data_7MU9
# 
_entry.id   7MU9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7MU9         pdb_00007mu9 10.2210/pdb7mu9/pdb 
WWPDB D_1000256276 ?            ?                   
BMRB  30908        ?            10.13018/BMR30908   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-12-22 
2 'Structure model' 1 1 2022-01-19 
3 'Structure model' 1 2 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' chem_comp_atom  
4 3 'Structure model' chem_comp_bond  
5 3 'Structure model' database_2      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'          
2 2 'Structure model' '_citation.pdbx_database_id_DOI'    
3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
4 2 'Structure model' '_citation.title'                   
5 2 'Structure model' '_citation.year'                    
6 2 'Structure model' '_citation_author.identifier_ORCID' 
7 2 'Structure model' '_citation_author.name'             
8 3 'Structure model' '_database_2.pdbx_DOI'              
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        7MU9 
_pdbx_database_status.recvd_initial_deposition_date   2021-05-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        
'Solution NMR structure of the XVIPCD region from the T4SS effector X-Tfe(XAC2609) from Xanthomonas citri' 
_pdbx_database_related.db_id          30908 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Oka, G.U.'     1 0000-0002-1943-7259 
'Salinas, R.K.' 2 0000-0003-1032-7683 
'Farah, C.S.'   3 0000-0003-3110-6302 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            119 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structural basis for effector recognition by an antibacterial type IV secretion system.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.2112529119 
_citation.pdbx_database_id_PubMed   34983846 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Oka, G.U.'         1  ?                   
primary 'Souza, D.P.'       2  0000-0003-1303-1765 
primary 'Cenens, W.'        3  ?                   
primary 'Matsuyama, B.Y.'   4  ?                   
primary 'Cardoso, M.V.C.'   5  0000-0001-5124-0432 
primary 'Oliveira, L.C.'    6  0000-0001-7167-8968 
primary 'da Silva Lima, F.' 7  ?                   
primary 'Cuccovia, I.M.'    8  0000-0001-8285-7419 
primary 'Guzzo, C.R.'       9  ?                   
primary 'Salinas, R.K.'     10 0000-0003-1032-7683 
primary 'Farah, C.S.'       11 0000-0003-3110-6302 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'VirD4 interacting protein conserved domain' 
_entity.formula_weight             11480.569 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'carboxypeptidase, VIPCD' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMSDPRHPDNAMYNGAVSKLEALGERGGFANRKELEQAAGQIVFESKVSGLQRIDHVVPNKSGDGFFAVQGELTDPAM
QRVFVDRNQAQNQPLENSSRQAAEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMSDPRHPDNAMYNGAVSKLEALGERGGFANRKELEQAAGQIVFESKVSGLQRIDHVVPNKSGDGFFAVQGELTDPAM
QRVFVDRNQAQNQPLENSSRQAAEE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   ASP n 
1 7   PRO n 
1 8   ARG n 
