU 74 131 131 LEU LEU C . n C 1 75 VAL 75 132 132 VAL VAL C . n C 1 76 ASP 76 133 133 ASP ASP C . n C 1 77 TYR 77 134 134 TYR TYR C . n C 1 78 HIS 78 135 135 HIS HIS C . n C 1 79 ARG 79 136 136 ARG ARG C . n C 1 80 SER 80 137 137 SER SER C . n C 1 81 THR 81 138 138 THR THR C . n C 1 82 SER 82 139 139 SER SER C . n C 1 83 VAL 83 140 140 VAL VAL C . n C 1 84 SER 84 141 141 SER SER C . n C 1 85 ARG 85 142 142 ARG ARG C . n C 1 86 ASN 86 143 143 ASN ASN C . n C 1 87 GLN 87 144 144 GLN GLN C . n C 1 88 GLN 88 145 145 GLN GLN C . n C 1 89 ILE 89 146 146 ILE ILE C . n C 1 90 PHE 90 147 147 PHE PHE C . n C 1 91 LEU 91 148 148 LEU LEU C . n C 1 92 ARG 92 149 149 ARG ARG C . n C 1 93 ASP 93 150 150 ASP ASP C . n C 1 94 ILE 94 151 151 ILE ILE C . n C 1 95 GLU 95 152 152 GLU GLU C . n D 1 1 GLY 1 58 58 GLY GLY D . n D 1 2 PRO 2 59 59 PRO PRO D . n D 1 3 TRP 3 60 60 TRP TRP D . n D 1 4 PHE 4 61 61 PHE PHE D . n D 1 5 PHE 5 62 62 PHE PHE D . n D 1 6 GLY 6 63 63 GLY GLY D . n D 1 7 LYS 7 64 64 LYS LYS D . n D 1 8 ILE 8 65 65 ILE ILE D . n D 1 9 PRO 9 66 66 PRO PRO D . n D 1 10 ARG 10 67 67 ARG ARG D . n D 1 11 ALA 11 68 68 ALA ALA D . n D 1 12 LYS 12 69 69 LYS LYS D . n D 1 13 ALA 13 70 70 ALA ALA D . n D 1 14 GLU 14 71 71 GLU GLU D . n D 1 15 GLU 15 72 72 GLU GLU D . n D 1 16 MET 16 73 73 MET MET D . n D 1 17 LEU 17 74 74 LEU LEU D . n D 1 18 SER 18 75 75 SER SER D . n D 1 19 LYS 19 76 76 LYS LYS D . n D 1 20 GLN 20 77 77 GLN GLN D . n D 1 21 ARG 21 78 78 ARG ARG D . n D 1 22 HIS 22 79 79 HIS HIS D . n D 1 23 ASP 23 80 80 ASP ASP D . n D 1 24 GLY 24 81 81 GLY GLY D . n D 1 25 ALA 25 82 82 ALA ALA D . n D 1 26 PHE 26 83 83 PHE PHE D . n D 1 27 LEU 27 84 84 LEU LEU D . n D 1 28 ILE 28 85 85 ILE ILE D . n D 1 29 ARG 29 86 86 ARG ARG D . n D 1 30 GLU 30 87 87 GLU GLU D . n D 1 31 SER 31 88 88 SER SER D . n D 1 32 GLU 32 89 89 GLU GLU D . n D 1 33 SER 33 90 90 SER SER D . n D 1 34 ALA 34 91 91 ALA ALA D . n D 1 35 PRO 35 92 92 PRO PRO D . n D 1 36 GLY 36 93 93 GLY GLY D . n D 1 37 ASP 37 94 94 ASP ASP D . n D 1 38 PHE 38 95 95 PHE PHE D . n D 1 39 SER 39 96 96 SER SER D . n D 1 40 LEU 40 97 97 LEU LEU D . n D 1 41 SER 41 98 98 SER SER D . n D 1 42 VAL 42 99 99 VAL VAL D . n D 1 43 LYS 43 100 100 LYS LYS D . n D 1 44 PHE 44 101 101 PHE PHE D . n D 1 45 GLY 45 102 102 GLY GLY D . n D 1 46 ASN 46 103 103 ASN ASN D . n D 1 47 ASP 47 104 104 ASP ASP D . n D 1 48 VAL 48 105 105 VAL VAL D . n D 1 49 GLN 49 106 106 GLN GLN D . n D 1 50 HIS 50 107 107 HIS HIS D . n D 1 51 PHE 51 108 108 PHE PHE D . n D 1 52 LYS 52 109 109 LYS LYS D . n D 1 53 VAL 53 110 110 VAL VAL D . n D 1 54 LEU 54 111 111 LEU LEU D . n D 1 55 ARG 55 112 112 ARG ARG D . n D 1 56 ASP 56 113 113 ASP ASP D . n D 1 57 GLY 57 114 114 GLY GLY D . n D 1 58 ALA 58 115 115 ALA ALA D . n D 1 59 GLY 59 116 116 GLY GLY D . n D 1 60 LYS 60 117 117 LYS LYS D . n D 1 61 TYR 61 118 118 TYR TYR D . n D 1 62 PHE 62 119 119 PHE PHE D . n D 1 63 LEU 63 120 120 LEU LEU D . n D 1 64 TRP 64 121 121 TRP TRP D . n D 1 65 VAL 65 122 122 VAL VAL D . n D 1 66 VAL 66 123 123 VAL VAL D . n D 1 67 LYS 67 124 124 LYS LYS D . n D 1 68 PHE 68 125 125 PHE PHE D . n D 1 69 ASN 69 126 126 ASN ASN D . n D 1 70 SER 70 127 127 SER SER D . n D 1 71 LEU 71 128 128 LEU LEU D . n D 1 72 ASN 72 129 129 ASN ASN D . n D 1 73 GLU 73 130 130 GLU GLU D . n D 1 74 LEU 74 131 131 LEU LEU D . n D 1 75 VAL 75 132 132 VAL VAL D . n D 1 76 ASP 76 133 133 ASP ASP D . n D 1 77 TYR 77 134 134 TYR TYR D . n D 1 78 HIS 78 135 135 HIS HIS D . n D 1 79 ARG 79 136 136 ARG ARG D . n D 1 80 SER 80 137 137 SER SER D . n D 1 81 THR 81 138 138 THR THR D . n D 1 82 SER 82 139 139 SER SER D . n D 1 83 VAL 83 140 140 VAL VAL D . n D 1 84 SER 84 141 141 SER SER D . n D 1 85 ARG 85 142 142 ARG ARG D . n D 1 86 ASN 86 143 143 ASN ASN D . n D 1 87 GLN 87 144 144 GLN GLN D . n D 1 88 GLN 88 145 145 GLN GLN D . n D 1 89 ILE 89 146 146 ILE ILE D . n D 1 90 PHE 90 147 147 PHE PHE D . n D 1 91 LEU 91 148 148 LEU LEU D . n D 1 92 ARG 92 149 149 ARG ARG D . n D 1 93 ASP 93 150 150 ASP ASP D . n D 1 94 ILE 94 151 151 ILE ILE D . n D 1 95 GLU 95 152 152 GLU GLU D . n E 1 1 GLY 1 58 58 GLY GLY E . n E 1 2 PRO 2 59 59 PRO PRO E . n E 1 3 TRP 3 60 60 TRP TRP E . n E 1 4 PHE 4 61 61 PHE PHE E . n E 1 5 PHE 5 62 62 PHE PHE E . n E 1 6 GLY 6 63 63 GLY GLY E . n E 1 7 LYS 7 64 64 LYS LYS E . n E 1 8 ILE 8 65 65 ILE ILE E . n E 1 9 PRO 9 66 66 PRO PRO E . n E 1 10 ARG 10 67 67 ARG ARG E . n E 1 11 ALA 11 68 68 ALA ALA E . n E 1 12 LYS 12 69 69 LYS LYS E . n E 1 13 ALA 13 70 70 ALA ALA E . n E 1 14 GLU 14 71 71 GLU GLU E . n E 1 15 GLU 15 72 72 GLU GLU E . n E 1 16 MET 16 73 73 MET MET E . n E 1 17 LEU 17 74 74 LEU LEU E . n E 1 18 SER 18 75 75 SER SER E . n E 1 19 LYS 19 76 76 LYS LYS E . n E 1 20 GLN 20 77 77 GLN GLN E . n E 1 21 ARG 21 78 78 ARG ARG E . n E 1 22 HIS 22 79 79 HIS HIS E . n E 1 23 ASP 23 80 80 ASP ASP E . n E 1 24 GLY 24 81 81 GLY GLY E . n E 1 25 ALA 25 82 82 ALA ALA E . n E 1 26 PHE 26 83 83 PHE PHE E . n E 1 27 LEU 27 84 84 LEU LEU E . n E 1 28 ILE 28 85 85 ILE ILE E . n E 1 29 ARG 29 86 86 ARG ARG E . n E 1 30 GLU 30 87 87 GLU GLU E . n E 1 31 SER 31 88 88 SER SER E . n E 1 32 GLU 32 89 89 GLU GLU E . n E 1 33 SER 33 90 90 SER SER E . n E 1 34 ALA 34 91 91 ALA ALA E . n E 1 35 PRO 35 92 92 PRO PRO E . n E 1 36 GLY 36 93 93 GLY GLY E . n E 1 37 ASP 37 94 94 ASP ASP E . n E 1 38 PHE 38 95 95 PHE PHE E . n E 1 39 SER 39 96 96 SER SER E . n E 1 40 LEU 40 97 97 LEU LEU E . n E 1 41 SER 41 98 98 SER SER E . n E 1 42 VAL 42 99 99 VAL VAL E . n E 1 43 LYS 43 100 100 LYS LYS E . n E 1 44 PHE 44 101 101 PHE PHE E . n E 1 45 GLY 45 102 102 GLY GLY E . n E 1 46 ASN 46 103 103 ASN ASN E . n E 1 47 ASP 47 104 104 ASP ASP E . n E 1 48 VAL 48 105 105 VAL VAL E . n E 1 49 GLN 49 106 106 GLN GLN E . n E 1 50 HIS 50 107 107 HIS HIS E . n E 1 51 PHE 51 108 108 PHE PHE E . n E 1 52 LYS 52 109 109 LYS LYS E . n E 1 53 VAL 53 110 110 VAL VAL E . n E 1 54 LEU 54 111 111 LEU LEU E . n E 1 55 ARG 55 112 112 ARG ARG E . n E 1 56 ASP 56 113 113 ASP ASP E . n E 1 57 GLY 57 114 114 GLY GLY E . n E 1 58 ALA 58 115 115 ALA ALA E . n E 1 59 GLY 59 116 116 GLY GLY E . n E 1 60 LYS 60 117 117 LYS LYS E . n E 1 61 TYR 61 118 118 TYR TYR E . n E 1 62 PHE 62 119 119 PHE PHE