data_7MQQ # _entry.id 7MQQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7MQQ pdb_00007mqq 10.2210/pdb7mqq/pdb WWPDB D_1000256644 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-16 2 'Structure model' 1 1 2022-03-30 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7MQQ _pdbx_database_status.recvd_initial_deposition_date 2021-05-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Outram, M.A.' 1 0000-0003-4510-3575 'Ericsson, D.J.' 2 0000-0001-5101-9244 'Williams, S.J.' 3 0000-0003-4781-6261 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'New Phytol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1469-8137 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 234 _citation.language ? _citation.page_first 592 _citation.page_last 606 _citation.title 'The stem rust effector protein AvrSr50 escapes Sr50 recognition by a substitution in a single surface-exposed residue.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/nph.18011 _citation.pdbx_database_id_PubMed 35107838 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ortiz, D.' 1 ? primary 'Chen, J.' 2 ? primary 'Outram, M.A.' 3 ? primary 'Saur, I.M.L.' 4 ? primary 'Upadhyaya, N.M.' 5 ? primary 'Mago, R.' 6 ? primary 'Ericsson, D.J.' 7 ? primary 'Cesari, S.' 8 ? primary 'Chen, C.' 9 ? primary 'Williams, S.J.' 10 ? primary 'Dodds, P.N.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stem rust effector protein AvrSr50' 13162.672 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 water nat water 18.015 108 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMARSLIKTDWSGSEYTILGANHYEEPNTGAAAQFPGTMAEDDGRSPYIVRKLRNSSGKRFYVFTDHPQQPIIWNPHEE IEIQFSRKYLIAVLTEFEADSKVFTHFARRQHRS ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMARSLIKTDWSGSEYTILGANHYEEPNTGAAAQFPGTMAEDDGRSPYIVRKLRNSSGKRFYVFTDHPQQPIIWNPHEE IEIQFSRKYLIAVLTEFEADSKVFTHFARRQHRS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 ALA n 1 5 ARG n 1 6 SER n 1 7 LEU n 1 8 ILE n 1 9 LYS n 1 10 THR n 1 11 ASP n 1 12 TRP n 1 13 SER n 1 14 GLY n 1 15 SER n 1 16 GLU n 1 17 TYR n 1 18 THR n 1 19 ILE n 1 20 LEU n 1 21 GLY n 1 22 ALA n 1 23 ASN n 1 24 HIS n 1 25 TYR n 1 26 GLU n 1 27 GLU n 1 28 PRO n 1 29 ASN n 1 30 THR n 1 31 GLY n 1 32 ALA n 1 33 ALA n 1 34 ALA n 1 35 GLN n 1 36 PHE n 1 37 PRO n 1 38 GLY n 1 39 THR n 1 40 MET n 1 41 ALA n 1 42 GLU n 1 43 ASP n 1 44 ASP n 1 45 GLY n 1 46 ARG n 1 47 SER n 1 48 PRO n 1 49 TYR n 1 50 ILE n 1 51 VAL n 1 52 ARG n 1 53 LYS n 1 54 LEU n 1 55 ARG n 1 56 ASN n 1 57 SER n 1 58 SER n 1 59 GLY n 1 60 LYS n 1 61 ARG n 1 62 PHE n 1 63 TYR n 1 64 VAL n 1 65 PHE n 1 66 THR n 1 67 ASP n 1 68 HIS n 1 69 PRO n 1 70 GLN n 1 71 GLN n 1 72 PRO n 1 73 ILE n 1 74 ILE n 1 75 TRP n 1 76 ASN n 1 77 PRO n 1 78 HIS n 1 79 GLU n 1 80 GLU n 1 81 ILE n 1 82 GLU n 1 83 ILE n 1 84 GLN n 1 85 PHE n 1 86 SER n 1 87 ARG n 1 88 LYS n 1 89 TYR n 1 90 LEU n 1 91 ILE n 1 92 ALA n 1 93 VAL n 1 94 LEU n 1 95 THR n 1 96 GLU n 1 97 PHE n 1 98 GLU n 1 99 ALA n 1 100 ASP n 1 101 SER n 1 102 LYS n 1 103 VAL n 1 104 PHE n 1 105 THR n 1 106 HIS n 1 107 PHE n 1 108 ALA n 1 109 ARG n 1 110 ARG n 1 111 GLN n 1 112 HIS n 1 113 ARG n 1 114 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 114 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PGT21_020314 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Puccinia graminis f. sp. tritici' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 56615 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'T7 Express lysY/Iq' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 