1 9   HIS n 
1 10  PRO n 
1 11  ASP n 
1 12  ASN n 
1 13  ALA n 
1 14  MET n 
1 15  TYR n 
1 16  ASN n 
1 17  GLY n 
1 18  ALA n 
1 19  VAL n 
1 20  SER n 
1 21  LYS n 
1 22  LEU n 
1 23  GLU n 
1 24  ALA n 
1 25  LEU n 
1 26  GLY n 
1 27  GLU n 
1 28  ARG n 
1 29  GLY n 
1 30  GLY n 
1 31  PHE n 
1 32  ALA n 
1 33  ASN n 
1 34  ARG n 
1 35  LYS n 
1 36  GLU n 
1 37  LEU n 
1 38  GLU n 
1 39  GLN n 
1 40  ALA n 
1 41  ALA n 
1 42  GLY n 
1 43  GLN n 
1 44  ILE n 
1 45  VAL n 
1 46  PHE n 
1 47  GLU n 
1 48  SER n 
1 49  LYS n 
1 50  VAL n 
1 51  SER n 
1 52  GLY n 
1 53  LEU n 
1 54  GLN n 
1 55  ARG n 
1 56  ILE n 
1 57  ASP n 
1 58  HIS n 
1 59  VAL n 
1 60  VAL n 
1 61  PRO n 
1 62  ASN n 
1 63  LYS n 
1 64  SER n 
1 65  GLY n 
1 66  ASP n 
1 67  GLY n 
1 68  PHE n 
1 69  PHE n 
1 70  ALA n 
1 71  VAL n 
1 72  GLN n 
1 73  GLY n 
1 74  GLU n 
1 75  LEU n 
1 76  THR n 
1 77  ASP n 
1 78  PRO n 
1 79  ALA n 
1 80  MET n 
1 81  GLN n 
1 82  ARG n 
1 83  VAL n 
1 84  PHE n 
1 85  VAL n 
1 86  ASP n 
1 87  ARG n 
1 88  ASN n 
1 89  GLN n 
1 90  ALA n 
1 91  GLN n 
1 92  ASN n 
1 93  GLN n 
1 94  PRO n 
1 95  LEU n 
1 96  GLU n 
1 97  ASN n 
1 98  SER n 
1 99  SER n 
1 100 ARG n 
1 101 GLN n 
1 102 ALA n 
1 103 ALA n 
1 104 GLU n 
1 105 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   105 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 XAC2609 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    306 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Xanthomonas axonopodis pv. citri (strain 306)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     190486 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               RP 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   HIS 3   3   3   HIS HIS A . n 
A 1 4   MET 4   4   4   MET MET A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   HIS 9   9   9   HIS HIS A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  TYR 15  15  15  TYR TYR A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  PHE 68  68  68  PHE PHE A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  GLN 93  93  93  GLN GLN A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 ARG 100 100 100 ARG ARG A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7MU9 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     7MU9 
_struct.title                        
'Solution NMR structure of the XVIPCD region from the T4SS effector X-Tfe(XAC2609) from Xanthomonas citri' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7MU9 
_struct_keywords.text            
'bacterial toxin, bacterial competition, type IV secretion system, VirD4 binding module, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8PJC6_XANAC 
_struct_ref.pdbx_db_accession          Q8PJC6 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SDPRHPDNAMYNGAVSKLEALGERGGFANRKELEQAAGQIVFESKVSGLQRIDHVVPNKSGDGFFAVQGELTDPAMQRVF
VDRNQAQNQPLENSSRQAAEE
;
_struct_ref.pdbx_align_begin           311 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7MU9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 105 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8PJC6 