E . n E 1 63 LEU 63 120 120 LEU LEU E . n E 1 64 TRP 64 121 121 TRP TRP E . n E 1 65 VAL 65 122 122 VAL VAL E . n E 1 66 VAL 66 123 123 VAL VAL E . n E 1 67 LYS 67 124 124 LYS LYS E . n E 1 68 PHE 68 125 125 PHE PHE E . n E 1 69 ASN 69 126 126 ASN ASN E . n E 1 70 SER 70 127 127 SER SER E . n E 1 71 LEU 71 128 128 LEU LEU E . n E 1 72 ASN 72 129 129 ASN ASN E . n E 1 73 GLU 73 130 130 GLU GLU E . n E 1 74 LEU 74 131 131 LEU LEU E . n E 1 75 VAL 75 132 132 VAL VAL E . n E 1 76 ASP 76 133 133 ASP ASP E . n E 1 77 TYR 77 134 134 TYR TYR E . n E 1 78 HIS 78 135 135 HIS HIS E . n E 1 79 ARG 79 136 136 ARG ARG E . n E 1 80 SER 80 137 137 SER SER E . n E 1 81 THR 81 138 138 THR THR E . n E 1 82 SER 82 139 139 SER SER E . n E 1 83 VAL 83 140 140 VAL VAL E . n E 1 84 SER 84 141 141 SER SER E . n E 1 85 ARG 85 142 142 ARG ARG E . n E 1 86 ASN 86 143 143 ASN ASN E . n E 1 87 GLN 87 144 144 GLN GLN E . n E 1 88 GLN 88 145 145 GLN GLN E . n E 1 89 ILE 89 146 146 ILE ILE E . n E 1 90 PHE 90 147 147 PHE PHE E . n E 1 91 LEU 91 148 148 LEU LEU E . n E 1 92 ARG 92 149 149 ARG ARG E . n E 1 93 ASP 93 150 150 ASP ASP E . n E 1 94 ILE 94 151 151 ILE ILE E . n E 1 95 GLU 95 152 152 GLU GLU E . n F 1 1 GLY 1 58 ? ? ? F . n F 1 2 PRO 2 59 59 PRO PRO F . n F 1 3 TRP 3 60 60 TRP TRP F . n F 1 4 PHE 4 61 61 PHE PHE F . n F 1 5 PHE 5 62 62 PHE PHE F . n F 1 6 GLY 6 63 63 GLY GLY F . n F 1 7 LYS 7 64 64 LYS LYS F . n F 1 8 ILE 8 65 65 ILE ILE F . n F 1 9 PRO 9 66 66 PRO PRO F . n F 1 10 ARG 10 67 67 ARG ARG F . n F 1 11 ALA 11 68 68 ALA ALA F . n F 1 12 LYS 12 69 69 LYS LYS F . n F 1 13 ALA 13 70 70 ALA ALA F . n F 1 14 GLU 14 71 71 GLU GLU F . n F 1 15 GLU 15 72 72 GLU GLU F . n F 1 16 MET 16 73 73 MET MET F . n F 1 17 LEU 17 74 74 LEU LEU F . n F 1 18 SER 18 75 75 SER SER F . n F 1 19 LYS 19 76 76 LYS LYS F . n F 1 20 GLN 20 77 77 GLN GLN F . n F 1 21 ARG 21 78 78 ARG ARG F . n F 1 22 HIS 22 79 79 HIS HIS F . n F 1 23 ASP 23 80 80 ASP ASP F . n F 1 24 GLY 24 81 81 GLY GLY F . n F 1 25 ALA 25 82 82 ALA ALA F . n F 1 26 PHE 26 83 83 PHE PHE F . n F 1 27 LEU 27 84 84 LEU LEU F . n F 1 28 ILE 28 85 85 ILE ILE F . n F 1 29 ARG 29 86 86 ARG ARG F . n F 1 30 GLU 30 87 87 GLU GLU F . n F 1 31 SER 31 88 88 SER SER F . n F 1 32 GLU 32 89 89 GLU GLU F . n F 1 33 SER 33 90 90 SER SER F . n F 1 34 ALA 34 91 91 ALA ALA F . n F 1 35 PRO 35 92 92 PRO PRO F . n F 1 36 GLY 36 93 93 GLY GLY F . n F 1 37 ASP 37 94 94 ASP ASP F . n F 1 38 PHE 38 95 95 PHE PHE F . n F 1 39 SER 39 96 96 SER SER F . n F 1 40 LEU 40 97 97 LEU LEU F . n F 1 41 SER 41 98 98 SER SER F . n F 1 42 VAL 42 99 99 VAL VAL F . n F 1 43 LYS 43 100 100 LYS LYS F . n F 1 44 PHE 44 101 101 PHE PHE F . n F 1 45 GLY 45 102 102 GLY GLY F . n F 1 46 ASN 46 103 103 ASN ASN F . n F 1 47 ASP 47 104 104 ASP ASP F . n F 1 48 VAL 48 105 105 VAL VAL F . n F 1 49 GLN 49 106 106 GLN GLN F . n F 1 50 HIS 50 107 107 HIS HIS F . n F 1 51 PHE 51 108 108 PHE PHE F . n F 1 52 LYS 52 109 109 LYS LYS F . n F 1 53 VAL 53 110 110 VAL VAL F . n F 1 54 LEU 54 111 111 LEU LEU F . n F 1 55 ARG 55 112 112 ARG ARG F . n F 1 56 ASP 56 113 113 ASP ASP F . n F 1 57 GLY 57 114 114 GLY GLY F . n F 1 58 ALA 58 115 115 ALA ALA F . n F 1 59 GLY 59 116 116 GLY GLY F . n F 1 60 LYS 60 117 117 LYS LYS F . n F 1 61 TYR 61 118 118 TYR TYR F . n F 1 62 PHE 62 119 119 PHE PHE F . n F 1 63 LEU 63 120 120 LEU LEU F . n F 1 64 TRP 64 121 121 TRP TRP F . n F 1 65 VAL 65 122 122 VAL VAL F . n F 1 66 VAL 66 123 123 VAL VAL F . n F 1 67 LYS 67 124 124 LYS LYS F . n F 1 68 PHE 68 125 125 PHE PHE F . n F 1 69 ASN 69 126 126 ASN ASN F . n F 1 70 SER 70 127 127 SER SER F . n F 1 71 LEU 71 128 128 LEU LEU F . n F 1 72 ASN 72 129 129 ASN ASN F . n F 1 73 GLU 73 130 130 GLU GLU F . n F 1 74 LEU 74 131 131 LEU LEU F . n F 1 75 VAL 75 132 132 VAL VAL F . n F 1 76 ASP 76 133 133 ASP ASP F . n F 1 77 TYR 77 134 134 TYR TYR F . n F 1 78 HIS 78 135 135 HIS HIS F . n F 1 79 ARG 79 136 136 ARG ARG F . n F 1 80 SER 80 137 137 SER SER F . n F 1 81 THR 81 138 138 THR THR F . n F 1 82 SER 82 139 139 SER SER F . n F 1 83 VAL 83 140 140 VAL VAL F . n F 1 84 SER 84 141 141 SER SER F . n F 1 85 ARG 85 142 142 ARG ARG F . n F 1 86 ASN 86 143 143 ASN ASN F . n F 1 87 GLN 87 144 144 GLN GLN F . n F 1 88 GLN 88 145 145 GLN GLN F . n F 1 89 ILE 89 146 146 ILE ILE F . n F 1 90 PHE 90 147 147 PHE PHE F . n F 1 91 LEU 91 148 148 LEU LEU F . n F 1 92 ARG 92 149 149 ARG ARG F . n F 1 93 ASP 93 150 150 ASP ASP F . n F 1 94 ILE 94 151 151 ILE ILE F . n F 1 95 GLU 95 152 152 GLU GLU F . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 2 ZLY 1 201 6 ZLY LIG A . H 3 EDO 1 202 3 EDO EDO A . I 4 SO4 1 203 6 SO4 SO4 A . J 4 SO4 1 204 11 SO4 SO4 A . K 4 SO4 1 205 14 SO4 SO4 A . L 2 ZLY 1 201 5 ZLY LIG B . M 3 EDO 1 202 16 EDO EDO B . N 4 SO4 1 203 1 SO4 SO4 B . O 4 SO4 1 204 12 SO4 SO4 B . P 4 SO4 1 205 13 SO4 SO4 B . Q 4 SO4 1 206 16 SO4 SO4 B . R 2 ZLY 1 201 2 ZLY LIG C . S 3 EDO 1 202 2 EDO EDO C . T 3 EDO 1 203 8 EDO EDO C . U 3 EDO 1 204 11 EDO EDO C . V 3 EDO 1 205 14 EDO EDO C . W 3 EDO 1 206 15 EDO EDO C . X 4 SO4 1 207 15 SO4 SO4 C . Y 2 ZLY 1 201 3 ZLY LIG D . Z 4 SO4 1 202 5 SO4 SO4 D . AA 4 SO4 1 203 8 SO4 SO4 D . BA 4 SO4 1 204 10 SO4 SO4 D . CA 2 ZLY 1 201 4 ZLY LIG E . DA 3 EDO 1 202 12 EDO EDO E . EA 3 EDO 1 203 13 EDO EDO E . FA 2 ZLY 1 201 1 ZLY LIG F . GA 3 EDO 1 202 6 EDO EDO F . HA 3 EDO 1 203 7 EDO EDO F . IA 3 EDO 1 204 9 EDO EDO F . JA 3 EDO 1 205 10 EDO EDO F . KA 5 HOH 1 301 96 HOH HOH A . KA 5 HOH 2 302 139 HOH HOH A . KA 5 HOH 3 303 103 HOH HOH A . KA 5 HOH 4 304 76 HOH HOH A . KA 5 HOH 5 305 95 HOH HOH A . KA 5 HOH 6 306 74 HOH HOH A . KA 5 HOH 7 307 83 HOH HOH A . KA 5 HOH 8 308 90 HOH HOH A . KA 5 HOH 9 309 102 HOH HOH A . KA 5 HOH 10 310 82 HOH HOH A . KA 5 HOH 11 311 142 HOH HOH A . KA 5 HOH 12 312 121 HOH HOH A . KA 5 HOH 13 313 46 HOH HOH A . LA 5 HOH 1 301 23 HOH HOH B . LA 5 HOH 2 302 31 HOH HOH B . LA 5 HOH 3 303 21 HOH HOH B . LA 5 HOH 4 304 107 HOH HOH B . LA 5 HOH 5 305 62 HOH HOH B . LA 5 HOH 6 306 69 HOH HOH B . LA 5 HOH 7 307 32 HOH HOH B . LA 5 HOH 8 308 33 HOH HOH B . LA 5 HOH 9 309 18 HOH HOH B . LA 5 HOH 10 310 39 HOH HOH B . LA 5 HOH 11 311 128 HOH HOH B . LA 5 HOH 12 312 12 HOH HOH B . LA 5 HOH 13 313 59 HOH HOH B . LA 5 HOH 