20 20 GLY GLY A . n A 1 2 PRO 2 21 21 PRO PRO A . n A 1 3 MET 3 22 22 MET MET A . n A 1 4 ALA 4 23 23 ALA ALA A . n A 1 5 ARG 5 24 24 ARG ARG A . n A 1 6 SER 6 25 25 SER SER A . n A 1 7 LEU 7 26 26 LEU LEU A . n A 1 8 ILE 8 27 27 ILE ILE A . n A 1 9 LYS 9 28 28 LYS LYS A . n A 1 10 THR 10 29 29 THR THR A . n A 1 11 ASP 11 30 30 ASP ASP A . n A 1 12 TRP 12 31 31 TRP TRP A . n A 1 13 SER 13 32 32 SER SER A . n A 1 14 GLY 14 33 33 GLY GLY A . n A 1 15 SER 15 34 34 SER SER A . n A 1 16 GLU 16 35 35 GLU GLU A . n A 1 17 TYR 17 36 36 TYR TYR A . n A 1 18 THR 18 37 37 THR THR A . n A 1 19 ILE 19 38 38 ILE ILE A . n A 1 20 LEU 20 39 39 LEU LEU A . n A 1 21 GLY 21 40 40 GLY GLY A . n A 1 22 ALA 22 41 41 ALA ALA A . n A 1 23 ASN 23 42 42 ASN ASN A . n A 1 24 HIS 24 43 43 HIS HIS A . n A 1 25 TYR 25 44 44 TYR TYR A . n A 1 26 GLU 26 45 45 GLU GLU A . n A 1 27 GLU 27 46 46 GLU GLU A . n A 1 28 PRO 28 47 47 PRO PRO A . n A 1 29 ASN 29 48 48 ASN ASN A . n A 1 30 THR 30 49 49 THR THR A . n A 1 31 GLY 31 50 50 GLY GLY A . n A 1 32 ALA 32 51 51 ALA ALA A . n A 1 33 ALA 33 52 52 ALA ALA A . n A 1 34 ALA 34 53 53 ALA ALA A . n A 1 35 GLN 35 54 54 GLN GLN A . n A 1 36 PHE 36 55 55 PHE PHE A . n A 1 37 PRO 37 56 56 PRO PRO A . n A 1 38 GLY 38 57 57 GLY GLY A . n A 1 39 THR 39 58 58 THR THR A . n A 1 40 MET 40 59 59 MET MET A . n A 1 41 ALA 41 60 60 ALA ALA A . n A 1 42 GLU 42 61 61 GLU GLU A . n A 1 43 ASP 43 62 62 ASP ASP A . n A 1 44 ASP 44 63 63 ASP ASP A . n A 1 45 GLY 45 64 64 GLY GLY A . n A 1 46 ARG 46 65 65 ARG ARG A . n A 1 47 SER 47 66 66 SER SER A . n A 1 48 PRO 48 67 67 PRO PRO A . n A 1 49 TYR 49 68 68 TYR TYR A . n A 1 50 ILE 50 69 69 ILE ILE A . n A 1 51 VAL 51 70 70 VAL VAL A . n A 1 52 ARG 52 71 71 ARG ARG A . n A 1 53 LYS 53 72 72 LYS LYS A . n A 1 54 LEU 54 73 73 LEU LEU A . n A 1 55 ARG 55 74 74 ARG ARG A . n A 1 56 ASN 56 75 75 ASN ASN A . n A 1 57 SER 57 76 76 SER SER A . n A 1 58 SER 58 77 77 SER SER A . n A 1 59 GLY 59 78 78 GLY GLY A . n A 1 60 LYS 60 79 79 LYS LYS A . n A 1 61 ARG 61 80 80 ARG ARG A . n A 1 62 PHE 62 81 81 PHE PHE A . n A 1 63 TYR 63 82 82 TYR TYR A . n A 1 64 VAL 64 83 83 VAL VAL A . n A 1 65 PHE 65 84 84 PHE PHE A . n A 1 66 THR 66 85 85 THR THR A . n A 1 67 ASP 67 86 86 ASP ASP A . n A 1 68 HIS 68 87 87 HIS HIS A . n A 1 69 PRO 69 88 88 PRO PRO A . n A 1 70 GLN 70 89 89 GLN GLN A . n A 1 71 GLN 71 90 90 GLN GLN A . n A 1 72 PRO 72 91 91 PRO PRO A . n A 1 73 ILE 73 92 92 ILE ILE A . n A 1 74 ILE 74 93 93 ILE ILE A . n A 1 75 TRP 75 94 94 TRP TRP A . n A 1 76 ASN 76 95 95 ASN ASN A . n A 1 77 PRO 77 96 96 PRO PRO A . n A 1 78 HIS 78 97 97 HIS HIS A . n A 1 79 GLU 79 98 98 GLU GLU A . n A 1 80 GLU 80 99 99 GLU GLU A . n A 1 81 ILE 81 100 100 ILE ILE A . n A 1 82 GLU 82 101 101 GLU GLU A . n A 1 83 ILE 83 102 102 ILE ILE A . n A 1 84 GLN 84 103 103 GLN GLN A . n A 1 85 PHE 85 104 104 PHE PHE A . n A 1 86 SER 86 105 105 SER SER A . n A 1 87 ARG 87 106 106 ARG ARG A . n A 1 88 LYS 88 107 107 LYS LYS A . n A 1 89 TYR 89 108 108 TYR TYR A . n A 1 90 LEU 90 109 109 LEU LEU A . n A 1 91 ILE 91 110 110 ILE ILE A . n A 1 92 ALA 92 111 111 ALA ALA A . n A 1 93 VAL 93 112 112 VAL VAL A . n A 1 94 LEU 94 113 113 LEU LEU A . n A 1 95 THR 95 114 114 THR THR A . n A 1 96 GLU 96 115 115 GLU GLU A . n A 1 97 PHE 97 116 116 PHE PHE A . n A 1 98 GLU 98 117 117 GLU GLU A . n A 1 99 ALA 99 118 118 ALA ALA A . n A 1 100 ASP 100 119 119 ASP ASP A . n A 1 101 SER 101 120 120 SER SER A . n A 1 102 LYS 102 121 121 LYS LYS