_struct_ref_seq.db_align_beg                  311 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  411 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       5 
_struct_ref_seq.pdbx_auth_seq_align_end       105 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7MU9 GLY A 1 ? UNP Q8PJC6 ? ? 'expression tag' 1 1 
1 7MU9 SER A 2 ? UNP Q8PJC6 ? ? 'expression tag' 2 2 
1 7MU9 HIS A 3 ? UNP Q8PJC6 ? ? 'expression tag' 3 3 
1 7MU9 MET A 4 ? UNP Q8PJC6 ? ? 'expression tag' 4 4 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 10 ? GLY A 26 ? PRO A 10 GLY A 26 1 ? 17 
HELX_P HELX_P2 AA2 GLU A 27 ? GLY A 30 ? GLU A 27 GLY A 30 5 ? 4  
HELX_P HELX_P3 AA3 ASN A 33 ? GLY A 52 ? ASN A 33 GLY A 52 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 58 ? PRO A 61 ? HIS A 58 PRO A 61 
AA1 2 GLY A 67 ? GLN A 72 ? GLY A 67 GLN A 72 
AA1 3 GLN A 81 ? ASP A 86 ? GLN A 81 ASP A 86 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 60 ? N VAL A 60 O PHE A 69 ? O PHE A 69 
AA1 2 3 N PHE A 68 ? N PHE A 68 O VAL A 85 ? O VAL A 85 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1  HD1 A HIS 9  ? ? OD1 A ASP 11 ? ? 1.59 
2 2  OD1 A ASP 11 ? ? HZ1 A LYS 49 ? ? 1.59 
3 5  OD2 A ASP 11 ? ? HZ1 A LYS 49 ? ? 1.59 
4 8  H1  A GLY 1  ? ? OE1 A GLU 38 ? ? 1.60 
5 11 OD1 A ASP 11 ? ? HZ3 A LYS 49 ? ? 1.58 
6 13 OD2 A ASP 11 ? ? HZ3 A LYS 49 ? ? 1.57 
7 15 HD1 A HIS 9  ? ? OD1 A ASP 11 ? ? 1.60 
8 18 HD1 A HIS 9  ? ? OD1 A ASP 11 ? ? 1.59 
9 19 HD1 A HIS 9  ? ? OD2 A ASP 11 ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  PRO A 10  ? ? -69.40  7.29    
2   1  GLN A 89  ? ? 42.94   -93.03  
3   1  ALA A 90  ? ? 63.58   -167.73 
4   1  ASN A 92  ? ? -170.27 -66.13  
5   1  PRO A 94  ? ? -68.15  84.13   
6   1  ASN A 97  ? ? -165.09 89.83   
7   1  ARG A 100 ? ? -146.15 27.21   
8   2  ASN A 92  ? ? -138.12 -68.31  
9   2  PRO A 94  ? ? -69.18  93.01   
10  2  LEU A 95  ? ? 72.70   -54.39  
11  2  ARG A 100 ? ? -92.24  47.80   
12  2  ALA A 102 ? ? 66.57   -72.32  
13  2  ALA A 103 ? ? -172.98 97.85   
14  3  ASN A 88  ? ? -145.21 35.14   
15  3  ASN A 92  ? ? -124.42 -111.04 
16  3  ASN A 97  ? ? 61.96   94.32   
17  4  HIS A 3   ? ? -156.91 -5.78   
18  4  ASN A 88  ? ? -161.95 18.09   
19  4  GLN A 89  ? ? 67.65   76.37   
20  4  GLN A 91  ? ? -57.67  109.35  
21  4  GLN A 93  ? ? 179.54  105.84  
22  4  PRO A 94  ? ? -67.10  69.28   
23  4  LEU A 95  ? ? 70.73   138.79  
24  4  SER A 98  ? ? 71.36   -41.78  
25  5  ASN A 92  ? ? -156.85 -80.42  
26  5  GLN A 93  ? ? -125.75 -50.54  
27  5  LEU A 95  ? ? 57.68   -165.30 
28  5  ALA A 102 ? ? 67.66   -73.10  
29  5  ALA A 103 ? ? -81.47  47.99   
30  6  GLN A 91  ? ? -164.53 -71.61  
31  6  ASN A 92  ? ? -115.94 -94.61  
32  6  ASN A 97  ? ? -168.21 54.67   
33  7  HIS A 3   ? ? -143.10 41.05   
34  7  ARG A 55  ? ? -175.15 136.43  
35  7  ALA A 90  ? ? -161.55 99.87   
36  7  ASN A 92  ? ? 172.48  78.98   
37  7  GLN A 93  ? ? 73.86   111.07  
38  7  ASN A 97  ? ? 57.48   72.06   