14 314 99 HOH HOH B . LA 5 HOH 15 315 47 HOH HOH B . LA 5 HOH 16 316 112 HOH HOH B . MA 5 HOH 1 301 57 HOH HOH C . MA 5 HOH 2 302 20 HOH HOH C . MA 5 HOH 3 303 127 HOH HOH C . MA 5 HOH 4 304 24 HOH HOH C . MA 5 HOH 5 305 11 HOH HOH C . MA 5 HOH 6 306 130 HOH HOH C . MA 5 HOH 7 307 52 HOH HOH C . MA 5 HOH 8 308 68 HOH HOH C . MA 5 HOH 9 309 64 HOH HOH C . MA 5 HOH 10 310 53 HOH HOH C . MA 5 HOH 11 311 43 HOH HOH C . MA 5 HOH 12 312 126 HOH HOH C . MA 5 HOH 13 313 94 HOH HOH C . MA 5 HOH 14 314 36 HOH HOH C . MA 5 HOH 15 315 80 HOH HOH C . MA 5 HOH 16 316 84 HOH HOH C . MA 5 HOH 17 317 54 HOH HOH C . MA 5 HOH 18 318 61 HOH HOH C . MA 5 HOH 19 319 115 HOH HOH C . MA 5 HOH 20 320 51 HOH HOH C . MA 5 HOH 21 321 85 HOH HOH C . MA 5 HOH 22 322 124 HOH HOH C . NA 5 HOH 1 301 66 HOH HOH D . NA 5 HOH 2 302 65 HOH HOH D . NA 5 HOH 3 303 123 HOH HOH D . NA 5 HOH 4 304 37 HOH HOH D . NA 5 HOH 5 305 67 HOH HOH D . NA 5 HOH 6 306 119 HOH HOH D . NA 5 HOH 7 307 131 HOH HOH D . NA 5 HOH 8 308 92 HOH HOH D . NA 5 HOH 9 309 17 HOH HOH D . NA 5 HOH 10 310 101 HOH HOH D . NA 5 HOH 11 311 89 HOH HOH D . NA 5 HOH 12 312 140 HOH HOH D . NA 5 HOH 13 313 105 HOH HOH D . NA 5 HOH 14 314 134 HOH HOH D . NA 5 HOH 15 315 87 HOH HOH D . NA 5 HOH 16 316 91 HOH HOH D . NA 5 HOH 17 317 113 HOH HOH D . NA 5 HOH 18 318 63 HOH HOH D . NA 5 HOH 19 319 40 HOH HOH D . NA 5 HOH 20 320 88 HOH HOH D . NA 5 HOH 21 321 77 HOH HOH D . NA 5 HOH 22 322 133 HOH HOH D . NA 5 HOH 23 323 136 HOH HOH D . OA 5 HOH 1 301 135 HOH HOH E . OA 5 HOH 2 302 25 HOH HOH E . OA 5 HOH 3 303 71 HOH HOH E . OA 5 HOH 4 304 108 HOH HOH E . OA 5 HOH 5 305 118 HOH HOH E . OA 5 HOH 6 306 29 HOH HOH E . OA 5 HOH 7 307 117 HOH HOH E . OA 5 HOH 8 308 79 HOH HOH E . OA 5 HOH 9 309 97 HOH HOH E . OA 5 HOH 10 310 110 HOH HOH E . OA 5 HOH 11 311 122 HOH HOH E . OA 5 HOH 12 312 143 HOH HOH E . PA 5 HOH 1 301 104 HOH HOH F . PA 5 HOH 2 302 109 HOH HOH F . PA 5 HOH 3 303 93 HOH HOH F . PA 5 HOH 4 304 22 HOH HOH F . PA 5 HOH 5 305 27 HOH HOH F . PA 5 HOH 6 306 70 HOH HOH F . PA 5 HOH 7 307 73 HOH HOH F . PA 5 HOH 8 308 41 HOH HOH F . PA 5 HOH 9 309 106 HOH HOH F . PA 5 HOH 10 310 72 HOH HOH F . PA 5 HOH 11 311 137 HOH HOH F . PA 5 HOH 12 312 15 HOH HOH F . PA 5 HOH 13 313 7 HOH HOH F . PA 5 HOH 14 314 138 HOH HOH F . PA 5 HOH 15 315 129 HOH HOH F . PA 5 HOH 16 316 111 HOH HOH F . PA 5 HOH 17 317 141 HOH HOH F . PA 5 HOH 18 318 98 HOH HOH F . PA 5 HOH 19 319 132 HOH HOH F . PA 5 HOH 20 320 14 HOH HOH F . PA 5 HOH 21 321 26 HOH HOH F . PA 5 HOH 22 322 3 HOH HOH F . PA 5 HOH 23 323 48 HOH HOH F . PA 5 HOH 24 324 78 HOH HOH F . PA 5 HOH 25 325 116 HOH HOH F . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 software_defined_assembly PISA trimeric 3 2 software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,G,H,I,J,K,KA 1 2 F,FA,GA,HA,IA,JA,PA 1 4 E,CA,DA,EA,OA 2 1 C,D,R,S,T,U,V,W,X,Y,Z,AA,BA,MA,NA 2 3 B,L,M,N,O,P,Q,LA # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6600 ? 1 MORE -69 ? 1 'SSA (A^2)' 13970 ? 2 'ABSA (A^2)' 7020 ? 2 MORE -111 ? 2 'SSA (A^2)' 14110 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 1_545 x,y-1,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -87.1020000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 1_455 x-1,y,z 1.0000000000 0.0000000000 0.0000000000 -61.8850000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 3_645 -x+1,y-1/2,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 61.8850000000 0.0000000000 1.0000000000 0.0000000000 -43.5510000000 0.0000000000 0.0000000000 -1.0000000000 68.2065000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-22 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 7.7270 13.5557 31.8412 0.9083 ? 0.3064 ? 0.1767 ? 1.0031 ? -0.0272 ? 0.5458 ? 7.8229 ? 1.4789 ? -2.6498 ? 8.3047 ? -1.8823 ? 5.6400 ? 0.1898 ? 0.4906 ? 0.4686 ? 1.0463 ? 0.2408 ? 1.0533 ? -1.4345 ? -1.7262 ? -0.4059 ? 2 'X-RAY DIFFRACTION' ? refined 4.4391 25.7307 30.3674 2.0500 ? 0.6490 ? 0.5653 ? 1.0159 ? -0.3085 ? 1.0569 ? 7.7037 ? -0.3573 ? 0.3818 ? 0.0157 ? -0.0234 ? 0.0167 ? -0.3153 ? -2.0757 ? 1.8770 ? 0.6993 ? -0.1099 ? 1.2377 ? -0.5895 ? -1.2416 ? 0.3381 ? 3 'X-RAY DIFFRACTION' ? refined 15.5264 15.0767 21.8936 0.7292 ? 0.0431 ? 0.0516 ? 0.3676 ? -0.0282 ? 0.3742 ? 4.6853 ? -0.5960 ? -0.6769 ? 5.6150 ? 0.0471 ? 6.6470 ? 0.1319 ? -0.0213 ? 0.2166 ? 0.3925 ? 0.1497 ? 0.1740 ? -0.7429 ? -0.0208 ? -0.2794 ? 4 'X-RAY DIFFRACTION' ? refined 11.5835 25.9469 18.4371 1.2147 ? 0.0824 ? -0.0648 ? 0.6072 ? -0.0505 ? 0.6314 ? 4.5041 ? -1.2711 ? 5.1803 ? 3.1271 ? -2.9420 ? 7.1761 ? -0.4804 ? -0.8845 ? 1.5531 ? 0.2363 ? -0.3031 ? -0.1772 ? -3.0122 ? -1.0344 ? 0.7289 ? 5 'X-RAY DIFFRACTION' ? refined 33.5170 43.1935 18.6046 0.7311 ? -0.1021 ? -0.0362 ? 0.6664 ? 0.0052 ? 0.3814 ? 7.8376 ? -3.3550 ? 7.0600 ? 8.3443 ? -5.6213 ? 7.5571 ? -0.3480 ? -0.8106 ? -0.2034 ? -0.1926 ? 0.7412 ? 0.4792 ? -1.2641 ? 0.1708 ? -0.3707 ? 6 'X-RAY DIFFRACTION' ? refined 24.7751 35.5467 16.3843 0.9187 ? -0.3652 ? 0.0505 ? 0.9520 ? -0.0569 ? 0.7895 ? 8.1882 ? -5.4244 ? 0.5369 ? 6.7323 ? 0.2529 ? 6.8501 ? -0.2048 ? -0.3638 ? -1.0375 ? 0.3776 ? -0.1788 ? 1.0404 ? 1.2635 ? -1.4160 ? 0.4168 ? 7 'X-RAY DIFFRACTION' ? refined 38.0136 42.6473 12.2481 0.5961 ? -0.0796 ? -0.0863 ? 0.5935 ? 0.0203 ? 0.4727 ? 6.2628 ? -4.2326 ? -5.2122 ? 5.6835 ? 4.2667 ? 8.5228 ? 0.1096 ? 0.3709 ? -0.9904 ? -0.4570 ? 0.1777 ? 0.2420 ? -0.1613 ? 0.2195 ? -0.2939 ? 8 'X-RAY DIFFRACTION' ? refined 26.8583 39.0294 8.1096 0.4760 ? -0.2205 ? 0.0417 ? 0.9345 ? 0.0243 ? 0.4999 ? 8.8386 ? 0.5409 ? -2.3624 ? 7.3884 ? -2.7746 ? 4.4692 ? -0.4787 ? -1.3737 ? -0.7086 ? 0.1018 ? 0.2212 ? 0.6627 ? 0.8833 ? -0.8762 ? 0.1821 ? 9 'X-RAY DIFFRACTION' ? refined 35.1189 52.4474 2.8335 0.4608 ? -0.0476 ? -0.0040 ? 0.5505 ? -0.0153 ? 0.3249 ? 9.5909 ? -0.1398 ? -0.2411 ? 3.9740 ? -0.3722 ? 2.9759 ? -0.0807 ? -0.5608 ? 0.0522 ? 0.1507 ? 0.0289 ? 0.0544 ? -0.1353 ? -0.5713 ? 0.0916 ? 10 'X-RAY DIFFRACTION' ? refined 26.5356 53.5444 9.4873 0.4800 ? 0.0938 ? 0.0465 ? 0.8316 ? -0.0873 ? 0.6124 ? 9.6194 ? 6.3619 ? 3.7138 ? 4.3304 ? 2.8037 ? 6.3286 ? 0.2669 ? -0.8413 ? 2.0224 ? 0.4362 ? -0.3650 ? 1.3839 ? -1.0696 ? -0.6177 ? 0.0855 ? 11 'X-RAY DIFFRACTION' ? refined 20.4544 45.4791 6.1611 0.4304 ? -0.0932 ? -0.1174 ? 