A . n A 1 103 VAL 103 122 122 VAL VAL A . n A 1 104 PHE 104 123 123 PHE PHE A . n A 1 105 THR 105 124 124 THR THR A . n A 1 106 HIS 106 125 125 HIS HIS A . n A 1 107 PHE 107 126 126 PHE PHE A . n A 1 108 ALA 108 127 127 ALA ALA A . n A 1 109 ARG 109 128 128 ARG ARG A . n A 1 110 ARG 110 129 129 ARG ARG A . n A 1 111 GLN 111 130 130 GLN GLN A . n A 1 112 HIS 112 131 131 HIS HIS A . n A 1 113 ARG 113 132 132 ARG ARG A . n A 1 114 SER 114 133 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 1 MG MG A . C 2 MG 1 202 2 MG MG A . D 3 HOH 1 301 8 HOH HOH A . D 3 HOH 2 302 93 HOH HOH A . D 3 HOH 3 303 41 HOH HOH A . D 3 HOH 4 304 52 HOH HOH A . D 3 HOH 5 305 88 HOH HOH A . D 3 HOH 6 306 68 HOH HOH A . D 3 HOH 7 307 43 HOH HOH A . D 3 HOH 8 308 58 HOH HOH A . D 3 HOH 9 309 33 HOH HOH A . D 3 HOH 10 310 31 HOH HOH A . D 3 HOH 11 311 63 HOH HOH A . D 3 HOH 12 312 56 HOH HOH A . D 3 HOH 13 313 87 HOH HOH A . D 3 HOH 14 314 24 HOH HOH A . D 3 HOH 15 315 54 HOH HOH A . D 3 HOH 16 316 28 HOH HOH A . D 3 HOH 17 317 123 HOH HOH A . D 3 HOH 18 318 66 HOH HOH A . D 3 HOH 19 319 55 HOH HOH A . D 3 HOH 20 320 46 HOH HOH A . D 3 HOH 21 321 79 HOH HOH A . D 3 HOH 22 322 3 HOH HOH A . D 3 HOH 23 323 40 HOH HOH A . D 3 HOH 24 324 34 HOH HOH A . D 3 HOH 25 325 10 HOH HOH A . D 3 HOH 26 326 13 HOH HOH A . D 3 HOH 27 327 25 HOH HOH A . D 3 HOH 28 328 138 HOH HOH A . D 3 HOH 29 329 121 HOH HOH A . D 3 HOH 30 330 72 HOH HOH A . D 3 HOH 31 331 6 HOH HOH A . D 3 HOH 32 332 14 HOH HOH A . D 3 HOH 33 333 1 HOH HOH A . D 3 HOH 34 334 18 HOH HOH A . D 3 HOH 35 335 57 HOH HOH A . D 3 HOH 36 336 49 HOH HOH A . D 3 HOH 37 337 4 HOH HOH A . D 3 HOH 38 338 19 HOH HOH A . D 3 HOH 39 339 11 HOH HOH A . D 3 HOH 40 340 38 HOH HOH A . D 3 HOH 41 341 12 HOH HOH A . D 3 HOH 42 342 137 HOH HOH A . D 3 HOH 43 343 16 HOH HOH A . D 3 HOH 44 344 7 HOH HOH A . D 3 HOH 45 345 83 HOH HOH A . D 3 HOH 46 346 27 HOH HOH A . D 3 HOH 47 347 5 HOH HOH A . D 3 HOH 48 348 2 HOH HOH A . D 3 HOH 49 349 30 HOH HOH A . D 3 HOH 50 350 42 HOH HOH A . D 3 HOH 51 351 37 HOH HOH A . D 3 HOH 52 352 65 HOH HOH A . D 3 HOH 53 353 35 HOH HOH A . D 3 HOH 54 354 29 HOH HOH A . D 3 HOH 55 355 17 HOH HOH A . D 3 HOH 56 356 74 HOH HOH A . D 3 HOH 57 357 44 HOH HOH A . D 3 HOH 58 358 48 HOH HOH A . D 3 HOH 59 359 15 HOH HOH A . D 3 HOH 60 360 22 HOH HOH A . D 3 HOH 61 361 36 HOH HOH A . D 3 HOH 62 362 9 HOH HOH A . D 3 HOH 63 363 113 HOH HOH A . D 3 HOH 64 364 53 HOH HOH A . D 3 HOH 65 365 110 HOH HOH A . D 3 HOH 66 366 21 HOH HOH A . D 3 HOH 67 367 107 HOH HOH A . D 3 HOH 68 368 45 HOH HOH A . D 3 HOH 69 369 39 HOH HOH A . D 3 HOH 70 370 81 HOH HOH A . D 3 HOH 71 371 32 HOH HOH A . D 3 HOH 72 372 50 HOH HOH A . D 3 HOH 73 373 69 HOH HOH A . D 3 HOH 74 374 92 HOH HOH A . D 3 HOH 75 375 59 HOH HOH A . D 3 HOH 76 376 84 HOH HOH A . D 3 HOH 77 377 70 HOH HOH A . D 3 HOH 78 378 67 HOH HOH A . D 3 HOH 79 379 117 HOH HOH A . D 3 HOH 80 380 89 HOH HOH A . D 3 HOH 81 381 23 HOH HOH A . D 3 HOH 82 382 73 HOH HOH A . D 3 HOH 83 383 128 HOH HOH A . D 3 HOH 84 384 106 HOH HOH A . D 3 HOH 85 385 101 HOH HOH A . D 3 HOH 86 386 61 HOH HOH A . D 3 HOH 87 387 20 HOH HOH A . D 3 HOH 88 388 75 HOH HOH A . D 3 HOH 89 389 95 HOH HOH A . D 3 HOH 90 390 80 HOH HOH A . D 3 HOH 91 391 103 HOH HOH A . D 3 HOH 92 392 62 HOH HOH A . D 3 HOH 93 393 77 HOH HOH A . D 3 HOH 94 394 51 HOH HOH A . D 3 HOH 95 395 60 HOH HOH A . D 3 HOH 96 396 99 HOH HOH A . D 3 HOH 97 397 127 HOH HOH A . D 3 HOH 98 398 114 HOH HOH A . D 3 HOH 99 399 64 HOH HOH A . D 