39  7  SER A 99  ? ? -145.03 51.82   
40  7  ARG A 100 ? ? -80.74  -71.70  
41  7  GLN A 101 ? ? 46.96   71.22   
42  7  ALA A 102 ? ? -95.16  47.58   
43  7  ALA A 103 ? ? 63.84   -175.67 
44  8  SER A 2   ? ? 60.66   -91.50  
45  8  HIS A 3   ? ? -146.23 28.62   
46  8  ARG A 55  ? ? -172.97 141.74  
47  8  GLN A 89  ? ? 39.02   49.64   
48  8  ASN A 92  ? ? -164.59 -84.69  
49  8  LEU A 95  ? ? 63.30   -175.28 
50  8  ALA A 102 ? ? -92.96  46.62   
51  9  SER A 2   ? ? 69.63   129.91  
52  9  ASN A 88  ? ? -139.30 -44.00  
53  9  ALA A 90  ? ? -81.50  35.65   
54  9  GLN A 91  ? ? -158.32 39.32   
55  9  ASN A 92  ? ? -127.97 -51.69  
56  9  GLN A 93  ? ? -155.56 -50.80  
57  9  GLU A 96  ? ? 67.55   107.33  
58  9  GLN A 101 ? ? -153.31 33.82   
59  9  ALA A 102 ? ? 61.74   -104.52 
60  9  ALA A 103 ? ? 67.36   -60.19  
61  10 GLN A 93  ? ? 70.49   122.88  
62  10 SER A 98  ? ? -115.24 57.12   
63  10 ARG A 100 ? ? -96.43  -68.98  
64  11 ASN A 88  ? ? -147.24 19.50   
65  11 GLN A 89  ? ? 37.93   58.74   
66  11 ALA A 90  ? ? -149.98 -28.37  
67  11 LEU A 95  ? ? 61.15   -170.84 
68  11 SER A 98  ? ? -84.15  44.19   
69  11 SER A 99  ? ? -172.40 114.35  
70  11 GLN A 101 ? ? -128.11 -69.45  
71  11 ALA A 102 ? ? -147.90 52.01   
72  12 ASN A 92  ? ? 74.65   -65.07  
73  12 PRO A 94  ? ? -69.85  80.22   
74  12 LEU A 95  ? ? 67.99   -70.74  
75  12 GLU A 96  ? ? -157.76 -75.29  
76  12 ALA A 102 ? ? 72.19   122.24  
77  13 ALA A 90  ? ? 72.36   92.30   
78  13 GLN A 91  ? ? -154.81 -72.40  
79  13 ASN A 92  ? ? -88.50  -127.67 
80  13 PRO A 94  ? ? -61.18  98.41   
81  13 LEU A 95  ? ? -152.32 -70.02  
82  13 GLU A 96  ? ? -101.17 79.35   
83  14 ARG A 55  ? ? -170.74 147.37  
84  14 GLN A 89  ? ? 51.56   -68.17  
85  14 ASN A 92  ? ? 71.52   -73.31  
86  14 GLN A 93  ? ? -130.95 -58.19  
87  15 PRO A 10  ? ? -69.16  7.84    
88  15 ASN A 88  ? ? -141.27 47.57   
89  15 ALA A 90  ? ? 64.07   -160.06 
90  15 GLN A 91  ? ? 77.51   -60.72  
91  15 ASN A 92  ? ? -79.41  -99.35  
92  15 LEU A 95  ? ? -145.01 34.21   
93  15 ASN A 97  ? ? 67.60   -81.38  
94  15 GLU A 104 ? ? -139.74 -39.23  
95  16 ALA A 90  ? ? -161.57 40.43   
96  16 ASN A 92  ? ? 68.42   -96.80  
97  16 PRO A 94  ? ? -35.04  114.38  
98  16 LEU A 95  ? ? 68.67   -63.22  
99  16 ALA A 102 ? ? 65.66   176.79  
100 17 HIS A 3   ? ? -100.01 45.11   
101 17 ARG A 55  ? ? -178.40 145.61  
102 17 GLN A 89  ? ? 33.66   75.19   
103 17 ALA A 90  ? ? -116.97 -77.14  
104 17 GLN A 91  ? ? -171.66 -52.32  
105 17 ASN A 92  ? ? -144.22 -48.36  
106 17 LEU A 95  ? ? 63.13   -90.16  
107 18 GLN A 89  ? ? 48.83   -71.36  
108 18 ALA A 90  ? ? -142.83 38.20   
109 18 ASN A 92  ? ? 69.33   -78.61  
110 18 GLN A 93  ? ? -128.38 -58.23  
111 18 SER A 98  ? ? -120.10 -151.55 
112 18 SER A 99  ? ? -75.56  43.72   
113 18 ARG A 100 ? ? -131.87 -45.88  
114 18 ALA A 102 ? ? -162.41 42.66   
115 19 ALA A 90  ? ? -164.67 -162.59 
116 19 GLN A 91  ? ? 74.34   -44.56  
117 19 ASN A 92  ? ? -85.91  -159.72 
118 19 GLU A 96  ? ? -76.17  -82.44  