1.1068 ? -0.0083 ? 0.7004 ? 9.7034 ? -0.0311 ? -1.7833 ? 9.4753 ? 0.9507 ? 5.4560 ? 0.3107 ? 0.1516 ? 0.4551 ? -0.0665 ? -0.6911 ? 0.8010 ? 0.9332 ? -1.3195 ? 0.2627 ? 12 'X-RAY DIFFRACTION' ? refined -5.0248 44.8844 11.6355 0.7036 ? -0.0473 ? -0.1110 ? 0.4332 ? 0.0009 ? 0.4955 ? 2.4535 ? 0.3928 ? 1.7301 ? 8.4124 ? 7.4089 ? 7.5737 ? -0.0835 ? -0.1357 ? -0.2174 ? 0.0077 ? -0.3216 ? 0.1159 ? 0.5395 ? -0.7613 ? 0.2685 ? 13 'X-RAY DIFFRACTION' ? refined 4.2809 43.8762 2.2042 0.7045 ? -0.0233 ? -0.0035 ? 0.7231 ? 0.0040 ? 0.5548 ? 9.2276 ? -4.0133 ? -4.9886 ? 3.2133 ? 3.3905 ? 3.7616 ? 0.2141 ? 0.5336 ? 0.4380 ? -0.5901 ? 0.5283 ? -1.5672 ? -0.1501 ? 0.9474 ? -0.8797 ? 14 'X-RAY DIFFRACTION' ? refined 5.6298 32.3645 5.8418 0.6394 ? 0.1785 ? -0.1155 ? 0.7936 ? 0.0943 ? 0.8008 ? 4.9006 ? 5.3423 ? 3.9540 ? 8.9963 ? 0.3990 ? 8.2603 ? -0.3331 ? -0.3294 ? -1.4208 ? 0.4967 ? -0.3721 ? -2.1710 ? 0.8933 ? 1.2796 ? 0.5893 ? 15 'X-RAY DIFFRACTION' ? refined -10.1624 44.7727 1.8629 0.4768 ? -0.0626 ? -0.0691 ? 0.3124 ? 0.0061 ? 0.4085 ? 6.8814 ? -3.6454 ? -1.6014 ? 5.6905 ? 6.4775 ? 9.3284 ? 0.0568 ? -0.3486 ? 0.3818 ? -0.1810 ? 0.1091 ? 0.1154 ? -0.4772 ? -0.3316 ? 0.0264 ? 16 'X-RAY DIFFRACTION' ? refined -10.8724 34.1227 -1.5853 0.6142 ? 0.0383 ? -0.0368 ? 0.3953 ? -0.0323 ? 0.4106 ? 6.1408 ? 1.2202 ? 0.9841 ? 1.9672 ? -0.0343 ? 3.0415 ? -0.2828 ? -0.1831 ? -0.3656 ? -0.0525 ? 0.1928 ? -0.2300 ? 0.5345 ? -0.0209 ? 0.0920 ? 17 'X-RAY DIFFRACTION' ? refined -11.9444 29.7571 6.4300 0.8898 ? 0.0227 ? -0.0666 ? 0.5161 ? 0.0664 ? 0.5158 ? 2.5834 ? -3.6702 ? 1.1913 ? 6.2950 ? -4.2366 ? 7.1228 ? 0.0744 ? -0.7971 ? -1.2440 ? 0.7182 ? 0.1145 ? 0.3350 ? 0.9649 ? -0.6029 ? -0.2372 ? 18 'X-RAY DIFFRACTION' ? refined -3.6218 24.5714 -1.9182 0.9365 ? 0.0729 ? -0.1237 ? 0.6918 ? -0.1283 ? 0.7330 ? 5.7976 ? 1.2671 ? 4.2989 ? 1.6918 ? 1.4827 ? 3.5266 ? -0.2993 ? 1.5506 ? -2.8020 ? -0.5361 ? 0.6833 ? -0.0688 ? 2.8374 ? 0.9524 ? -0.2939 ? 19 'X-RAY DIFFRACTION' ? refined -0.0739 31.0075 8.8421 1.1998 ? 0.1761 ? -0.3093 ? 0.5677 ? 0.0964 ? 0.7199 ? 4.6988 ? -0.4746 ? -0.4568 ? 1.8388 ? 3.6055 ? 7.5845 ? -0.2882 ? -0.7774 ? -0.3770 ? 2.4510 ? 0.2558 ? -1.4896 ? 1.0692 ? 1.0305 ? -0.1461 ? 20 'X-RAY DIFFRACTION' ? refined 0.7272 48.1548 13.9025 0.6091 ? -0.0076 ? -0.0997 ? 0.4345 ? 0.0717 ? 0.4815 ? 7.4112 ? 1.3016 ? 3.3321 ? 3.7541 ? 2.9930 ? 3.1686 ? 0.6983 ? -0.2321 ? -0.7665 ? 0.6474 ? 0.0142 ? -0.1937 ? 0.4941 ? 0.1081 ? -0.6729 ? 21 'X-RAY DIFFRACTION' ? refined -11.7366 52.0185 20.3339 0.5996 ? -0.1213 ? 0.0177 ? 0.4572 ? -0.0002 ? 0.4128 ? 3.7496 ? -0.4989 ? 0.4678 ? 1.3797 ? 0.3456 ? 3.3887 ? 0.1701 ? -0.4815 ? -0.4912 ? 0.1957 ? -0.0496 ? 0.1084 ? 0.3998 ? -0.4121 ? -0.1193 ? 22 'X-RAY DIFFRACTION' ? refined -7.1435 60.5887 15.5217 0.4344 ? -0.0377 ? 0.0674 ? 0.4163 ? -0.0443 ? 0.3791 ? 8.5172 ? -0.9875 ? -1.6039 ? 8.4115 ? 0.0588 ? 6.2588 ? 0.1634 ? -0.4774 ? 0.8047 ? 0.0728 ? 0.1138 ? -0.0787 ? -0.6977 ? 0.2767 ? -0.2846 ? 23 'X-RAY DIFFRACTION' ? refined 43.4884 33.0788 44.2112 0.6039 ? 0.2619 ? -0.0058 ? 0.4216 ? 0.0311 ? 0.6232 ? 9.0827 ? 5.7650 ? -0.6405 ? 8.7744 ? 0.1850 ? 7.7324 ? 0.9840 ? -0.3445 ? -1.9504 ? -1.1378 ? -0.2073 ? 0.5683 ? -0.1388 ? 0.6919 ? -0.6547 ? 24 'X-RAY DIFFRACTION' ? refined 40.5742 24.2841 36.6360 2.5952 ? 0.4632 ? -0.5159 ? 0.0780 ? 0.1453 ? 0.6991 ? 8.8200 ? -2.7448 ? -3.4698 ? 8.2333 ? -1.9740 ? 2.6168 ? 0.2999 ? -0.1446 ? -1.4376 ? 0.1889 ? 0.0200 ? 1.0965 ? 1.1017 ? 0.4306 ? -0.1555 ? 25 'X-RAY DIFFRACTION' ? refined 30.0872 26.6820 38.7569 1.4184 ? -0.4000 ? -0.3263 ? 0.8984 ? 0.0760 ? 1.1004 ? 3.9177 ? 2.4493 ? -5.9468 ? 9.4734 ? -5.6924 ? 9.9662 ? -0.9525 ? 0.6727 ? -1.8157 ? -1.1045 ? -0.0350 ? 0.4260 ? 0.4637 ? -2.3562 ? 0.8536 ? 26 'X-RAY DIFFRACTION' ? refined 44.6462 38.9360 34.7567 0.8674 ? -0.0055 ? 0.1146 ? 0.7723 ? 0.1259 ? 0.7962 ? 9.0703 ? -1.2572 ? 3.2167 ? 3.7469 ? 2.6048 ? 3.8844 ? 0.3100 ? 0.9859 ? 0.2791 ? -1.2148 ? 0.5093 ? -1.1239 ? 0.7628 ? 1.2141 ? -0.8080 ? 27 'X-RAY DIFFRACTION' ? refined 34.3717 34.2514 31.8347 1.5368 ? -0.4273 ? -0.4437 ? 0.6538 ? 0.1144 ? 0.8134 ? 7.4368 ? 5.6757 ? 1.6574 ? 5.9700 ? 2.7178 ? 1.5332 ? 0.5970 ? -0.0617 ? -1.2776 ? -1.9731 ? 0.0264 ? 0.2995 ? 2.0884 ? -1.0073 ? -0.3883 ? 28 'X-RAY DIFFRACTION' ? refined 35.2828 50.6978 34.5886 0.6752 ? -0.0178 ? -0.0707 ? 0.5249 ? 0.1330 ? 0.4646 ? 7.0049 ? -5.3109 ? -0.3793 ? 4.5806 ? 0.7817 ? 6.8751 ? 0.3116 ? 0.2144 ? 0.2804 ? -0.8502 ? 0.2694 ? 0.4097 ? -0.6498 ? -1.1887 ? -0.5613 ? 29 'X-RAY DIFFRACTION' ? refined 30.7380 44.0084 41.6622 0.6301 ? -0.0679 ? 0.0335 ? 0.7323 ? 0.3399 ? 0.8718 ? 8.4960 ? 5.9128 ? 3.4616 ? 5.0640 ? 4.8063 ? 7.5600 ? 0.3148 ? -1.6956 ? -0.1453 ? 1.4165 ? 0.4449 ? 2.1225 ? 0.8720 ? -1.4352 ? -0.7000 ? 30 'X-RAY DIFFRACTION' ? refined 26.0196 36.0868 36.9339 0.5799 ? -0.2289 ? -0.2212 ? 0.7234 ? 0.2015 ? 1.2297 ? 5.8726 ? -4.3705 ? 0.5058 ? 7.3039 ? -2.4591 ? 6.3885 ? 0.7899 ? -0.3866 ? -2.3469 ? 0.0101 ? 0.1095 ? 2.4933 ? 1.2071 ? -1.1197 ? -0.7653 ? 31 'X-RAY DIFFRACTION' ? refined 19.8690 77.2058 25.1896 0.7645 ? 0.0191 ? -0.0238 ? 0.4809 ? -0.1668 ? 0.5960 ? 7.0088 ? 1.7989 ? 2.2267 ? 7.4520 ? -4.2314 ? 4.0074 ? 0.2961 ? 0.0243 ? -0.3270 ? 1.9589 ? -0.0373 ? -0.3067 ? -1.2095 ? -0.7642 ? -0.2844 ? 32 'X-RAY DIFFRACTION' ? refined 19.8372 67.3793 16.4056 0.7197 ? 0.0257 ? -0.0162 ? 0.5584 ? -0.1079 ? 0.7056 ? 5.3016 ? 2.2530 ? 2.1259 ? 3.7567 ? -2.3887 ? 4.7369 ? 1.0287 ? 0.6338 ? -1.1083 ? -0.1959 ? 0.7371 ? -0.4921 ? 1.0939 ? 0.5818 ? -1.5062 ? 33 'X-RAY DIFFRACTION' ? refined 12.4121 71.4966 18.9790 0.3792 ? -0.0561 ? 0.0159 ? 0.3401 ? 0.0170 ? 0.3078 ? 9.0122 ? 5.1457 ? -4.5184 ? 8.0830 ? -4.0336 ? 8.0874 ? 0.2942 ? 0.5447 ? 0.1050 ? 0.9291 ? -0.1296 ? -0.3169 ? -0.4700 ? -0.0515 ? -0.1186 ? 34 'X-RAY DIFFRACTION' ? refined 15.5237 79.5409 14.1468 0.4377 ? 0.0000 ? 0.0596 ? 0.4073 ? -0.0048 ? 0.5406 ? 1.5910 ? 2.0416 ? 2.2948 ? 7.9521 ? 3.5328 ? 8.0898 ? -0.4319 ? 0.4222 ? -0.1555 ? -0.6559 ? 0.4405 ? -1.2737 ? -0.9857 ? 0.8130 ? 0.0455 ? 35 'X-RAY DIFFRACTION' ? refined 5.3424 81.7158 14.6090 0.4934 ? -0.0764 ? 0.0482 ? 0.5007 ? -0.0211 ? 0.3704 ? 3.5370 ? -1.9556 ? -1.0872 ? 7.5080 ? 0.8612 ? 4.2536 ? 0.0539 ? -0.1231 ? 0.0985 ? 0.6420 ? -0.1198 ? 0.4862 ? -0.0972 ? -0.5016 ? 