3 HOH 100 400 85 HOH HOH A . D 3 HOH 101 401 122 HOH HOH A . D 3 HOH 102 402 129 HOH HOH A . D 3 HOH 103 403 82 HOH HOH A . D 3 HOH 104 404 132 HOH HOH A . D 3 HOH 105 405 26 HOH HOH A . D 3 HOH 106 406 47 HOH HOH A . D 3 HOH 107 407 76 HOH HOH A . D 3 HOH 108 408 125 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? CRANK2 ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7MQQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.732 _cell.length_a_esd ? _cell.length_b 50.732 _cell.length_b_esd ? _cell.length_c 91.091 _cell.length_c_esd ? _cell.volume 203034.607 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7MQQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7MQQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.57 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '60% Tacsimate pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 13.89 _reflns.entry_id 7MQQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.15 _reflns.d_resolution_low 31.62 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 48941 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.97 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.5 _reflns.pdbx_Rmerge_I_obs 0.044 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.43 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.013 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.15 _reflns_shell.d_res_low 1.19 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4807 _reflns_shell.percent_possible_all 99.96 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.9152 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.9603 _reflns_shell.pdbx_Rpim_I_all 0.2883 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.863 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 20.31 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7MQQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.15 _refine.ls_d_res_low 31.62 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 48941 _refine.ls_number_reflns_R_free 2577 _refine.ls_number_reflns_R_work 46364 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.97 _refine.ls_percent_reflns_R_free 5.27 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1626 _refine.ls_R_factor_R_free 0.1768 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1618 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model 'SAD AvrSr50' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.6711 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0960 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.15 _refine_hist.d_res_low 31.62 _refine_hist.number_atoms_solvent 108 _refine_hist.number_atoms_total 1034 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 924 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0193 ? 951 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.5506 ? 1287 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.1254 ? 130 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0132 ? 170 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 7.2508 ? 126 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.15 1.17 . . 134 2554 99.96 . . . 0.2210 . 0.2134 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.17 1.20 . . 155 2515 99.96 . . . 0.2081 . 0.1936 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.20 1.22 . . 146 2521 100.00 . . . 0.2126 . 0.1823 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.22 1.25 . . 131 2549 99.93 . . . 0.1847 . 0.1707 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.25 1.28 . . 138 2524 99.92 . . . 0.1986 . 0.1606 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.28 1.32 . . 133 2573 100.00 . . . 0.1913 . 0.1502 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.32 1.36 . . 137 2561 99.96 . . . 0.1889 . 0.1479 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.36 1.40 . . 122 2570 99.96 . . . 0.1574 . 0.1409 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.40 1.45 . . 154 2564 100.00 . . . 0.1990 . 0.1529 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.45 1.51 . . 119 2556 100.00 . . . 0.1620 . 0.1361 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.51 1.58 . . 122 2588 100.00 . . . 0.1483 . 0.1416 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.58 1.66 . . 157 2570 100.00 . . . 0.1518 . 0.1344 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.66 1.76 . . 133 2579 100.00 . . . 0.1932 . 0.1481 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.76 1.90 . . 159 2554 100.00 . . . 0.1584 . 0.1406 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.90 2.09 . . 153 2595 100.00 . . . 0.1590 . 0.1426 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.09 2.39 . . 146 2617 99.96 . . . 0.1681 . 0.1526 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.39 3.01 . . 161 2626 100.00 . . . 0.1939 . 0.1814 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.01 31.62 . . 177 2748 99.86 . . . 0.1770 . 0.1758 . . . . . . . . . . . # _struct.entry_id 7MQQ _struct.title 'Structure of an allelic variant of Puccinia graminis f. sp. tritici (Pgt) effector AvrSr50 (QCMJC)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7MQQ _struct_keywords.text 'Effector, stem rust, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5B0MRS6_PUCGR _struct_ref.pdbx_db_accession A0A5B0MRS6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ARSLVKIDWSGSEYTILGANHYEEPNTGAAAQFPGTMTVDDGRSPYIVRKLRNSSGKRFYVFTGHPQQPIVWNPHEEIEI QFNRKFLIAVLTEFEADSQVFNHFARRQHR ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7MQQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A5B0MRS6 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7MQQ GLY A 1 ? UNP A0A5B0MRS6 ? ? 'expression tag' 20 1 1 7MQQ PRO A 2 ? UNP A0A5B0MRS6 ? ? 'expression tag' 21 2 1 7MQQ MET A 3 ? UNP A0A5B0MRS6 ? ? 'expression tag' 22 3 1 7MQQ ILE A 8 ? UNP A0A5B0MRS6 VAL 27 conflict 27 4 1 7MQQ THR A 10 ? UNP A0A5B0MRS6 ILE 29 conflict 29 5 1 7MQQ ALA A 41 ? UNP A0A5B0MRS6 THR 60 conflict 60 6 1 7MQQ GLU A 42 ? UNP A0A5B0MRS6 VAL 61 conflict 61 7 1 7MQQ ASP A 67 ? UNP A0A5B0MRS6 GLY 86 conflict 86 8 1 7MQQ ILE A 74 ? UNP A0A5B0MRS6 VAL 93 conflict 93 9 1 7MQQ SER A 86 ? UNP A0A5B0MRS6 ASN 105 conflict 105 10 1 7MQQ TYR A 89 ? UNP A0A5B0MRS6 PHE 108 conflict 108 11 1 7MQQ LYS A 102 ? UNP A0A5B0MRS6 GLN 121 conflict 121 12 1 7MQQ THR A 105 ? UNP A0A5B0MRS6 ASN 124 conflict 124 13 1 7MQQ SER A 114 ? UNP A0A5B0MRS6 ? ? 'expression tag' 133 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details 'Size exclusion coupled with multi-angle light scattering (SEC-MALS)' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 101 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 112 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 120 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 131 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A MET 3 O ? ? ? 1_555 B MG . MG ? ? A MET 22 A MG 201 1_555 ? ? ? ? ? ? ? 2.548 ? ? metalc2 metalc ? ? A ARG 5 O ? ? ? 1_555 B MG . MG ? ? A ARG 24 A MG 201 1_555 ? ? ? ? ? ? ? 2.219 ? ? metalc3 metalc ? ? A ASP 67 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 86 A MG 202 1_555 ? ? ? ? ? ? ? 2.461 ? ? metalc4 metalc ? ? A HIS 68 O ? ? ? 1_555 C MG . MG ? ? A HIS 87 A MG 202 1_555 ? ? ? ? ? ? ? 2.548 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 346 4_555 ? ? ? ? ? ? ? 2.234 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 361 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc7 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 387 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc8 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 387 4_555 ? ? ? ? ? ? ? 2.245 ? ? metalc9 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 201 A HOH 394 1_555 ? ? ? ? ? ? ? 2.441 ? ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 316 1_555 ? ? ? ? ? ? ? 2.196 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 319 1_555 ? ? ? ? ? ? ? 2.582 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 385 1_555 ? ? ? ? ? ? ? 2.611 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A MET 3 ? A MET 22 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? A ARG 5 ? A ARG 24 ? 1_555 86.0 ? 2 O ? A MET 3 ? A MET 22 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 346 ? 4_555 81.0 ? 3 O ? A ARG 5 ? A ARG 24 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 346 ? 4_555 166.7 ? 4 O ? A MET 3 ? A MET 22 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 361 ? 1_555 91.1 ? 5 O ? A ARG 5 ? A ARG 24 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 361 ? 1_555 89.1 ? 6 O ? D HOH . ? A HOH 346 ? 4_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 361 ? 1_555 94.1 ? 7 O ? A MET 3 ? A MET 22 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 1_555 97.2 ? 8 O ? A ARG 5 ? A ARG 24 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 1_555 88.2 ? 9 O ? D HOH . ? A HOH 346 ? 4_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 1_555 90.4 ? 10 O ? D HOH . ? A HOH 361 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 1_555 171.1 ? 11 O ? A MET 3 ? A MET 22 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 4_555 97.3 ? 12 O ? A ARG 5 ? A ARG 24 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 4_555 88.3 ? 13 O ? D HOH . ? A HOH 346 ? 4_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 4_555 90.4 ? 14 O ? D HOH . ? A HOH 361 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 4_555 171.1 ? 15 O ? D HOH . ? A HOH 387 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 387 ? 4_555 0.1 ? 16 O ? A MET 3 ? A MET 22 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 394 ? 1_555 171.3 ? 17 O ? A ARG 5 ? A ARG 24 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 394 ? 1_555 87.8 ? 18 O ? D HOH . ? A HOH 346 ? 4_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 394 ? 1_555 105.4 ? 19 O ? D HOH . ? A HOH 361 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 394 ? 1_555 82.7 ? 20 O ? D HOH . ? A HOH 387 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 394 ? 1_555 88.7 ? 21 O ? D HOH . ? A HOH 387 ? 4_555 MG ? B MG . ? A MG 201 ? 1_555 O ? D HOH . ? A HOH 394 ? 1_555 88.7 ? 22 OD1 ? A ASP 67 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? A HIS 68 ? A HIS 87 ? 1_555 85.9 ? 23 OD1 ? A ASP 67 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 316 ? 1_555 73.4 ? 24 O ? A HIS 68 ? A HIS 87 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 316 ? 1_555 106.9 ? 25 OD1 ? A ASP 67 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_555 82.1 ? 26 O ? A HIS 68 ? A HIS 87 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_555 162.5 ? 27 O ? D HOH . ? A HOH 316 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_555 81.8 ? 28 OD1 ? A ASP 67 ? A ASP 86 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 385 ? 1_555 89.3 ? 29 O ? A HIS 68 ? A HIS 87 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 385 ? 1_555 79.1 ? 30 O ? D HOH . ? A HOH 316 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 385 ? 1_555 160.9 ? 31 O ? D HOH . ? A HOH 319 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 385 ? 1_555 88.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 68 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 87 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 69 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 88 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.29 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 7 ? TRP A 12 ? LEU A 26 TRP A 31 AA1 2 SER A 15 ? GLY A 21 ? SER A 34 GLY A 40 AA1 3 ILE A 91 ? THR A 95 ? ILE A 110 THR A 114 AA1 4 PHE A 62 ? PHE A 65 ? PHE A 81 PHE A 84 AA1 5 ILE A 73 ? TRP A 75 ? ILE A 92 TRP A 94 AA2 1 TYR A 49 ? ARG A 55 ? TYR A 68 ARG A 74 AA2 2 GLU A 80 ? SER A 86 ? GLU A 99 SER A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 10 ? N THR A 29 O TYR A 17 ? O TYR A 36 AA1 2 3 N THR A 18 ? N THR A 37 O LEU A 94 ? O LEU A 113 AA1 3 4 O THR A 95 ? O THR A 114 N TYR A 63 ? N TYR A 82 AA1 4 5 N PHE A 62 ? N PHE A 81 O TRP A 75 ? O TRP A 94 AA2 1 2 N ARG A 52 ? N ARG A 71 O ILE A 83 ? O ILE A 102 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 373 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 397 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.01 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 H A MET 22 ? ? 1_555 HE21 A GLN 130 ? ? 4_555 1.34 2 1 O A HOH 390 ? ? 1_555 O A HOH 403 ? ? 6_664 2.05 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 98 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 98 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.347 _pdbx_validate_rmsd_bond.bond_target_value 1.517 _pdbx_validate_rmsd_bond.bond_deviation -0.170 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ALA _pdbx_validate_rmsd_angle.auth_seq_id_1 60 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ALA _pdbx_validate_rmsd_angle.auth_seq_id_2 60 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ALA _pdbx_validate_rmsd_angle.auth_seq_id_3 60 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 100.85 _pdbx_validate_rmsd_angle.angle_target_value 110.10 _pdbx_validate_rmsd_angle.angle_deviation -9.25 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 387 ? D HOH . 2 1 A HOH 401 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # _pdbx_entry_details.entry_id 7MQQ _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id SER _pdbx_unobs_or_zero_occ_residues.auth_seq_id 133 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id SER _pdbx_unobs_or_zero_occ_residues.label_seq_id 114 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 MG MG MG N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number FT200100135 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'SAD AvrSr50' # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 7MQQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019711 _atom_sites.fract_transf_matrix[1][2] 0.011380 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022761 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010978 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_