119 19 ALA A 103 ? ? 49.29   70.87   
120 19 GLU A 104 ? ? 73.20   -11.00  
121 20 ASP A 11  ? ? 172.40  27.92   
122 20 LYS A 63  ? ? 40.21   -87.28  
123 20 ASN A 88  ? ? -177.34 129.10  
124 20 GLN A 89  ? ? -60.73  91.80   
125 20 ASN A 92  ? ? -107.84 -162.13 
126 20 PRO A 94  ? ? -51.95  109.46  
127 20 GLN A 101 ? ? 68.58   -79.69  
128 20 GLU A 104 ? ? -171.51 -44.12  
# 
_pdbx_nmr_ensemble.entry_id                                      7MU9 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             7MU9 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1.5 mM [U-100% 13C; U-100% 15N] XAC2609(311-411), 20 mM TRIS, 100 mM sodium chloride, 0.1 % v/v glycerol, 0.05 % w/v sodium azide, 93% H2O/7% D2O
;
_pdbx_nmr_sample_details.solvent_system   '93% H2O/7% D2O' 
_pdbx_nmr_sample_details.label            15N/13C 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          ? 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 'XAC2609(311-411)' 1.5  ? mM      '[U-100% 13C; U-100% 15N]' 
1 TRIS               20   ? mM      'natural abundance'        
1 'sodium chloride'  100  ? mM      'natural abundance'        
1 glycerol           0.1  ? '% v/v' 'natural abundance'        
1 'sodium azide'     0.05 ? '% w/v' 'natural abundance'        
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         mbar 
_pdbx_nmr_exptl_sample_conditions.pressure               1016 
_pdbx_nmr_exptl_sample_conditions.pH                     8.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         '100 mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  condition_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 0.1 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           10 
_pdbx_nmr_exptl_sample_conditions.temperature_err        0.2 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
9  1 1 '3D HNCACB'                  1 anisotropic 
10 1 1 '3D CBCA(CO)NH'              1 anisotropic 
11 1 1 '3D HNCA'                    1 anisotropic 
12 1 1 '3D HN(CO)CA'                1 anisotropic 
13 1 1 '3D HNCO'                    1 anisotropic 
14 1 1 'HN(CA)CO'                   1 anisotropic 
15 1 1 '3D-(H)CCH'                  1 isotropic   
16 1 1 '3D-H(C)CH'                  1 anisotropic 
17 1 1 '3D HCCH-TOCSY'              1 anisotropic 
18 1 1 '3D HCCH-TOCSY'              1 anisotropic 
19 1 1 '3D 15N NOESY-HSQC'          1 anisotropic 
20 1 1 '3D 13C NOESY-HSQC'          1 anisotropic 
21 1 1 '2D 1H-1H NOESY'             1 anisotropic 
22 1 1 '2D AROMATIC 13C NOESY-HSQC' 1 anisotropic 
23 1 1 '3D (D2O) H(C)CH-TOCSY'      1 anisotropic 
24 1 1 '3D (D2O) (H)CCH-TOCSY'      1 anisotropic 
25 1 1 '3D (D2O) 13C NOESY-HSQC'    1 anisotropic 
26 1 1 '3D (D2) 15N NOESY-HSQC'     1 anisotropic 
27 1 1 '2D 1H-13C HSQC'             1 anisotropic 
28 1 1 '2D 1H-15N HSQC'             1 anisotropic 
# 
_pdbx_nmr_refine.entry_id           7MU9 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 refinement                  CNS               ?   'Brunger A. T. et.al.'         
2 'structure calculation'     ARIA              ?   
;Linge, O'Donoghue and Nilges
;
3 'chemical shift assignment' 'CcpNmr Analysis' 2.3 CCPN                           
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TYR N    N N N 304 
TYR CA   C N S 305 
TYR C    C N N 306 
TYR O    O N N 307 
TYR CB   C N N 308 
TYR CG   C Y N 309 
TYR CD1  C Y N 310 
TYR CD2  C Y N 311 
TYR CE1  C Y N 312 
TYR CE2  C Y N 313 
TYR CZ   C Y N 314 
TYR OH   O N N 315 
TYR OXT  O N N 316 
TYR H    H N N 317 
TYR H2   H N N 318 
TYR HA   H N N 319 
TYR HB2  H N N 320 
TYR HB3  H N N 321 
TYR HD1  H N N 322 
TYR HD2  H N N 323 
TYR HE1  H N N 324 
TYR HE2  H N N 325 
TYR HH   H N N 326 
TYR HXT  H N N 327 
VAL N    N N N 328 
VAL CA   C N S 329 
VAL C    C N N 330 
VAL O    O N N 331 
VAL CB   C N N 332 
VAL CG1  C N N 333 
VAL CG2  C N N 334 
VAL OXT  O N N 335 
VAL H    H N N 336 
VAL H2   H N N 337 
VAL HA   H N N 338 
VAL HB   H N N 339 
VAL HG11 H N N 340 
VAL HG12 H N N 341 
VAL HG13 H N N 342 
VAL HG21 H N N 343 
VAL HG22 H N N 344 
VAL HG23 H N N 345 
VAL HXT  H N N 346 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TYR N   CA   sing N N 291 
TYR N   H    sing N N 292 
TYR N   H2   sing N N 293 
TYR CA  C    sing N N 294 
TYR CA  CB   sing N N 295 
TYR CA  HA   sing N N 296 
TYR C   O    doub N N 297 
TYR C   OXT  sing N N 298 
TYR CB  CG   sing N N 299 
TYR CB  HB2  sing N N 300 
TYR CB  HB3  sing N N 301 
TYR CG  CD1  doub Y N 302 
TYR CG  CD2  sing Y N 303 
TYR CD1 CE1  sing Y N 304 
TYR CD1 HD1  sing N N 305 
TYR CD2 CE2  doub Y N 306 
TYR CD2 HD2  sing N N 307 
TYR CE1 CZ   doub Y N 308 
TYR CE1 HE1  sing N N 309 
TYR CE2 CZ   sing Y N 310 
TYR CE2 HE2  sing N N 311 
TYR CZ  OH   sing N N 312 
TYR OH  HH   sing N N 313 
TYR OXT HXT  sing N N 314 
VAL N   CA   sing N N 315 
VAL N   H    sing N N 316 
VAL N   H2   sing N N 317 
VAL CA  C    sing N N 318 
VAL CA  CB   sing N N 319 
VAL CA  HA   sing N N 320 
VAL C   O    doub N N 321 
VAL C   OXT  sing N N 322 
VAL CB  CG1  sing N N 323 
VAL CB  CG2  sing N N 324 
VAL CB  HB   sing N N 325 
VAL CG1 HG11 sing N N 326 
VAL CG1 HG12 sing N N 327 
VAL CG1 HG13 sing N N 328 
VAL CG2 HG21 sing N N 329 
VAL CG2 HG22 sing N N 330 
VAL CG2 HG23 sing N N 331 
VAL OXT HXT  sing N N 332 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Sao Paulo Research Foundation (FAPESP)' Brazil 2017/17303-7 1 
'Sao Paulo Research Foundation (FAPESP)' Brazil 2018/09277-9 2 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE III' 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.details           ? 
# 
_atom_sites.entry_id                    7MU9 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_