0.1057 ? 36 'X-RAY DIFFRACTION' ? refined 3.0171 70.4699 16.5853 0.5918 ? -0.1080 ? 0.0953 ? 0.5175 ? -0.0375 ? 0.5044 ? 9.0903 ? -0.8698 ? 5.0900 ? 9.9130 ? -3.6725 ? 3.9084 ? 0.3300 ? 0.1402 ? 0.2086 ? -0.0461 ? 0.0718 ? 0.4359 ? 0.7060 ? -0.0976 ? -0.4632 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 58 ? ? ? A 75 ? ? ;chain 'A' and (resid 58 through 75 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 76 ? ? ? A 82 ? ? ;chain 'A' and (resid 76 through 82 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 83 ? ? ? A 137 ? ? ;chain 'A' and (resid 83 through 137 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 138 ? ? ? A 148 ? ? ;chain 'A' and (resid 138 through 148 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 58 ? ? ? B 66 ? ? ;chain 'B' and (resid 58 through 66 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 67 ? ? ? B 82 ? ? ;chain 'B' and (resid 67 through 82 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 83 ? ? ? B 94 ? ? ;chain 'B' and (resid 83 through 94 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 95 ? ? ? B 109 ? ? ;chain 'B' and (resid 95 through 109 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 110 ? ? ? B 127 ? ? ;chain 'B' and (resid 110 through 127 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? B 128 ? ? ? B 137 ? ? ;chain 'B' and (resid 128 through 137 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? B 138 ? ? ? B 151 ? ? ;chain 'B' and (resid 138 through 151 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? C 58 ? ? ? C 66 ? ? ;chain 'C' and (resid 58 through 66 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? C 67 ? ? ? C 75 ? ? ;chain 'C' and (resid 67 through 75 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? C 76 ? ? ? C 82 ? ? ;chain 'C' and (resid 76 through 82 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? C 83 ? ? ? C 94 ? ? ;chain 'C' and (resid 83 through 94 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? C 95 ? ? ? C 127 ? ? ;chain 'C' and (resid 95 through 127 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? C 128 ? ? ? C 136 ? ? ;chain 'C' and (resid 128 through 136 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? C 137 ? ? ? C 146 ? ? ;chain 'C' and (resid 137 through 146 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? C 147 ? ? ? C 152 ? ? ;chain 'C' and (resid 147 through 152 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? D 58 ? ? ? D 82 ? ? ;chain 'D' and (resid 58 through 82 ) ; 21 'X-RAY DIFFRACTION' 21 ? ? D 83 ? ? ? D 127 ? ? ;chain 'D' and (resid 83 through 127 ) ; 22 'X-RAY DIFFRACTION' 22 ? ? D 128 ? ? ? D 152 ? ? ;chain 'D' and (resid 128 through 152 ) ; 23 'X-RAY DIFFRACTION' 23 ? ? E 58 ? ? ? E 67 ? ? ;chain 'E' and (resid 58 through 67 ) ; 24 'X-RAY DIFFRACTION' 24 ? ? E 68 ? ? ? E 73 ? ? ;chain 'E' and (resid 68 through 73 ) ; 25 'X-RAY DIFFRACTION' 25 ? ? E 74 ? ? ? E 82 ? ? ;chain 'E' and (resid 74 through 82 ) ; 26 'X-RAY DIFFRACTION' 26 ? ? E 83 ? ? ? E 94 ? ? ;chain 'E' and (resid 83 through 94 ) ; 27 'X-RAY DIFFRACTION' 27 ? ? E 95 ? ? ? E 110 ? ? ;chain 'E' and (resid 95 through 110 ) ; 28 'X-RAY DIFFRACTION' 28 ? ? E 111 ? ? ? E 127 ? ? ;chain 'E' and (resid 111 through 127 ) ; 29 'X-RAY DIFFRACTION' 29 ? ? E 128 ? ? ? E 136 ? ? ;chain 'E' and (resid 128 through 136 ) ; 30 'X-RAY DIFFRACTION' 30 ? ? E 137 ? ? ? E 152 ? ? ;chain 'E' and (resid 137 through 152 ) ; 31 'X-RAY DIFFRACTION' 31 ? ? F 59 ? ? ? F 66 ? ? ;chain 'F' and (resid 59 through 66 ) ; 32 'X-RAY DIFFRACTION' 32 ? ? F 67 ? ? ? F 76 ? ? ;chain 'F' and (resid 67 through 76 ) ; 33 'X-RAY DIFFRACTION' 33 ? ? F 77 ? ? ? F 87 ? ? ;chain 'F' and (resid 77 through 87 ) ; 34 'X-RAY DIFFRACTION' 34 ? ? F 88 ? ? ? F 101 ? ? ;chain 'F' and (resid 88 through 101 ) ; 35 'X-RAY DIFFRACTION' 35 ? ? F 102 ? ? ? F 137 ? ? ;chain 'F' and (resid 102 through 137 ) ; 36 'X-RAY DIFFRACTION' 36 ? ? F 138 ? ? ? F 152 ? ? ;chain 'F' and (resid 138 through 152 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2-3874_3874 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.1 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7MPH _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 64 ? ? -96.58 56.43 2 1 ARG A 67 ? ? -26.62 -51.78 3 1 SER A 75 ? ? -31.68 -27.25 4 1 TRP A 121 ? ? -129.64 -71.27 5 1 VAL A 122 ? ? -128.08 -51.18 6 1 ARG B 67 ? ? -28.40 -50.72 7 1 TRP B 121 ? ? -128.31 -73.33 8 1 VAL B 122 ? ? -126.66 -50.76 9 1 ASN B 143 ? ? -123.52 -82.23 10 1 TRP C 121 ? ? -128.52 -75.83 11 1 VAL C 122 ? ? -124.94 -50.44 12 1 ASN C 143 ? ? -124.49 -76.67 13 1 ARG D 67 ? ? -29.13 -53.14 14 1 PRO D 92 ? ? -54.05 39.76 15 1 TRP D 121 ? ? -126.33 -82.51 16 1 ASN D 143 ? ? -127.23 -53.09 17 1 PRO E 66 ? ? -64.38 31.32 18 1 ARG E 67 ? ? 68.36 -53.23 19 1 SER E 75 ? ? 73.09 -25.18 20 1 TRP E 121 ? ? -126.78 -80.51 21 1 VAL E 122 ? ? -123.45 -51.94 22 1 ASN E 143 ? ? -127.67 -82.89 23 1 ARG F 67 ? ? -26.93 -52.28 24 1 SER F 75 ? ? -37.34 -29.65 25 1 TRP F 121 ? ? -127.04 -78.62 26 1 VAL F 122 ? ? -123.84 -50.81 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 67 ? CG ? A ARG 10 CG 2 1 Y 1 A ARG 67 ? CD ? A ARG 10 CD 3 1 Y 1 A ARG 67 ? NE ? A ARG 10 NE 4 1 Y 1 A ARG 67 ? CZ ? A ARG 10 CZ 5 1 Y 1 A ARG 67 ? NH1 ? A ARG 10 NH1 6 1 Y 1 A ARG 67 ? NH2 ? A ARG 10 NH2 7 1 Y 1 A LYS 69 ? CG ? A LYS 12 CG 8 1 Y 1 A LYS 69 ? CD ? A LYS 12 CD 9 1 Y 1 A LYS 69 ? CE ? A LYS 12 CE 10 1 Y 1 A LYS 69 ? NZ ? A LYS 12 NZ 11 1 Y 1 A ARG 78 ? CG ? A ARG 21 CG 12 1 Y 1 A ARG 78 ? CD ? A ARG 21 CD 13 1 Y 1 A ARG 78 ? NE ? A ARG 21 NE 14 1 Y 1 A ARG 78 ? CZ ? A ARG 21 CZ 15 1 Y 1 A ARG 78 ? NH1 ? A ARG 21 NH1 16 1 Y 1 A ARG 78 ? NH2 ? A ARG 21 NH2 17 1 Y 1 A LYS 109 ? CG ? A LYS 52 CG 18 1 Y 1 A LYS 109 ? CD ? A LYS 52 CD 19 1 Y 1 A LYS 109 ? CE ? A LYS 52 CE 20 1 Y 1 A LYS 109 ? NZ ? A LYS 52 NZ 21 1 Y 1 A ARG 142 ? CG ? A ARG 85 CG 22 1 Y 1 A ARG 142 ? CD ? A ARG 85 CD 23 1 Y 1 A ARG 142 ? NE ? A ARG 85 NE 24 1 Y 1 A ARG 142 ? CZ ? A ARG 85 CZ 25 1 Y 1 A ARG 142 ? NH1 ? A ARG 85 NH1 26 1 Y 1 A ARG 142 ? NH2 ? A ARG 85 NH2 27 1 Y 1 B ARG 67 ? CG ? B ARG 10 CG 28 1 Y 1 B ARG 67 ? CD ? B ARG 10 CD 29 1 Y 1 B ARG 67 ? NE ? B ARG 10 NE 30 1 Y 1 B ARG 67 ? CZ ? B ARG 10 CZ 31 1 Y 1 B ARG 67 ? NH1 ? B ARG 10 NH1 32 1 Y 1 B ARG 67 ? NH2 ? B ARG 10 NH2 33 1 Y 1 B ARG 78 ? CG ? B ARG 21 CG 34 1 Y 1 B ARG 78 ? CD ? B ARG 21 CD 35 1 Y 1 B ARG 78 ? NE ? B ARG 21 NE 36 1 Y 1 B ARG 78 ? CZ ? B ARG 21 CZ 37 1 Y 1 B ARG 78 ? NH1 ? B ARG 21 NH1 38 1 Y 1 B ARG 78 ? NH2 ? B ARG 21 NH2 39 1 Y 1 B GLU 89 ? CG ? B GLU 32 CG 40 1 Y 1 B GLU 89 ? CD ? B GLU 32 CD 41 1 Y 1 B GLU 89 ? OE1 ? B GLU 32 OE1 42 1 Y 1 B GLU 89 ? OE2 ? B GLU 32 OE2 43 1 Y 1 B ASN 103 ? CG ? B ASN 46 CG 44 1 Y 1 B ASN 103 ? OD1 ? B ASN 46 OD1 45 1 Y 1 B ASN 103 ? ND2 ? B ASN 46 ND2 46 1 Y 1 B ARG 136 ? CG ? B ARG 79 CG 47 1 Y 1 B ARG 136 ? CD ? B ARG 79 CD 48 1 Y 1 B ARG 136 ? NE ? B ARG 79 NE 49 1 Y 1 B ARG 136 ? CZ ? B ARG 79 CZ 50 1 Y 1 B ARG 136 ? NH1 ? B ARG 79 NH1 51 1 Y 1 B ARG 136 ? NH2 ? B ARG 79 NH2 52 1 Y 1 C GLU 72 ? CG ? C GLU 15 CG 53 1 Y 1 C GLU 72 ? CD ? C GLU 15 CD 54 1 Y 1 C GLU 72 ? OE1 ? C GLU 15 OE1 55 1 Y 1 C GLU 72 ? OE2 ? C GLU 15 OE2 56 1 Y 1 C LYS 76 ? CG ? C LYS 19 CG 57 1 Y 1 C LYS 76 ? CD ? C LYS 19 CD 58 1 Y 1 C LYS 76 ? CE ? C LYS 19 CE 59 1 Y 1 C LYS 76 ? NZ ? C LYS 19 NZ 60 1 Y 1 C ARG 78 ? CG ? C ARG 21 CG 61 1 Y 1 C ARG 78 ? CD ? C ARG 21 CD 62 1 Y 1 C ARG 78 ? NE ? C ARG 21 NE 63 1 Y 1 C ARG 78 ? CZ ? C ARG 21 CZ 64 1 Y 1 C ARG 78 ? NH1 ? C ARG 21 NH1 65 1 Y 1 C ARG 78 ? NH2 ? C ARG 21 NH2 66 1 Y 1 C ARG 142 ? CG ? C ARG 85 CG 67 1 Y 1 C ARG 142 ? CD ? C ARG 85 CD 68 1 Y 1 C ARG 142 ? NE ? C ARG 85 NE 69 1 Y 1 C ARG 142 ? CZ ? C ARG 85 CZ 70 1 Y 1 C ARG 142 ? NH1 ? C ARG 85 NH1 71 1 Y 1 C ARG 142 ? NH2 ? C ARG 85 NH2 72 1 Y 1 C ASN 143 ? CG ? C ASN 86 CG 73 1 Y 1 C ASN 143 ? OD1 ? C ASN 86 OD1 74 1 Y 1 C ASN 143 ? ND2 ? C ASN 86 ND2 75 1 Y 1 D GLU 72 ? CG ? D GLU 15 CG 76 1 Y 1 D GLU 72 ? CD ? D GLU 15 CD 77 1 Y 1 D GLU 72 ? OE1 ? D GLU 15 OE1 78 1 Y 1 D GLU 72 ? OE2 ? D GLU 15 OE2 79 1 Y 1 D LYS 76 ? CG ? D LYS 19 CG 80 1 Y 1 D LYS 76 ? CD ? D LYS 19 CD 81 1 Y 1 D LYS 76 ? CE ? D LYS 19 CE 82 1 Y 1 D LYS 76 ? NZ ? D LYS 19 NZ 83 1 Y 1 D GLU 89 ? CG ? D GLU 32 CG 84 1 Y 1 D GLU 89 ? CD ? D GLU 32 CD 85 1 Y 1 D GLU 89 ? OE1 ? D GLU 32 OE1 86 1 Y 1 D GLU 89 ? OE2 ? D GLU 32 OE2 87 1 Y 1 D ASN 143 ? CG ? D ASN 86 CG 88 1 Y 1 D ASN 143 ? OD1 ? D ASN 86 OD1 89 1 Y 1 D ASN 143 ? ND2 ? D ASN 86 ND2 90 1 Y 1 E ARG 67 ? CG ? E ARG 10 CG 91 1 Y 1 E ARG 67 ? CD ? E ARG 10 CD 92 1 Y 1 E ARG 67 ? NE ? E ARG 10 NE 93 1 Y 1 E ARG 67 ? CZ ? E ARG 10 CZ 94 1 Y 1 E ARG 67 ? NH1 ? E ARG 10 NH1 95 1 Y 1 E ARG 67 ? NH2 ? E ARG 10 NH2 96 1 Y 1 E LYS 69 ? CG ? E LYS 12 CG 97 1 Y 1 E LYS 69 ? CD ? E LYS 12 CD 98 1 Y 1 E LYS 69 ? CE ? E LYS 12 CE 99 1 Y 1 E LYS 69 ? NZ ? E LYS 12 NZ 100 1 Y 1 E GLU 71 ? CG ? E GLU 14 CG 101 1 Y 1 E GLU 71 ? CD ? E GLU 14 CD 102 1 Y 1 E GLU 71 ? OE1 ? E GLU 14 OE1 103 1 Y 1 E GLU 71 ? OE2 ? E GLU 14 OE2 104 1 Y 1 E LYS 76 ? CG ? E LYS 19 CG 105 1 Y 1 E LYS 76 ? CD ? E LYS 19 CD 106 1 Y 1 E LYS 76 ? CE ? E LYS 19 CE 107 1 Y 1 E LYS 76 ? NZ ? E LYS 19 NZ 108 1 Y 1 E ARG 78 ? CG ? E ARG 21 CG 109 1 Y 1 E ARG 78 ? CD ? E ARG 21 CD 110 1 Y 1 E ARG 78 ? NE ? E ARG 21 NE 111 1 Y 1 E ARG 78 ? CZ ? E ARG 21 CZ 112 1 Y 1 E ARG 78 ? NH1 ? E ARG 21 NH1 113 1 Y 1 E ARG 78 ? NH2 ? E ARG 21 NH2 114 1 Y 1 E LYS 100 ? CG ? E LYS 43 CG 115 1 Y 1 E LYS 100 ? CD ? E LYS 43 CD 116 1 Y 1 E LYS 100 ? CE ? E LYS 43 CE 117 1 Y 1 E LYS 100 ? NZ ? E LYS 43 NZ 118 1 Y 1 E ARG 142 ? CG ? E ARG 85 CG 119 1 Y 1 E ARG 142 ? CD ? E ARG 85 CD 120 1 Y 1 E ARG 142 ? NE ? E ARG 85 NE 121 1 Y 1 E ARG 142 ? CZ ? E ARG 85 CZ 122 1 Y 1 E ARG 142 ? NH1 ? E ARG 85 NH1 123 1 Y 1 E ARG 142 ? NH2 ? E ARG 85 NH2 124 1 Y 1 E GLN 144 ? CG ? E GLN 87 CG 125 1 Y 1 E GLN 144 ? CD ? E GLN 87 CD 126 1 Y 1 E GLN 144 ? OE1 ? E GLN 87 OE1 127 1 Y 1 E GLN 144 ? NE2 ? E GLN 87 NE2 128 1 Y 1 E ARG 149 ? CG ? E ARG 92 CG 129 1 Y 1 E ARG 149 ? CD ? E ARG 92 CD 130 1 Y 1 E ARG 149 ? NE ? E ARG 92 NE 131 1 Y 1 E ARG 149 ? CZ ? E ARG 92 CZ 132 1 Y 1 E ARG 149 ? NH1 ? E ARG 92 NH1 133 1 Y 1 E ARG 149 ? NH2 ? E ARG 92 NH2 134 1 Y 1 F LYS 69 ? CG ? F LYS 12 CG 135 1 Y 1 F LYS 69 ? CD ? F LYS 12 CD 136 1 Y 1 F LYS 69 ? CE ? F LYS 12 CE 137 1 Y 1 F LYS 69 ? NZ ? F LYS 12 NZ 138 1 Y 1 F ARG 78 ? CG ? F ARG 21 CG 139 1 Y 1 F ARG 78 ? CD ? F ARG 21 CD 140 1 Y 1 F ARG 78 ? NE ? F ARG 21 NE 141 1 Y 1 F ARG 78 ? CZ ? F ARG 21 CZ 142 1 Y 1 F ARG 78 ? NH1 ? F ARG 21 NH1 143 1 Y 1 F ARG 78 ? NH2 ? F ARG 21 NH2 144 1 Y 1 F ASN 143 ? CG ? F ASN 86 CG 145 1 Y 1 F ASN 143 ? OD1 ? F ASN 86 OD1 146 1 Y 1 F ASN 143 ? ND2 ? F ASN 86 ND2 147 1 Y 1 F GLN 144 ? CG ? F GLN 87 CG 148 1 Y 1 F GLN 144 ? CD ? F GLN 87 CD 149 1 Y 1 F GLN 144 ? OE1 ? F GLN 87 OE1 150 1 Y 1 F GLN 144 ? NE2 ? F GLN 87 NE2 151 1 N 1 B ZLY 201 ? O48 ? L ZLY 1 O48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 148 ? A LEU 91 2 1 Y 1 A ARG 149 ? A ARG 92 3 1 Y 1 A ASP 150 ? A ASP 93 4 1 Y 1 A ILE 151 ? A ILE 94 5 1 Y 1 A GLU 152 ? A GLU 95 6 1 Y 1 B GLU 152 ? B GLU 95 7 1 Y 1 F GLY 58 ? F GLY 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 EDO C1 C N N 74 EDO O1 O N N 75 EDO C2 C N N 76 EDO O2 O N N 77 EDO H11 H N N 78 EDO H12 H N N 79 EDO HO1 H N N 80 EDO H21 H N N 81 EDO H22 H N N 82 EDO HO2 H N N 83 GLN N N N N 84 GLN CA C N S 85 GLN C C N N 86 GLN O O N N 87 GLN CB C N N 88 GLN CG C N N 89 GLN CD C N N 90 GLN OE1 O N N 91 GLN NE2 N N N 92 GLN OXT O N N 93 GLN H H N N 94 GLN H2 H N N 95 GLN HA H N N 96 GLN HB2 H N N 97 GLN HB3 H N N 98 GLN HG2 H N N 99 GLN HG3 H N N 100 GLN HE21 H N N 101 GLN HE22 H N N 102 GLN HXT H N N 103 GLU N N N N 104 GLU CA C N S 105 GLU C C N N 106 GLU O O N N 107 GLU CB C N N 108 GLU CG C N N 109 GLU CD C N N 110 GLU OE1 O N N 111 GLU OE2 O N N 112 GLU OXT O N N 113 GLU H H N N 114 GLU H2 H N N 115 GLU HA H N N 116 GLU HB2 H N N 117 GLU HB3 H N N 118 GLU HG2 H N N 119 GLU HG3 H N N 120 GLU HE2 H N N 121 GLU HXT H N N 122 GLY N N N N 123 GLY CA C N N 124 GLY C C N N 125 GLY O O N N 126 GLY OXT O N N 127 GLY H H N N 128 GLY H2 H N N 129 GLY HA2 H N N 130 GLY HA3 H N N 131 GLY HXT H N N 132 HIS N N N N 133 HIS CA C N S 134 HIS C C N N 135 HIS O O N N 136 HIS CB C N N 137 HIS CG C Y N 138 HIS ND1 N Y N 139 HIS CD2 C Y N 140 HIS CE1 C Y N 141 HIS NE2 N Y N 142 HIS OXT O N N 143 HIS H H N N 144 HIS H2 H N N 145 HIS HA H N N 146 HIS HB2 H N N 147 HIS HB3 H N N 148 HIS HD1 H N N 149 HIS HD2 H N N 150 HIS HE1 H N N 151 HIS HE2 H N N 152 HIS HXT H N N 153 HOH O O N N 154 HOH H1 H N N 155 HOH H2 H N N 156 ILE N N N N 157 ILE CA C N S 158 ILE C C N N 159 ILE O O N N 160 ILE CB C N S 161 ILE CG1 C N N 162 ILE CG2 C N N 163 ILE CD1 C N N 164 ILE OXT O N N 165 ILE H H N N 166 ILE H2 H N N 167 ILE HA H N N 168 ILE HB H N N 169 ILE HG12 H N N 170 ILE HG13 H N N 171 ILE HG21 H N N 172 ILE HG22 H N N 173 ILE HG23 H N N 174 ILE HD11 H N N 175 ILE HD12 H N N 176 ILE HD13 H N N 177 ILE HXT H N N 178 LEU N N N N 179 LEU CA C N S 180 LEU C C N N 181 LEU O O N N 182 LEU CB C N N 183 LEU CG C N N 184 LEU CD1 C N N 185 LEU CD2 C N N 186 LEU OXT O N N 187 LEU H H N N 188 LEU H2 H N N 189 LEU HA H N N 190 LEU HB2 H N N 191 LEU HB3 H N N 192 LEU HG H N N 193 LEU HD11 H N N 194 LEU HD12 H N N 195 LEU HD13 H N N 196 LEU HD21 H N N 197 LEU HD22 H N N 198 LEU HD23 H N N 199 LEU HXT H N N 200 LYS N N N N 201 LYS CA C N S 202 LYS C C N N 203 LYS O O N N 204 LYS CB C N N 205 LYS CG C N N 206 LYS CD C N N 207 LYS CE C N N 208 LYS NZ N N N 209 LYS OXT O N N 210 LYS H H N N 211 LYS H2 H N N 212 LYS HA H N N 213 LYS HB2 H N N 214 LYS HB3 H N N 215 LYS HG2 H N N 216 LYS HG3 H N N 217 LYS HD2 H N N 218 LYS HD3 H N N 219 LYS HE2 H N N 220 LYS HE3 H N N 221 LYS HZ1 H N N 222 LYS HZ2 H N N 223 LYS HZ3 H N N 224 LYS HXT H N N 225 MET N N N N 226 MET CA C N S 227 MET C C N N 228 MET O O N N 229 MET CB C N N 230 MET CG C N N 231 MET SD S N N 232 MET CE C N N 233 MET OXT O N N 234 MET H H N N 235 MET H2 H N N 236 MET HA H N N 237 MET HB2 H N N 238 MET HB3 H N N 239 MET HG2 H N N 240 MET HG3 H N N 241 MET HE1 H N N 242 MET HE2 H N N 243 MET HE3 H N N 244 MET HXT H N N 245 PHE N N N N 246 PHE CA C N S 247 PHE C C N N 248 PHE O O N N 249 PHE CB C N N 250 PHE CG C Y N 251 PHE CD1 C Y N 252 PHE CD2 C Y N 253 PHE CE1 C Y N 254 PHE CE2 C Y N 255 PHE CZ C Y N 256 PHE OXT O N N 257 PHE H H N N 258 PHE H2 H N N 259 PHE HA H N N 260 PHE HB2 H N N 261 PHE HB3 H N N 262 PHE HD1 H N N 263 PHE HD2 H N N 264 PHE HE1 H N N 265 PHE HE2 H N N 266 PHE HZ H N N 267 PHE HXT H N N 268 PRO N N N N 269 PRO CA C N S 270 PRO C C N N 271 PRO O O N N 272 PRO CB C N N 273 PRO CG C N N 274 PRO CD C N N 275 PRO OXT O N N 276 PRO H H N N 277 PRO HA H N N 278 PRO HB2 H N N 279 PRO HB3 H N N 280 PRO HG2 H N N 281 PRO HG3 H N N 282 PRO HD2 H N N 283 PRO HD3 H N N 284 PRO HXT H N N 285 SER N N N N 286 SER CA C N S 287 SER C C N N 288 SER O O N N 289 SER CB C N N 290 SER OG O N N 291 SER OXT O N N 292 SER H H N N 293 SER H2 H N N 294 SER HA H N N 295 SER HB2 H N N 296 SER HB3 H N N 297 SER HG H N N 298 SER HXT H N N 299 SO4 S S N N 300 SO4 O1 O N N 301 SO4 O2 O N N 302 SO4 O3 O N N 303 SO4 O4 O N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 ZLY C10 C Y N 392 ZLY C13 C Y N 393 ZLY C15 C Y N 394 ZLY C17 C N N 395 ZLY C20 C N R 396 ZLY C21 C Y N 397 ZLY C22 C Y N 398 ZLY C24 C Y N 399 ZLY C26 C N N 400 ZLY C02 C N N 401 ZLY C04 C N N 402 ZLY C05 C N S 403 ZLY C06 C N N 404 ZLY C07 C Y N 405 ZLY C08 C Y N 406 ZLY C09 C Y N 407 ZLY C11 C Y N 408 ZLY C12 C Y N 409 ZLY C14 C Y N 410 ZLY C16 C Y N 411 ZLY C18 C N N 412 ZLY C19 C N N 413 ZLY C23 C Y N 414 ZLY C25 C N N 415 ZLY C29 C Y N 416 ZLY C30 C Y N 417 ZLY C31 C N N 418 ZLY C32 C N N 419 ZLY C34 C N N 420 ZLY C35 C N N 421 ZLY C36 C N N 422 ZLY C37 C N N 423 ZLY C38 C N N 424 ZLY C39 C N N 425 ZLY C41 C N S 426 ZLY C42 C N N 427 ZLY C43 C N N 428 ZLY C47 C N N 429 ZLY N03 N N N 430 ZLY N33 N N N 431 ZLY N44 N N N 432 ZLY N46 N N N 433 ZLY O01 O N N 434 ZLY O27 O N N 435 ZLY O28 O N N 436 ZLY O40 O N N 437 ZLY O45 O N N 438 ZLY O48 O N N 439 ZLY H1 H N N 440 ZLY H2 H N N 441 ZLY H3 H N N 442 ZLY H4 H N N 443 ZLY H5 H N N 444 ZLY H6 H N N 445 ZLY H7 H N N 446 ZLY H8 H N N 447 ZLY H9 H N N 448 ZLY H10 H N N 449 ZLY H11 H N N 450 ZLY H12 H N N 451 ZLY H13 H N N 452 ZLY H14 H N N 453 ZLY H15 H N N 454 ZLY H16 H N N 455 ZLY H17 H N N 456 ZLY H18 H N N 457 ZLY H19 H N N 458 ZLY H20 H N N 459 ZLY H21 H N N 460 ZLY H22 H N N 461 ZLY H23 H N N 462 ZLY H24 H N N 463 ZLY H25 H N N 464 ZLY H26 H N N 465 ZLY H27 H N N 466 ZLY H28 H N N 467 ZLY H29 H N N 468 ZLY H30 H N N 469 ZLY H31 H N N 470 ZLY H32 H N N 471 ZLY H33 H N N 472 ZLY H34 H N N 473 ZLY H35 H N N 474 ZLY H36 H N N 475 ZLY H37 H N N 476 ZLY H38 H N N 477 ZLY H39 H N N 478 ZLY H40 H N N 479 ZLY H41 H N N 480 ZLY H42 H N N 481 ZLY H43 H N N 482 ZLY H44 H N N 483 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 EDO C1 O1 sing N N 70 EDO C1 C2 sing N N 71 EDO C1 H11 sing N N 72 EDO C1 H12 sing N N 73 EDO O1 HO1 sing N N 74 EDO C2 O2 sing N N 75 EDO C2 H21 sing N N 76 EDO C2 H22 sing N N 77 EDO O2 HO2 sing N N 78 GLN N CA sing N N 79 GLN N H sing N N 80 GLN N H2 sing N N 81 GLN CA C sing N N 82 GLN CA CB sing N N 83 GLN CA HA sing N N 84 GLN C O doub N N 85 GLN C OXT sing N N 86 GLN CB CG sing N N 87 GLN CB HB2 sing N N 88 GLN CB HB3 sing N N 89 GLN CG CD sing N N 90 GLN CG HG2 sing N N 91 GLN CG HG3 sing N N 92 GLN CD OE1 doub N N 93 GLN CD NE2 sing N N 94 GLN NE2 HE21 sing N N 95 GLN NE2 HE22 sing N N 96 GLN OXT HXT sing N N 97 GLU N CA sing N N 98 GLU N H sing N N 99 GLU N H2 sing N N 100 GLU CA C sing N N 101 GLU CA CB sing N N 102 GLU CA HA sing N N 103 GLU C O doub N N 104 GLU C OXT sing N N 105 GLU CB CG sing N N 106 GLU CB HB2 sing N N 107 GLU CB HB3 sing N N 108 GLU CG CD sing N N 109 GLU CG HG2 sing N N 110 GLU CG HG3 sing N N 111 GLU CD OE1 doub N N 112 GLU CD OE2 sing N N 113 GLU OE2 HE2 sing N N 114 GLU OXT HXT sing N N 115 GLY N CA sing N N 116 GLY N H sing N N 117 GLY N H2 sing N N 118 GLY CA C sing N N 119 GLY CA HA2 sing N N 120 GLY CA HA3 sing N N 121 GLY C O doub N N 122 GLY C OXT sing N N 123 GLY OXT HXT sing N N 124 HIS N CA sing N N 125 HIS N H sing N N 126 HIS N H2 sing N N 127 HIS CA C sing N N 128 HIS CA CB sing N N 129 HIS CA HA sing N N 130 HIS C O doub N N 131 HIS C OXT sing N N 132 HIS CB CG sing N N 133 HIS CB HB2 sing N N 134 HIS CB HB3 sing N N 135 HIS CG ND1 sing Y N 136 HIS CG CD2 doub Y N 137 HIS ND1 CE1 doub Y N 138 HIS ND1 HD1 sing N N 139 HIS CD2 NE2 sing Y N 140 HIS CD2 HD2 sing N N 141 HIS CE1 NE2 sing Y N 142 HIS CE1 HE1 sing N N 143 HIS NE2 HE2 sing N N 144 HIS OXT HXT sing N N 145 HOH O H1 sing N N 146 HOH O H2 sing N N 147 ILE N CA sing N N 148 ILE N H sing N N 149 ILE N H2 sing N N 150 ILE CA C sing N N 151 ILE CA CB sing N N 152 ILE CA HA sing N N 153 ILE C O doub N N 154 ILE C OXT sing N N 155 ILE CB CG1 sing N N 156 ILE CB CG2 sing N N 157 ILE CB HB sing N N 158 ILE CG1 CD1 sing N N 159 ILE CG1 HG12 sing N N 160 ILE CG1 HG13 sing N N 161 ILE CG2 HG21 sing N N 162 ILE CG2 HG22 sing N N 163 ILE CG2 HG23 sing N N 164 ILE CD1 HD11 sing N N 165 ILE CD1 HD12 sing N N 166 ILE CD1 HD13 sing N N 167 ILE OXT HXT sing N N 168 LEU N CA sing N N 169 LEU N H sing N N 170 LEU N H2 sing N N 171 LEU CA C sing N N 172 LEU CA CB sing N N 173 LEU CA HA sing N N 174 LEU C O doub N N 175 LEU C OXT sing N N 176 LEU CB CG sing N N 177 LEU CB HB2 sing N N 178 LEU CB HB3 sing N N 179 LEU CG CD1 sing N N 180 LEU CG CD2 sing N N 181 LEU CG HG sing N N 182 LEU CD1 HD11 sing N N 183 LEU CD1 HD12 sing N N 184 LEU CD1 HD13 sing N N 185 LEU CD2 HD21 sing N N 186 LEU CD2 HD22 sing N N 187 LEU CD2 HD23 sing N N 188 LEU OXT HXT sing N N 189 LYS N CA sing N N 190 LYS N H sing N N 191 LYS N H2 sing N N 192 LYS CA C sing N N 193 LYS CA CB sing N N 194 LYS CA HA sing N N 195 LYS C O doub N N 196 LYS C OXT sing N N 197 LYS CB CG sing N N 198 LYS CB HB2 sing N N 199 LYS CB HB3 sing N N 200 LYS CG CD sing N N 201 LYS CG HG2 sing N N 202 LYS CG HG3 sing N N 203 LYS CD CE sing N N 204 LYS CD HD2 sing N N 205 LYS CD HD3 sing N N 206 LYS CE NZ sing N N 207 LYS CE HE2 sing N N 208 LYS CE HE3 sing N N 209 LYS NZ HZ1 sing N N 210 LYS NZ HZ2 sing N N 211 LYS NZ HZ3 sing N N 212 LYS OXT HXT sing N N 213 MET N CA sing N N 214 MET N H sing N N 215 MET N H2 sing N N 216 MET CA C sing N N 217 MET CA CB sing N N 218 MET CA HA sing N N 219 MET C O doub N N 220 MET C OXT sing N N 221 MET CB CG sing N N 222 MET CB HB2 sing N N 223 MET CB HB3 sing N N 224 MET CG SD sing N N 225 MET CG HG2 sing N N 226 MET CG HG3 sing N N 227 MET SD CE sing N N 228 MET CE HE1 sing N N 229 MET CE HE2 sing N N 230 MET CE HE3 sing N N 231 MET OXT HXT sing N N 232 PHE N CA sing N N 233 PHE N H sing N N 234 PHE N H2 sing N N 235 PHE CA C sing N N 236 PHE CA CB sing N N 237 PHE CA HA sing N N 238 PHE C O doub N N 239 PHE C OXT sing N N 240 PHE CB CG sing N N 241 PHE CB HB2 sing N N 242 PHE CB HB3 sing N N 243 PHE CG CD1 doub Y N 244 PHE CG CD2 sing Y N 245 PHE CD1 CE1 sing Y N 246 PHE CD1 HD1 sing N N 247 PHE CD2 CE2 doub Y N 248 PHE CD2 HD2 sing N N 249 PHE CE1 CZ doub Y N 250 PHE CE1 HE1 sing N N 251 PHE CE2 CZ sing Y N 252 PHE CE2 HE2 sing N N 253 PHE CZ HZ sing N N 254 PHE OXT HXT sing N N 255 PRO N CA sing N N 256 PRO N CD sing N N 257 PRO N H sing N N 258 PRO CA C sing N N 259 PRO CA CB sing N N 260 PRO CA HA sing N N 261 PRO C O doub N N 262 PRO C OXT sing N N 263 PRO CB CG sing N N 264 PRO CB HB2 sing N N 265 PRO CB HB3 sing N N 266 PRO CG CD sing N N 267 PRO CG HG2 sing N N 268 PRO CG HG3 sing N N 269 PRO CD HD2 sing N N 270 PRO CD HD3 sing N N 271 PRO OXT HXT sing N N 272 SER N CA sing N N 273 SER N H sing N N 274 SER N H2 sing N N 275 SER CA C sing N N 276 SER CA CB sing N N 277 SER CA HA sing N N 278 SER C O doub N N 279 SER C OXT sing N N 280 SER CB OG sing N N 281 SER CB HB2 sing N N 282 SER CB HB3 sing N N 283 SER OG HG sing N N 284 SER OXT HXT sing N N 285 SO4 S O1 doub N N 286 SO4 S O2 doub N N 287 SO4 S O3 sing N N 288 SO4 S O4 sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 ZLY C10 C11 doub Y N 376 ZLY C10 C09 sing Y N 377 ZLY C11 C12 sing Y N 378 ZLY C09 C08 doub Y N 379 ZLY C12 C13 doub Y N 380 ZLY C08 C13 sing Y N 381 ZLY C08 C07 sing Y N 382 ZLY C06 C07 sing N N 383 ZLY C06 C05 sing N N 384 ZLY C04 N03 sing N N 385 ZLY C04 C05 sing N N 386 ZLY C13 C14 sing Y N 387 ZLY C07 C16 doub Y N 388 ZLY N03 C02 sing N N 389 ZLY C05 C17 sing N N 390 ZLY O48 C47 doub N N 391 ZLY O40 C32 doub N N 392 ZLY C39 C38 sing N N 393 ZLY C39 C34 sing N N 394 ZLY C17 C18 sing N N 395 ZLY O01 C02 doub N N 396 ZLY C38 C37 sing N N 397 ZLY C18 C19 doub N E 398 ZLY C02 C41 sing N N 399 ZLY C14 C15 doub Y N 400 ZLY C47 C34 sing N N 401 ZLY C47 N46 sing N N 402 ZLY C32 C31 sing N N 403 ZLY C32 N33 sing N N 404 ZLY C31 C20 sing N N 405 ZLY C16 C15 sing Y N 406 ZLY C41 N46 sing N N 407 ZLY C41 C42 sing N N 408 ZLY C34 N33 sing N N 409 ZLY C34 C35 sing N N 410 ZLY C19 C20 sing N N 411 ZLY C37 C36 sing N N 412 ZLY C20 C21 sing N N 413 ZLY C30 C21 doub Y N 414 ZLY C30 C29 sing Y N 415 ZLY C35 C36 sing N N 416 ZLY C42 C43 sing N N 417 ZLY C21 C22 sing Y N 418 ZLY C29 C24 doub Y N 419 ZLY O45 C43 doub N N 420 ZLY C43 N44 sing N N 421 ZLY C22 C23 doub Y N 422 ZLY C24 C23 sing Y N 423 ZLY C24 C25 sing N N 424 ZLY O28 C26 doub N N 425 ZLY C25 C26 sing N N 426 ZLY C26 O27 sing N N 427 ZLY C10 H1 sing N N 428 ZLY C15 H2 sing N N 429 ZLY C17 H3 sing N N 430 ZLY C17 H4 sing N N 431 ZLY C20 H5 sing N N 432 ZLY C22 H6 sing N N 433 ZLY C04 H7 sing N N 434 ZLY C04 H8 sing N N 435 ZLY C05 H9 sing N N 436 ZLY C06 H10 sing N N 437 ZLY C06 H11 sing N N 438 ZLY C09 H12 sing N N 439 ZLY C11 H13 sing N N 440 ZLY C12 H14 sing N N 441 ZLY C14 H15 sing N N 442 ZLY C16 H16 sing N N 443 ZLY C18 H17 sing N N 444 ZLY C19 H18 sing N N 445 ZLY C23 H19 sing N N 446 ZLY C25 H20 sing N N 447 ZLY C25 H21 sing N N 448 ZLY C29 H22 sing N N 449 ZLY C30 H23 sing N N 450 ZLY C31 H24 sing N N 451 ZLY C31 H25 sing N N 452 ZLY C35 H26 sing N N 453 ZLY C35 H27 sing N N 454 ZLY C36 H28 sing N N 455 ZLY C36 H29 sing N N 456 ZLY C37 H30 sing N N 457 ZLY C37 H31 sing N N 458 ZLY C38 H32 sing N N 459 ZLY C38 H33 sing N N 460 ZLY C39 H34 sing N N 461 ZLY C39 H35 sing N N 462 ZLY C41 H36 sing N N 463 ZLY C42 H37 sing N N 464 ZLY C42 H38 sing N N 465 ZLY N03 H39 sing N N 466 ZLY N33 H40 sing N N 467 ZLY N44 H41 sing N N 468 ZLY N44 H42 sing N N 469 ZLY N46 H43 sing N N 470 ZLY O27 H44 sing N N 471 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZLY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZLY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(4-{(10R,11E,14S,18S)-18-(2-amino-2-oxoethyl)-14-[(naphthalen-1-yl)methyl]-8,17,20-trioxo-7,16,19-triazaspiro[5.14]icos-11-en-10-yl}phenyl)acetic acid ; ZLY 3 1,2-ETHANEDIOL EDO 4 'SULFATE ION' SO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1CJ1 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #