data_7N4D # _entry.id 7N4D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7N4D pdb_00007n4d 10.2210/pdb7n4d/pdb WWPDB D_1000257338 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7N4D _pdbx_database_status.recvd_initial_deposition_date 2021-06-03 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Translation initiation factor eif-5a family protein from Naegleria fowleri ATCC 30863' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sroge, C.D.' 1 ? primary 'Davies, D.R.' 2 ? primary 'Horanyi, P.S.' 3 ? primary 'Lorimer, D.D.' 4 ? primary 'Edwards, T.E.' 5 ? primary 'Abendroth, J.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 93.570 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7N4D _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.570 _cell.length_a_esd ? _cell.length_b 58.940 _cell.length_b_esd ? _cell.length_c 102.340 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7N4D _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Eukaryotic translation initiation factor 5A' 17230.420 4 ? ? ? ? 2 water nat water 18.015 55 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name eIF-5A # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSDEDQTFESASSGASHTYPMQAGNLKKGGYVVIKDKPCKITEVTTSKTGKHGHAKANITGIDIFTGKKYEDVCPTSHNM PVPNVTRNEYQVIDISGEYVSIMLEDGSTRDDLKLPNETEEDKTLAEKIKAAFDEGAEFNVIVMSAMGVEKIVEMKL ; _entity_poly.pdbx_seq_one_letter_code_can ;MSDEDQTFESASSGASHTYPMQAGNLKKGGYVVIKDKPCKITEVTTSKTGKHGHAKANITGIDIFTGKKYEDVCPTSHNM PVPNVTRNEYQVIDISGEYVSIMLEDGSTRDDLKLPNETEEDKTLAEKIKAAFDEGAEFNVIVMSAMGVEKIVEMKL ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASP n 1 4 GLU n 1 5 ASP n 1 6 GLN n 1 7 THR n 1 8 PHE n 1 9 GLU n 1 10 SER n 1 11 ALA n 1 12 SER n 1 13 SER n 1 14 GLY n 1 15 ALA n 1 16 SER n 1 17 HIS n 1 18 THR n 1 19 TYR n 1 20 PRO n 1 21 MET n 1 22 GLN n 1 23 ALA n 1 24 GLY n 1 25 ASN n 1 26 LEU n 1 27 LYS n 1 28 LYS n 1 29 GLY n 1 30 GLY n 1 31 TYR n 1 32 VAL n 1 33 VAL n 1 34 ILE n 1 35 LYS n 1 36 ASP n 1 37 LYS n 1 38 PRO n 1 39 CYS n 1 40 LYS n 1 41 ILE n 1 42 THR n 1 43 GLU n 1 44 VAL n 1 45 THR n 1 46 THR n 1 47 SER n 1 48 LYS n 1 49 THR n 1 50 GLY n 1 51 LYS n 1 52 HIS n 1 53 GLY n 1 54 HIS n 1 55 ALA n 1 56 LYS n 1 57 ALA n 1 58 ASN n 1 59 ILE n 1 60 THR n 1 61 GLY n 1 62 ILE n 1 63 ASP n 1 64 ILE n 1 65 PHE n 1 66 THR n 1 67 GLY n 1 68 LYS n 1 69 LYS n 1 70 TYR n 1 71 GLU n 1 72 ASP n 1 73 VAL n 1 74 CYS n 1 75 PRO n 1 76 THR n 1 77 SER n 1 78 HIS n 1 79 ASN n 1 80 MET n 1 81 PRO n 1 82 VAL n 1 83 PRO n 1 84 ASN n 1 85 VAL n 1 86 THR n 1 87 ARG n 1 88 ASN n 1 89 GLU n 1 90 TYR n 1 91 GLN n 1 92 VAL n 1 93 ILE n 1 94 ASP n 1 95 ILE n 1 96 SER n 1 97 GLY n 1 98 GLU n 1 99 TYR n 1 100 VAL n 1 101 SER n 1 102 ILE n 1 103 MET n 1 104 LEU n 1 105 GLU n 1 106 ASP n 1 107 GLY n 1 108 SER n 1 109 THR n 1 110 ARG n 1 111 ASP n 1 112 ASP n 1 113 LEU n 1 114 LYS n 1 115 LEU n 1 116 PRO n 1 117 ASN n 1 118 GLU n 1 119 THR n 1 120 GLU n 1 121 GLU n 1 122 ASP n 1 123 LYS n 1 124 THR n 1 125 LEU n 1 126 ALA n 1 127 GLU n 1 128 LYS n 1 129 ILE n 1 130 LYS n 1 131 ALA n 1 132 ALA n 1 133 PHE n 1 134 ASP n 1 135 GLU n 1 136 GLY n 1 137 ALA n 1 138 GLU n 1 139 PHE n 1 140 ASN n 1 141 VAL n 1 142 ILE n 1 143 VAL n 1 144 MET n 1 145 SER n 1 146 ALA n 1 147 MET n 1 148 GLY n 1 149 VAL n 1 150 GLU n 1 151 LYS n 1 152 ILE n 1 153 VAL n 1 154 GLU n 1 155 MET n 1 156 LYS n 1 157 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 157 _entity_src_gen.gene_src_common_name 'Brain eating amoeba' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FDP41_013076 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Naegleria fowleri' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5763 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name NafoA.20237.a.D11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A6A5BRA8_NAEFO _struct_ref.pdbx_db_accession A0A6A5BRA8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDEDQTFESASSGASHTYPMQAGNLKKGGYVVIKDKPCKITEVTTSKTGKHGHAKANITGIDIFTGKKYEDVCPTSHNM PVPNVTRNEYQVIDISGEYVSIMLEDGSTRDDLKLPNETEEDKTLAEKIKAAFDEGAEFNVIVMSAMGVEKIVEMKL ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7N4D A 1 ? 157 ? A0A6A5BRA8 1 ? 157 ? 1 157 2 1 7N4D B 1 ? 157 ? A0A6A5BRA8 1 ? 157 ? 1 157 3 1 7N4D C 1 ? 157 ? A0A6A5BRA8 1 ? 157 ? 1 157 4 1 7N4D D 1 ? 157 ? A0A6A5BRA8 1 ? 157 ? 1 157 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7N4D _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Rigaku JCSG+ screen, D12:0.04M KPO4, 16% w/v PEG 8 000, 20% glycerol: NafoA.20237.a.D11.PD38375 NafoA.01541.a.B2.PW38668 (4:1) at 13.91 mg/ml + 4mM GC7,deoxyhypusine synthase inhibitor + 4mM NAD: cryo: direct: tray 320284d12, puck pvq5-1 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Beryllium Lenses' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Diamond [111]' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 42.970 _reflns.entry_id 7N4D _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.450 _reflns.d_resolution_low 31.360 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24974 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.640 _reflns.pdbx_Rmerge_I_obs 0.067 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.390 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.925 _reflns.pdbx_scaling_rejects 6 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.084 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 65938 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.450 2.510 ? 2.110 ? 4914 1868 ? 1858 99.500 ? ? ? ? 0.527 ? ? ? ? ? ? ? ? 2.645 ? ? ? ? 0.657 ? ? 1 1 0.792 ? ? ? ? ? ? ? ? ? ? 2.510 2.580 ? 2.170 ? 4792 1815 ? 1805 99.400 ? ? ? ? 0.515 ? ? ? ? ? ? ? ? 2.655 ? ? ? ? 0.643 ? ? 2 1 0.753 ? ? ? ? ? ? ? ? ? ? 2.580 2.660 ? 2.640 ? 4590 1761 ? 1746 99.100 ? ? ? ? 0.442 ? ? ? ? ? ? ? ? 2.629 ? ? ? ? 0.554 ? ? 3 1 0.809 ? ? ? ? ? ? ? ? ? ? 2.660 2.740 ? 3.260 ? 4615 1746 ? 1733 99.300 ? ? ? ? 0.345 ? ? ? ? ? ? ? ? 2.663 ? ? ? ? 0.430 ? ? 4 1 0.874 ? ? ? ? ? ? ? ? ? ? 2.740 2.830 ? 4.150 ? 4321 1647 ? 1635 99.300 ? ? ? ? 0.256 ? ? ? ? ? ? ? ? 2.643 ? ? ? ? 0.320 ? ? 5 1 0.919 ? ? ? ? ? ? ? ? ? ? 2.830 2.930 ? 5.210 ? 4241 1620 ? 1607 99.200 ? ? ? ? 0.198 ? ? ? ? ? ? ? ? 2.639 ? ? ? ? 0.248 ? ? 6 1 0.952 ? ? ? ? ? ? ? ? ? ? 2.930 3.040 ? 6.570 ? 4135 1565 ? 1553 99.200 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 2.663 ? ? ? ? 0.199 ? ? 7 1 0.965 ? ? ? ? ? ? ? ? ? ? 3.040 3.160 ? 8.180 ? 3908 1485 ? 1472 99.100 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 2.655 ? ? ? ? 0.157 ? ? 8 1 0.980 ? ? ? ? ? ? ? ? ? ? 3.160 3.300 ? 10.140 ? 3775 1456 ? 1429 98.100 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 2.642 ? ? ? ? 0.123 ? ? 9 1 0.987 ? ? ? ? ? ? ? ? ? ? 3.300 3.460 ? 12.920 ? 3573 1372 ? 1354 98.700 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 2.639 ? ? ? ? 0.090 ? ? 10 1 0.992 ? ? ? ? ? ? ? ? ? ? 3.460 3.650 ? 15.560 ? 3402 1312 ? 1286 98.000 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 2.645 ? ? ? ? 0.076 ? ? 11 1 0.993 ? ? ? ? ? ? ? ? ? ? 3.650 3.870 ? 18.190 ? 3215 1243 ? 1221 98.200 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 2.633 ? ? ? ? 0.059 ? ? 12 1 0.996 ? ? ? ? ? ? ? ? ? ? 3.870 4.140 ? 20.220 ? 3026 1176 ? 1148 97.600 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 2.636 ? ? ? ? 0.052 ? ? 13 1 0.997 ? ? ? ? ? ? ? ? ? ? 4.140 4.470 ? 23.550 ? 2798 1097 ? 1062 96.800 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 2.635 ? ? ? ? 0.044 ? ? 14 1 0.998 ? ? ? ? ? ? ? ? ? ? 4.470 4.900 ? 25.390 ? 2520 1008 ? 972 96.400 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 2.593 ? ? ? ? 0.039 ? ? 15 1 0.998 ? ? ? ? ? ? ? ? ? ? 4.900 5.480 ? 25.060 ? 2327 914 ? 881 96.400 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 2.641 ? ? ? ? 0.039 ? ? 16 1 0.998 ? ? ? ? ? ? ? ? ? ? 5.480 6.330 ? 23.470 ? 2076 816 ? 778 95.300 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 2.668 ? ? ? ? 0.044 ? ? 17 1 0.997 ? ? ? ? ? ? ? ? ? ? 6.330 7.750 ? 25.540 ? 1725 680 ? 651 95.700 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 2.650 ? ? ? ? 0.036 ? ? 18 1 0.998 ? ? ? ? ? ? ? ? ? ? 7.750 10.960 ? 31.290 ? 1336 546 ? 517 94.700 ? ? ? ? 0.025 ? ? ? ? ? ? ? ? 2.584 ? ? ? ? 0.032 ? ? 19 1 0.998 ? ? ? ? ? ? ? ? ? ? 10.960 31.360 ? 33.140 ? 649 316 ? 266 84.200 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 2.440 ? ? ? ? 0.029 ? ? 20 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 126.670 _refine.B_iso_mean 58.9055 _refine.B_iso_min 32.170 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7N4D _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4500 _refine.ls_d_res_low 31.3600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24963 _refine.ls_number_reflns_R_free 2021 _refine.ls_number_reflns_R_work 22942 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.1700 _refine.ls_percent_reflns_R_free 8.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2387 _refine.ls_R_factor_R_free 0.2939 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2339 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'pdb entry 5dlq as per Morda' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.1200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4500 _refine_hist.d_res_low 31.3600 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 4184 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 551 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 52.83 _refine_hist.pdbx_number_atoms_protein 4129 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2409 10.286 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2409 10.286 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 2409 10.286 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 2409 10.286 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4500 2.5100 1789 . 148 1641 99.0000 . . . 0.3804 0.0000 0.3244 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.5100 2.5800 1790 . 133 1657 99.0000 . . . 0.3607 0.0000 0.3237 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.5800 2.6500 1774 . 154 1620 99.0000 . . . 0.4023 0.0000 0.3107 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.6600 2.7400 1811 . 148 1663 99.0000 . . . 0.2968 0.0000 0.2976 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.7400 2.8400 1757 . 154 1603 99.0000 . . . 0.3568 0.0000 0.2884 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.8400 2.9500 1804 . 165 1639 99.0000 . . . 0.3454 0.0000 0.2961 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.9500 3.0900 1786 . 176 1610 99.0000 . . . 0.3375 0.0000 0.2558 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.0900 3.2500 1788 . 115 1673 99.0000 . . . 0.3305 0.0000 0.2558 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.2500 3.4500 1800 . 106 1694 98.0000 . . . 0.3179 0.0000 0.2509 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.4500 3.7200 1769 . 167 1602 98.0000 . . . 0.2848 0.0000 0.2188 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 3.7200 4.0900 1780 . 154 1626 97.0000 . . . 0.2354 0.0000 0.2119 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 4.0900 4.6800 1758 . 152 1606 97.0000 . . . 0.2515 0.0000 0.1911 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 4.6800 5.8900 1777 . 135 1642 96.0000 . . . 0.2770 0.0000 0.1963 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 5.8900 31.3600 1780 . 114 1666 94.0000 . . . 0.2696 0.0000 0.2065 . . . . . . . 14 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; 1 2 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; 1 3 ;(chain C and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; 1 4 ;(chain D and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? A 16 A 27 ;(chain A and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 1 2 ? A 28 A 28 ;(chain A and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 1 3 ? A 16 A 157 ;(chain A and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 1 4 ? A 16 A 157 ;(chain A and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 1 5 ? A 16 A 157 ;(chain A and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 1 6 ? A 16 A 157 ;(chain A and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 1 ? B 16 B 26 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 2 ? B 27 B 28 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 3 ? B 16 B 157 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 4 ? B 16 B 157 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 5 ? B 16 B 157 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 6 ? B 0 B 0 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 7 ? B 16 B 157 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 8 ? B 16 B 157 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 9 ? B 16 B 157 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 2 10 ? B 16 B 157 ;(chain B and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 42 or (resid 43 and (name N or name CA or name C or name O or name CB )) or resid 44 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 3 1 ? C 16 C 27 ;(chain C and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 3 2 ? C 28 C 28 ;(chain C and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 3 3 ? C 16 C 157 ;(chain C and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 3 4 ? C 16 C 157 ;(chain C and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 3 5 ? C 16 C 157 ;(chain C and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 3 6 ? C 16 C 157 ;(chain C and (resid 16 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 57 through 83 or resid 85 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 4 1 ? D 16 D 26 ;(chain D and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 4 2 ? D 27 D 28 ;(chain D and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 4 3 ? D 16 D 157 ;(chain D and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 4 4 ? D 16 D 157 ;(chain D and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 4 5 ? D 16 D 157 ;(chain D and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? 1 4 6 ? D 16 D 157 ;(chain D and (resid 16 through 26 or (resid 27 through 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 46 or resid 57 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB )) or resid 69 through 83 or resid 85 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB )) or resid 119 through 157)) ; ? ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7N4D _struct.title 'Translation initiation factor eif-5a family protein from Naegleria fowleri ATCC 30863' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7N4D _struct_keywords.text 'SSGCID, eif5a, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 24 ? LEU A 26 ? GLY A 24 LEU A 26 5 ? 3 HELX_P HELX_P2 AA2 THR A 119 ? GLU A 135 ? THR A 119 GLU A 135 1 ? 17 HELX_P HELX_P3 AA3 GLY B 24 ? LEU B 26 ? GLY B 24 LEU B 26 5 ? 3 HELX_P HELX_P4 AA4 THR B 119 ? GLU B 135 ? THR B 119 GLU B 135 1 ? 17 HELX_P HELX_P5 AA5 GLY C 24 ? LEU C 26 ? GLY C 24 LEU C 26 5 ? 3 HELX_P HELX_P6 AA6 THR C 119 ? GLU C 135 ? THR C 119 GLU C 135 1 ? 17 HELX_P HELX_P7 AA7 GLY D 24 ? LEU D 26 ? GLY D 24 LEU D 26 5 ? 3 HELX_P HELX_P8 AA8 THR D 119 ? GLU D 135 ? THR D 119 GLU D 135 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 5 ? AA4 ? 2 ? AA5 ? 4 ? AA6 ? 5 ? AA7 ? 2 ? AA8 ? 4 ? AA9 ? 5 ? AB1 ? 2 ? AB2 ? 4 ? AB3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA7 1 2 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA8 3 4 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AA9 3 4 ? anti-parallel AA9 4 5 ? anti-parallel AB1 1 2 ? anti-parallel AB2 1 2 ? anti-parallel AB2 2 3 ? anti-parallel AB2 3 4 ? anti-parallel AB3 1 2 ? anti-parallel AB3 2 3 ? anti-parallel AB3 3 4 ? anti-parallel AB3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 18 ? GLN A 22 ? THR A 18 GLN A 22 AA1 2 ASN A 79 ? PRO A 83 ? ASN A 79 PRO A 83 AA2 1 TYR A 31 ? ILE A 34 ? TYR A 31 ILE A 34 AA2 2 LYS A 37 ? SER A 47 ? LYS A 37 SER A 47 AA2 3 LYS A 56 ? ASP A 63 ? LYS A 56 ASP A 63 AA2 4 LYS A 69 ? PRO A 75 ? LYS A 69 PRO A 75 AA3 1 THR A 109 ? LYS A 114 ? THR A 109 LYS A 114 AA3 2 TYR A 99 ? MET A 103 ? TYR A 99 MET A 103 AA3 3 THR A 86 ? SER A 96 ? THR A 86 SER A 96 AA3 4 ASN A 140 ? ALA A 146 ? ASN A 140 ALA A 146 AA3 5 VAL A 149 ? LYS A 156 ? VAL A 149 LYS A 156 AA4 1 THR B 18 ? GLN B 22 ? THR B 18 GLN B 22 AA4 2 ASN B 79 ? PRO B 83 ? ASN B 79 PRO B 83 AA5 1 TYR B 31 ? ILE B 34 ? TYR B 31 ILE B 34 AA5 2 LYS B 37 ? SER B 47 ? LYS B 37 SER B 47 AA5 3 LYS B 56 ? ASP B 63 ? LYS B 56 ASP B 63 AA5 4 LYS B 69 ? PRO B 75 ? LYS B 69 PRO B 75 AA6 1 THR B 109 ? LYS B 114 ? THR B 109 LYS B 114 AA6 2 TYR B 99 ? MET B 103 ? TYR B 99 MET B 103 AA6 3 THR B 86 ? SER B 96 ? THR B 86 SER B 96 AA6 4 ASN B 140 ? ALA B 146 ? ASN B 140 ALA B 146 AA6 5 VAL B 149 ? LYS B 156 ? VAL B 149 LYS B 156 AA7 1 THR C 18 ? GLN C 22 ? THR C 18 GLN C 22 AA7 2 ASN C 79 ? PRO C 83 ? ASN C 79 PRO C 83 AA8 1 TYR C 31 ? ILE C 34 ? TYR C 31 ILE C 34 AA8 2 LYS C 37 ? THR C 45 ? LYS C 37 THR C 45 AA8 3 ALA C 57 ? ASP C 63 ? ALA C 57 ASP C 63 AA8 4 LYS C 69 ? CYS C 74 ? LYS C 69 CYS C 74 AA9 1 THR C 109 ? LYS C 114 ? THR C 109 LYS C 114 AA9 2 TYR C 99 ? MET C 103 ? TYR C 99 MET C 103 AA9 3 THR C 86 ? SER C 96 ? THR C 86 SER C 96 AA9 4 ASN C 140 ? ALA C 146 ? ASN C 140 ALA C 146 AA9 5 VAL C 149 ? LYS C 156 ? VAL C 149 LYS C 156 AB1 1 THR D 18 ? GLN D 22 ? THR D 18 GLN D 22 AB1 2 ASN D 79 ? PRO D 83 ? ASN D 79 PRO D 83 AB2 1 TYR D 31 ? ILE D 34 ? TYR D 31 ILE D 34 AB2 2 LYS D 37 ? THR D 45 ? LYS D 37 THR D 45 AB2 3 ALA D 57 ? ASP D 63 ? ALA D 57 ASP D 63 AB2 4 LYS D 69 ? CYS D 74 ? LYS D 69 CYS D 74 AB3 1 THR D 109 ? LYS D 114 ? THR D 109 LYS D 114 AB3 2 TYR D 99 ? MET D 103 ? TYR D 99 MET D 103 AB3 3 THR D 86 ? SER D 96 ? THR D 86 SER D 96 AB3 4 ASN D 140 ? ALA D 146 ? ASN D 140 ALA D 146 AB3 5 VAL D 149 ? LYS D 156 ? VAL D 149 LYS D 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 21 ? N MET A 21 O MET A 80 ? O MET A 80 AA2 1 2 N VAL A 32 ? N VAL A 32 O CYS A 39 ? O CYS A 39 AA2 2 3 N THR A 45 ? N THR A 45 O ASN A 58 ? O ASN A 58 AA2 3 4 N ILE A 59 ? N ILE A 59 O ASP A 72 ? O ASP A 72 AA3 1 2 O LEU A 113 ? O LEU A 113 N VAL A 100 ? N VAL A 100 AA3 2 3 O TYR A 99 ? O TYR A 99 N SER A 96 ? N SER A 96 AA3 3 4 N ASN A 88 ? N ASN A 88 O VAL A 143 ? O VAL A 143 AA3 4 5 N ASN A 140 ? N ASN A 140 O LYS A 156 ? O LYS A 156 AA4 1 2 N MET B 21 ? N MET B 21 O MET B 80 ? O MET B 80 AA5 1 2 N VAL B 32 ? N VAL B 32 O CYS B 39 ? O CYS B 39 AA5 2 3 N THR B 45 ? N THR B 45 O ASN B 58 ? O ASN B 58 AA5 3 4 N ILE B 59 ? N ILE B 59 O ASP B 72 ? O ASP B 72 AA6 1 2 O LEU B 113 ? O LEU B 113 N VAL B 100 ? N VAL B 100 AA6 2 3 O SER B 101 ? O SER B 101 N ILE B 93 ? N ILE B 93 AA6 3 4 N ASN B 88 ? N ASN B 88 O VAL B 143 ? O VAL B 143 AA6 4 5 N ALA B 146 ? N ALA B 146 O VAL B 149 ? O VAL B 149 AA7 1 2 N MET C 21 ? N MET C 21 O MET C 80 ? O MET C 80 AA8 1 2 N VAL C 32 ? N VAL C 32 O CYS C 39 ? O CYS C 39 AA8 2 3 N THR C 45 ? N THR C 45 O ASN C 58 ? O ASN C 58 AA8 3 4 N ALA C 57 ? N ALA C 57 O CYS C 74 ? O CYS C 74 AA9 1 2 O LEU C 113 ? O LEU C 113 N VAL C 100 ? N VAL C 100 AA9 2 3 O TYR C 99 ? O TYR C 99 N SER C 96 ? N SER C 96 AA9 3 4 N ASN C 88 ? N ASN C 88 O VAL C 143 ? O VAL C 143 AA9 4 5 N MET C 144 ? N MET C 144 O LYS C 151 ? O LYS C 151 AB1 1 2 N MET D 21 ? N MET D 21 O MET D 80 ? O MET D 80 AB2 1 2 N VAL D 32 ? N VAL D 32 O CYS D 39 ? O CYS D 39 AB2 2 3 N THR D 45 ? N THR D 45 O ASN D 58 ? O ASN D 58 AB2 3 4 N ALA D 57 ? N ALA D 57 O CYS D 74 ? O CYS D 74 AB3 1 2 O LEU D 113 ? O LEU D 113 N VAL D 100 ? N VAL D 100 AB3 2 3 O TYR D 99 ? O TYR D 99 N SER D 96 ? N SER D 96 AB3 3 4 N ASN D 88 ? N ASN D 88 O VAL D 143 ? O VAL D 143 AB3 4 5 N ASN D 140 ? N ASN D 140 O LYS D 156 ? O LYS D 156 # _atom_sites.entry_id 7N4D _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017370 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001083 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016966 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009790 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 PHE 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 MET 144 144 144 MET MET A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 MET 147 147 147 MET MET A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LEU 157 157 157 LEU LEU A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 SER 2 2 ? ? ? B . n B 1 3 ASP 3 3 ? ? ? B . n B 1 4 GLU 4 4 ? ? ? B . n B 1 5 ASP 5 5 ? ? ? B . n B 1 6 GLN 6 6 ? ? ? B . n B 1 7 THR 7 7 ? ? ? B . n B 1 8 PHE 8 8 ? ? ? B . n B 1 9 GLU 9 9 ? ? ? B . n B 1 10 SER 10 10 ? ? ? B . n B 1 11 ALA 11 11 ? ? ? B . n B 1 12 SER 12 12 ? ? ? B . n B 1 13 SER 13 13 ? ? ? B . n B 1 14 GLY 14 14 ? ? ? B . n B 1 15 ALA 15 15 ? ? ? B . n B 1 16 SER 16 16 16 SER SER B . n B 1 17 HIS 17 17 17 HIS HIS B . n B 1 18 THR 18 18 18 THR THR B . n B 1 19 TYR 19 19 19 TYR TYR B . n B 1 20 PRO 20 20 20 PRO PRO B . n B 1 21 MET 21 21 21 MET MET B . n B 1 22 GLN 22 22 22 GLN GLN B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 GLY 24 24 24 GLY GLY B . n B 1 25 ASN 25 25 25 ASN ASN B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLY 29 29 29 GLY GLY B . n B 1 30 GLY 30 30 30 GLY GLY B . n B 1 31 TYR 31 31 31 TYR TYR B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 LYS 37 37 37 LYS LYS B . n B 1 38 PRO 38 38 38 PRO PRO B . n B 1 39 CYS 39 39 39 CYS CYS B . n B 1 40 LYS 40 40 40 LYS LYS B . n B 1 41 ILE 41 41 41 ILE ILE B . n B 1 42 THR 42 42 42 THR THR B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 THR 45 45 45 THR THR B . n B 1 46 THR 46 46 46 THR THR B . n B 1 47 SER 47 47 47 SER SER B . n B 1 48 LYS 48 48 48 LYS LYS B . n B 1 49 THR 49 49 49 THR THR B . n B 1 50 GLY 50 50 50 GLY GLY B . n B 1 51 LYS 51 51 51 LYS LYS B . n B 1 52 HIS 52 52 52 HIS HIS B . n B 1 53 GLY 53 53 53 GLY GLY B . n B 1 54 HIS 54 54 54 HIS HIS B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 LYS 56 56 56 LYS LYS B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 ASN 58 58 58 ASN ASN B . n B 1 59 ILE 59 59 59 ILE ILE B . n B 1 60 THR 60 60 60 THR THR B . n B 1 61 GLY 61 61 61 GLY GLY B . n B 1 62 ILE 62 62 62 ILE ILE B . n B 1 63 ASP 63 63 63 ASP ASP B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 PHE 65 65 65 PHE PHE B . n B 1 66 THR 66 66 66 THR THR B . n B 1 67 GLY 67 67 67 GLY GLY B . n B 1 68 LYS 68 68 68 LYS LYS B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 TYR 70 70 70 TYR TYR B . n B 1 71 GLU 71 71 71 GLU GLU B . n B 1 72 ASP 72 72 72 ASP ASP B . n B 1 73 VAL 73 73 73 VAL VAL B . n B 1 74 CYS 74 74 74 CYS CYS B . n B 1 75 PRO 75 75 75 PRO PRO B . n B 1 76 THR 76 76 76 THR THR B . n B 1 77 SER 77 77 77 SER SER B . n B 1 78 HIS 78 78 78 HIS HIS B . n B 1 79 ASN 79 79 79 ASN ASN B . n B 1 80 MET 80 80 80 MET MET B . n B 1 81 PRO 81 81 81 PRO PRO B . n B 1 82 VAL 82 82 82 VAL VAL B . n B 1 83 PRO 83 83 83 PRO PRO B . n B 1 84 ASN 84 84 84 ASN ASN B . n B 1 85 VAL 85 85 85 VAL VAL B . n B 1 86 THR 86 86 86 THR THR B . n B 1 87 ARG 87 87 87 ARG ARG B . n B 1 88 ASN 88 88 88 ASN ASN B . n B 1 89 GLU 89 89 89 GLU GLU B . n B 1 90 TYR 90 90 90 TYR TYR B . n B 1 91 GLN 91 91 91 GLN GLN B . n B 1 92 VAL 92 92 92 VAL VAL B . n B 1 93 ILE 93 93 93 ILE ILE B . n B 1 94 ASP 94 94 94 ASP ASP B . n B 1 95 ILE 95 95 95 ILE ILE B . n B 1 96 SER 96 96 96 SER SER B . n B 1 97 GLY 97 97 97 GLY GLY B . n B 1 98 GLU 98 98 98 GLU GLU B . n B 1 99 TYR 99 99 99 TYR TYR B . n B 1 100 VAL 100 100 100 VAL VAL B . n B 1 101 SER 101 101 101 SER SER B . n B 1 102 ILE 102 102 102 ILE ILE B . n B 1 103 MET 103 103 103 MET MET B . n B 1 104 LEU 104 104 104 LEU LEU B . n B 1 105 GLU 105 105 105 GLU GLU B . n B 1 106 ASP 106 106 106 ASP ASP B . n B 1 107 GLY 107 107 107 GLY GLY B . n B 1 108 SER 108 108 108 SER SER B . n B 1 109 THR 109 109 109 THR THR B . n B 1 110 ARG 110 110 110 ARG ARG B . n B 1 111 ASP 111 111 111 ASP ASP B . n B 1 112 ASP 112 112 112 ASP ASP B . n B 1 113 LEU 113 113 113 LEU LEU B . n B 1 114 LYS 114 114 114 LYS LYS B . n B 1 115 LEU 115 115 115 LEU LEU B . n B 1 116 PRO 116 116 116 PRO PRO B . n B 1 117 ASN 117 117 117 ASN ASN B . n B 1 118 GLU 118 118 118 GLU GLU B . n B 1 119 THR 119 119 119 THR THR B . n B 1 120 GLU 120 120 120 GLU GLU B . n B 1 121 GLU 121 121 121 GLU GLU B . n B 1 122 ASP 122 122 122 ASP ASP B . n B 1 123 LYS 123 123 123 LYS LYS B . n B 1 124 THR 124 124 124 THR THR B . n B 1 125 LEU 125 125 125 LEU LEU B . n B 1 126 ALA 126 126 126 ALA ALA B . n B 1 127 GLU 127 127 127 GLU GLU B . n B 1 128 LYS 128 128 128 LYS LYS B . n B 1 129 ILE 129 129 129 ILE ILE B . n B 1 130 LYS 130 130 130 LYS LYS B . n B 1 131 ALA 131 131 131 ALA ALA B . n B 1 132 ALA 132 132 132 ALA ALA B . n B 1 133 PHE 133 133 133 PHE PHE B . n B 1 134 ASP 134 134 134 ASP ASP B . n B 1 135 GLU 135 135 135 GLU GLU B . n B 1 136 GLY 136 136 136 GLY GLY B . n B 1 137 ALA 137 137 137 ALA ALA B . n B 1 138 GLU 138 138 138 GLU GLU B . n B 1 139 PHE 139 139 139 PHE PHE B . n B 1 140 ASN 140 140 140 ASN ASN B . n B 1 141 VAL 141 141 141 VAL VAL B . n B 1 142 ILE 142 142 142 ILE ILE B . n B 1 143 VAL 143 143 143 VAL VAL B . n B 1 144 MET 144 144 144 MET MET B . n B 1 145 SER 145 145 145 SER SER B . n B 1 146 ALA 146 146 146 ALA ALA B . n B 1 147 MET 147 147 147 MET MET B . n B 1 148 GLY 148 148 148 GLY GLY B . n B 1 149 VAL 149 149 149 VAL VAL B . n B 1 150 GLU 150 150 150 GLU GLU B . n B 1 151 LYS 151 151 151 LYS LYS B . n B 1 152 ILE 152 152 152 ILE ILE B . n B 1 153 VAL 153 153 153 VAL VAL B . n B 1 154 GLU 154 154 154 GLU GLU B . n B 1 155 MET 155 155 155 MET MET B . n B 1 156 LYS 156 156 156 LYS LYS B . n B 1 157 LEU 157 157 157 LEU LEU B . n C 1 1 MET 1 1 ? ? ? C . n C 1 2 SER 2 2 ? ? ? C . n C 1 3 ASP 3 3 ? ? ? C . n C 1 4 GLU 4 4 ? ? ? C . n C 1 5 ASP 5 5 ? ? ? C . n C 1 6 GLN 6 6 ? ? ? C . n C 1 7 THR 7 7 ? ? ? C . n C 1 8 PHE 8 8 ? ? ? C . n C 1 9 GLU 9 9 ? ? ? C . n C 1 10 SER 10 10 ? ? ? C . n C 1 11 ALA 11 11 ? ? ? C . n C 1 12 SER 12 12 ? ? ? C . n C 1 13 SER 13 13 ? ? ? C . n C 1 14 GLY 14 14 ? ? ? C . n C 1 15 ALA 15 15 ? ? ? C . n C 1 16 SER 16 16 16 SER SER C . n C 1 17 HIS 17 17 17 HIS HIS C . n C 1 18 THR 18 18 18 THR THR C . n C 1 19 TYR 19 19 19 TYR TYR C . n C 1 20 PRO 20 20 20 PRO PRO C . n C 1 21 MET 21 21 21 MET MET C . n C 1 22 GLN 22 22 22 GLN GLN C . n C 1 23 ALA 23 23 23 ALA ALA C . n C 1 24 GLY 24 24 24 GLY GLY C . n C 1 25 ASN 25 25 25 ASN ASN C . n C 1 26 LEU 26 26 26 LEU LEU C . n C 1 27 LYS 27 27 27 LYS LYS C . n C 1 28 LYS 28 28 28 LYS LYS C . n C 1 29 GLY 29 29 29 GLY GLY C . n C 1 30 GLY 30 30 30 GLY GLY C . n C 1 31 TYR 31 31 31 TYR TYR C . n C 1 32 VAL 32 32 32 VAL VAL C . n C 1 33 VAL 33 33 33 VAL VAL C . n C 1 34 ILE 34 34 34 ILE ILE C . n C 1 35 LYS 35 35 35 LYS LYS C . n C 1 36 ASP 36 36 36 ASP ASP C . n C 1 37 LYS 37 37 37 LYS LYS C . n C 1 38 PRO 38 38 38 PRO PRO C . n C 1 39 CYS 39 39 39 CYS CYS C . n C 1 40 LYS 40 40 40 LYS LYS C . n C 1 41 ILE 41 41 41 ILE ILE C . n C 1 42 THR 42 42 42 THR THR C . n C 1 43 GLU 43 43 43 GLU GLU C . n C 1 44 VAL 44 44 44 VAL VAL C . n C 1 45 THR 45 45 45 THR THR C . n C 1 46 THR 46 46 46 THR THR C . n C 1 47 SER 47 47 47 SER SER C . n C 1 48 LYS 48 48 ? ? ? C . n C 1 49 THR 49 49 ? ? ? C . n C 1 50 GLY 50 50 ? ? ? C . n C 1 51 LYS 51 51 ? ? ? C . n C 1 52 HIS 52 52 ? ? ? C . n C 1 53 GLY 53 53 ? ? ? C . n C 1 54 HIS 54 54 ? ? ? C . n C 1 55 ALA 55 55 ? ? ? C . n C 1 56 LYS 56 56 56 LYS LYS C . n C 1 57 ALA 57 57 57 ALA ALA C . n C 1 58 ASN 58 58 58 ASN ASN C . n C 1 59 ILE 59 59 59 ILE ILE C . n C 1 60 THR 60 60 60 THR THR C . n C 1 61 GLY 61 61 61 GLY GLY C . n C 1 62 ILE 62 62 62 ILE ILE C . n C 1 63 ASP 63 63 63 ASP ASP C . n C 1 64 ILE 64 64 64 ILE ILE C . n C 1 65 PHE 65 65 65 PHE PHE C . n C 1 66 THR 66 66 66 THR THR C . n C 1 67 GLY 67 67 67 GLY GLY C . n C 1 68 LYS 68 68 68 LYS LYS C . n C 1 69 LYS 69 69 69 LYS LYS C . n C 1 70 TYR 70 70 70 TYR TYR C . n C 1 71 GLU 71 71 71 GLU GLU C . n C 1 72 ASP 72 72 72 ASP ASP C . n C 1 73 VAL 73 73 73 VAL VAL C . n C 1 74 CYS 74 74 74 CYS CYS C . n C 1 75 PRO 75 75 75 PRO PRO C . n C 1 76 THR 76 76 76 THR THR C . n C 1 77 SER 77 77 77 SER SER C . n C 1 78 HIS 78 78 78 HIS HIS C . n C 1 79 ASN 79 79 79 ASN ASN C . n C 1 80 MET 80 80 80 MET MET C . n C 1 81 PRO 81 81 81 PRO PRO C . n C 1 82 VAL 82 82 82 VAL VAL C . n C 1 83 PRO 83 83 83 PRO PRO C . n C 1 84 ASN 84 84 84 ASN ASN C . n C 1 85 VAL 85 85 85 VAL VAL C . n C 1 86 THR 86 86 86 THR THR C . n C 1 87 ARG 87 87 87 ARG ARG C . n C 1 88 ASN 88 88 88 ASN ASN C . n C 1 89 GLU 89 89 89 GLU GLU C . n C 1 90 TYR 90 90 90 TYR TYR C . n C 1 91 GLN 91 91 91 GLN GLN C . n C 1 92 VAL 92 92 92 VAL VAL C . n C 1 93 ILE 93 93 93 ILE ILE C . n C 1 94 ASP 94 94 94 ASP ASP C . n C 1 95 ILE 95 95 95 ILE ILE C . n C 1 96 SER 96 96 96 SER SER C . n C 1 97 GLY 97 97 97 GLY GLY C . n C 1 98 GLU 98 98 98 GLU GLU C . n C 1 99 TYR 99 99 99 TYR TYR C . n C 1 100 VAL 100 100 100 VAL VAL C . n C 1 101 SER 101 101 101 SER SER C . n C 1 102 ILE 102 102 102 ILE ILE C . n C 1 103 MET 103 103 103 MET MET C . n C 1 104 LEU 104 104 104 LEU LEU C . n C 1 105 GLU 105 105 105 GLU GLU C . n C 1 106 ASP 106 106 106 ASP ASP C . n C 1 107 GLY 107 107 107 GLY GLY C . n C 1 108 SER 108 108 108 SER SER C . n C 1 109 THR 109 109 109 THR THR C . n C 1 110 ARG 110 110 110 ARG ARG C . n C 1 111 ASP 111 111 111 ASP ASP C . n C 1 112 ASP 112 112 112 ASP ASP C . n C 1 113 LEU 113 113 113 LEU LEU C . n C 1 114 LYS 114 114 114 LYS LYS C . n C 1 115 LEU 115 115 115 LEU LEU C . n C 1 116 PRO 116 116 116 PRO PRO C . n C 1 117 ASN 117 117 117 ASN ASN C . n C 1 118 GLU 118 118 118 GLU GLU C . n C 1 119 THR 119 119 119 THR THR C . n C 1 120 GLU 120 120 120 GLU GLU C . n C 1 121 GLU 121 121 121 GLU GLU C . n C 1 122 ASP 122 122 122 ASP ASP C . n C 1 123 LYS 123 123 123 LYS LYS C . n C 1 124 THR 124 124 124 THR THR C . n C 1 125 LEU 125 125 125 LEU LEU C . n C 1 126 ALA 126 126 126 ALA ALA C . n C 1 127 GLU 127 127 127 GLU GLU C . n C 1 128 LYS 128 128 128 LYS LYS C . n C 1 129 ILE 129 129 129 ILE ILE C . n C 1 130 LYS 130 130 130 LYS LYS C . n C 1 131 ALA 131 131 131 ALA ALA C . n C 1 132 ALA 132 132 132 ALA ALA C . n C 1 133 PHE 133 133 133 PHE PHE C . n C 1 134 ASP 134 134 134 ASP ASP C . n C 1 135 GLU 135 135 135 GLU GLU C . n C 1 136 GLY 136 136 136 GLY GLY C . n C 1 137 ALA 137 137 137 ALA ALA C . n C 1 138 GLU 138 138 138 GLU GLU C . n C 1 139 PHE 139 139 139 PHE PHE C . n C 1 140 ASN 140 140 140 ASN ASN C . n C 1 141 VAL 141 141 141 VAL VAL C . n C 1 142 ILE 142 142 142 ILE ILE C . n C 1 143 VAL 143 143 143 VAL VAL C . n C 1 144 MET 144 144 144 MET MET C . n C 1 145 SER 145 145 145 SER SER C . n C 1 146 ALA 146 146 146 ALA ALA C . n C 1 147 MET 147 147 147 MET MET C . n C 1 148 GLY 148 148 148 GLY GLY C . n C 1 149 VAL 149 149 149 VAL VAL C . n C 1 150 GLU 150 150 150 GLU GLU C . n C 1 151 LYS 151 151 151 LYS LYS C . n C 1 152 ILE 152 152 152 ILE ILE C . n C 1 153 VAL 153 153 153 VAL VAL C . n C 1 154 GLU 154 154 154 GLU GLU C . n C 1 155 MET 155 155 155 MET MET C . n C 1 156 LYS 156 156 156 LYS LYS C . n C 1 157 LEU 157 157 157 LEU LEU C . n D 1 1 MET 1 1 ? ? ? D . n D 1 2 SER 2 2 ? ? ? D . n D 1 3 ASP 3 3 ? ? ? D . n D 1 4 GLU 4 4 ? ? ? D . n D 1 5 ASP 5 5 ? ? ? D . n D 1 6 GLN 6 6 ? ? ? D . n D 1 7 THR 7 7 ? ? ? D . n D 1 8 PHE 8 8 ? ? ? D . n D 1 9 GLU 9 9 ? ? ? D . n D 1 10 SER 10 10 ? ? ? D . n D 1 11 ALA 11 11 ? ? ? D . n D 1 12 SER 12 12 ? ? ? D . n D 1 13 SER 13 13 ? ? ? D . n D 1 14 GLY 14 14 ? ? ? D . n D 1 15 ALA 15 15 ? ? ? D . n D 1 16 SER 16 16 16 SER SER D . n D 1 17 HIS 17 17 17 HIS HIS D . n D 1 18 THR 18 18 18 THR THR D . n D 1 19 TYR 19 19 19 TYR TYR D . n D 1 20 PRO 20 20 20 PRO PRO D . n D 1 21 MET 21 21 21 MET MET D . n D 1 22 GLN 22 22 22 GLN GLN D . n D 1 23 ALA 23 23 23 ALA ALA D . n D 1 24 GLY 24 24 24 GLY GLY D . n D 1 25 ASN 25 25 25 ASN ASN D . n D 1 26 LEU 26 26 26 LEU LEU D . n D 1 27 LYS 27 27 27 LYS LYS D . n D 1 28 LYS 28 28 28 LYS LYS D . n D 1 29 GLY 29 29 29 GLY GLY D . n D 1 30 GLY 30 30 30 GLY GLY D . n D 1 31 TYR 31 31 31 TYR TYR D . n D 1 32 VAL 32 32 32 VAL VAL D . n D 1 33 VAL 33 33 33 VAL VAL D . n D 1 34 ILE 34 34 34 ILE ILE D . n D 1 35 LYS 35 35 35 LYS LYS D . n D 1 36 ASP 36 36 36 ASP ASP D . n D 1 37 LYS 37 37 37 LYS LYS D . n D 1 38 PRO 38 38 38 PRO PRO D . n D 1 39 CYS 39 39 39 CYS CYS D . n D 1 40 LYS 40 40 40 LYS LYS D . n D 1 41 ILE 41 41 41 ILE ILE D . n D 1 42 THR 42 42 42 THR THR D . n D 1 43 GLU 43 43 43 GLU GLU D . n D 1 44 VAL 44 44 44 VAL VAL D . n D 1 45 THR 45 45 45 THR THR D . n D 1 46 THR 46 46 46 THR THR D . n D 1 47 SER 47 47 ? ? ? D . n D 1 48 LYS 48 48 ? ? ? D . n D 1 49 THR 49 49 ? ? ? D . n D 1 50 GLY 50 50 ? ? ? D . n D 1 51 LYS 51 51 ? ? ? D . n D 1 52 HIS 52 52 ? ? ? D . n D 1 53 GLY 53 53 ? ? ? D . n D 1 54 HIS 54 54 ? ? ? D . n D 1 55 ALA 55 55 ? ? ? D . n D 1 56 LYS 56 56 56 LYS LYS D . n D 1 57 ALA 57 57 57 ALA ALA D . n D 1 58 ASN 58 58 58 ASN ASN D . n D 1 59 ILE 59 59 59 ILE ILE D . n D 1 60 THR 60 60 60 THR THR D . n D 1 61 GLY 61 61 61 GLY GLY D . n D 1 62 ILE 62 62 62 ILE ILE D . n D 1 63 ASP 63 63 63 ASP ASP D . n D 1 64 ILE 64 64 64 ILE ILE D . n D 1 65 PHE 65 65 65 PHE PHE D . n D 1 66 THR 66 66 66 THR THR D . n D 1 67 GLY 67 67 67 GLY GLY D . n D 1 68 LYS 68 68 68 LYS LYS D . n D 1 69 LYS 69 69 69 LYS LYS D . n D 1 70 TYR 70 70 70 TYR TYR D . n D 1 71 GLU 71 71 71 GLU GLU D . n D 1 72 ASP 72 72 72 ASP ASP D . n D 1 73 VAL 73 73 73 VAL VAL D . n D 1 74 CYS 74 74 74 CYS CYS D . n D 1 75 PRO 75 75 75 PRO PRO D . n D 1 76 THR 76 76 76 THR THR D . n D 1 77 SER 77 77 77 SER SER D . n D 1 78 HIS 78 78 78 HIS HIS D . n D 1 79 ASN 79 79 79 ASN ASN D . n D 1 80 MET 80 80 80 MET MET D . n D 1 81 PRO 81 81 81 PRO PRO D . n D 1 82 VAL 82 82 82 VAL VAL D . n D 1 83 PRO 83 83 83 PRO PRO D . n D 1 84 ASN 84 84 84 ASN ASN D . n D 1 85 VAL 85 85 85 VAL VAL D . n D 1 86 THR 86 86 86 THR THR D . n D 1 87 ARG 87 87 87 ARG ARG D . n D 1 88 ASN 88 88 88 ASN ASN D . n D 1 89 GLU 89 89 89 GLU GLU D . n D 1 90 TYR 90 90 90 TYR TYR D . n D 1 91 GLN 91 91 91 GLN GLN D . n D 1 92 VAL 92 92 92 VAL VAL D . n D 1 93 ILE 93 93 93 ILE ILE D . n D 1 94 ASP 94 94 94 ASP ASP D . n D 1 95 ILE 95 95 95 ILE ILE D . n D 1 96 SER 96 96 96 SER SER D . n D 1 97 GLY 97 97 97 GLY GLY D . n D 1 98 GLU 98 98 98 GLU GLU D . n D 1 99 TYR 99 99 99 TYR TYR D . n D 1 100 VAL 100 100 100 VAL VAL D . n D 1 101 SER 101 101 101 SER SER D . n D 1 102 ILE 102 102 102 ILE ILE D . n D 1 103 MET 103 103 103 MET MET D . n D 1 104 LEU 104 104 104 LEU LEU D . n D 1 105 GLU 105 105 105 GLU GLU D . n D 1 106 ASP 106 106 106 ASP ASP D . n D 1 107 GLY 107 107 107 GLY GLY D . n D 1 108 SER 108 108 108 SER SER D . n D 1 109 THR 109 109 109 THR THR D . n D 1 110 ARG 110 110 110 ARG ARG D . n D 1 111 ASP 111 111 111 ASP ASP D . n D 1 112 ASP 112 112 112 ASP ASP D . n D 1 113 LEU 113 113 113 LEU LEU D . n D 1 114 LYS 114 114 114 LYS LYS D . n D 1 115 LEU 115 115 115 LEU LEU D . n D 1 116 PRO 116 116 116 PRO PRO D . n D 1 117 ASN 117 117 117 ASN ASN D . n D 1 118 GLU 118 118 118 GLU GLU D . n D 1 119 THR 119 119 119 THR THR D . n D 1 120 GLU 120 120 120 GLU GLU D . n D 1 121 GLU 121 121 121 GLU GLU D . n D 1 122 ASP 122 122 122 ASP ASP D . n D 1 123 LYS 123 123 123 LYS LYS D . n D 1 124 THR 124 124 124 THR THR D . n D 1 125 LEU 125 125 125 LEU LEU D . n D 1 126 ALA 126 126 126 ALA ALA D . n D 1 127 GLU 127 127 127 GLU GLU D . n D 1 128 LYS 128 128 128 LYS LYS D . n D 1 129 ILE 129 129 129 ILE ILE D . n D 1 130 LYS 130 130 130 LYS LYS D . n D 1 131 ALA 131 131 131 ALA ALA D . n D 1 132 ALA 132 132 132 ALA ALA D . n D 1 133 PHE 133 133 133 PHE PHE D . n D 1 134 ASP 134 134 134 ASP ASP D . n D 1 135 GLU 135 135 135 GLU GLU D . n D 1 136 GLY 136 136 136 GLY GLY D . n D 1 137 ALA 137 137 137 ALA ALA D . n D 1 138 GLU 138 138 138 GLU GLU D . n D 1 139 PHE 139 139 139 PHE PHE D . n D 1 140 ASN 140 140 140 ASN ASN D . n D 1 141 VAL 141 141 141 VAL VAL D . n D 1 142 ILE 142 142 142 ILE ILE D . n D 1 143 VAL 143 143 143 VAL VAL D . n D 1 144 MET 144 144 144 MET MET D . n D 1 145 SER 145 145 145 SER SER D . n D 1 146 ALA 146 146 146 ALA ALA D . n D 1 147 MET 147 147 147 MET MET D . n D 1 148 GLY 148 148 148 GLY GLY D . n D 1 149 VAL 149 149 149 VAL VAL D . n D 1 150 GLU 150 150 150 GLU GLU D . n D 1 151 LYS 151 151 151 LYS LYS D . n D 1 152 ILE 152 152 152 ILE ILE D . n D 1 153 VAL 153 153 153 VAL VAL D . n D 1 154 GLU 154 154 154 GLU GLU D . n D 1 155 MET 155 155 155 MET MET D . n D 1 156 LYS 156 156 156 LYS LYS D . n D 1 157 LEU 157 157 157 LEU LEU D . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 201 67 HOH HOH A . E 2 HOH 2 202 5 HOH HOH A . E 2 HOH 3 203 91 HOH HOH A . E 2 HOH 4 204 92 HOH HOH A . E 2 HOH 5 205 60 HOH HOH A . E 2 HOH 6 206 68 HOH HOH A . E 2 HOH 7 207 20 HOH HOH A . E 2 HOH 8 208 62 HOH HOH A . E 2 HOH 9 209 95 HOH HOH A . E 2 HOH 10 210 26 HOH HOH A . E 2 HOH 11 211 93 HOH HOH A . E 2 HOH 12 212 22 HOH HOH A . E 2 HOH 13 213 33 HOH HOH A . E 2 HOH 14 214 70 HOH HOH A . E 2 HOH 15 215 47 HOH HOH A . E 2 HOH 16 216 76 HOH HOH A . E 2 HOH 17 217 78 HOH HOH A . E 2 HOH 18 218 83 HOH HOH A . F 2 HOH 1 201 44 HOH HOH B . F 2 HOH 2 202 39 HOH HOH B . F 2 HOH 3 203 41 HOH HOH B . F 2 HOH 4 204 82 HOH HOH B . F 2 HOH 5 205 80 HOH HOH B . F 2 HOH 6 206 38 HOH HOH B . F 2 HOH 7 207 94 HOH HOH B . F 2 HOH 8 208 51 HOH HOH B . F 2 HOH 9 209 84 HOH HOH B . F 2 HOH 10 210 88 HOH HOH B . F 2 HOH 11 211 97 HOH HOH B . G 2 HOH 1 201 14 HOH HOH C . G 2 HOH 2 202 49 HOH HOH C . G 2 HOH 3 203 72 HOH HOH C . G 2 HOH 4 204 53 HOH HOH C . G 2 HOH 5 205 15 HOH HOH C . G 2 HOH 6 206 6 HOH HOH C . G 2 HOH 7 207 34 HOH HOH C . G 2 HOH 8 208 57 HOH HOH C . G 2 HOH 9 209 35 HOH HOH C . G 2 HOH 10 210 24 HOH HOH C . G 2 HOH 11 211 32 HOH HOH C . G 2 HOH 12 212 29 HOH HOH C . H 2 HOH 1 201 46 HOH HOH D . H 2 HOH 2 202 7 HOH HOH D . H 2 HOH 3 203 73 HOH HOH D . H 2 HOH 4 204 36 HOH HOH D . H 2 HOH 5 205 42 HOH HOH D . H 2 HOH 6 206 17 HOH HOH D . H 2 HOH 7 207 77 HOH HOH D . H 2 HOH 8 208 45 HOH HOH D . H 2 HOH 9 209 25 HOH HOH D . H 2 HOH 10 210 98 HOH HOH D . H 2 HOH 11 211 59 HOH HOH D . H 2 HOH 12 212 96 HOH HOH D . H 2 HOH 13 213 54 HOH HOH D . H 2 HOH 14 214 89 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 3 author_and_software_defined_assembly PISA monomeric 1 4 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E 2 1 B,F 3 1 C,G 4 1 D,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-23 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -9.5803 2.2577 34.6575 0.4252 ? 0.1257 ? -0.0195 ? 0.5338 ? 0.1265 ? 0.3881 ? 8.2449 ? 0.2785 ? 3.9278 ? 3.8541 ? -0.7409 ? 5.7208 ? -0.0148 ? -0.1892 ? -0.2750 ? -0.1509 ? 0.1694 ? 0.1877 ? -0.1469 ? 0.1694 ? -0.0763 ? 2 'X-RAY DIFFRACTION' ? refined -20.8482 0.7959 36.7389 0.3566 ? 0.0333 ? 0.0486 ? 0.8616 ? 0.1639 ? 0.6691 ? 3.4136 ? 0.7844 ? 4.1144 ? 2.1290 ? 0.9817 ? 5.0692 ? 0.0662 ? -0.8444 ? -0.2882 ? 0.0689 ? 0.3220 ? 0.5832 ? -0.2365 ? -0.4066 ? -0.2281 ? 3 'X-RAY DIFFRACTION' ? refined -12.0457 3.6236 39.7633 0.3244 ? 0.0665 ? 0.0064 ? 0.8897 ? 0.2074 ? 0.5031 ? 2.6440 ? -1.5850 ? 1.5141 ? 2.1366 ? -0.1584 ? 1.1517 ? -0.0566 ? -1.0589 ? -0.1011 ? 0.3437 ? 0.2786 ? 0.5037 ? -0.0651 ? -0.0524 ? 0.0131 ? 4 'X-RAY DIFFRACTION' ? refined 15.7888 -1.4415 46.6399 0.3047 ? -0.0667 ? -0.0772 ? 0.6198 ? -0.0568 ? 0.3132 ? 4.5827 ? -0.5926 ? 1.0171 ? 2.2135 ? -0.2563 ? 2.1882 ? -0.1790 ? -0.1136 ? -0.0109 ? 0.3818 ? -0.1209 ? -0.0863 ? 0.0030 ? 0.1691 ? 0.0052 ? 5 'X-RAY DIFFRACTION' ? refined 12.5075 -0.3553 51.4907 0.4040 ? 0.0124 ? -0.0608 ? 0.4752 ? -0.0062 ? 0.3738 ? 4.0048 ? -0.9586 ? 0.2697 ? 1.8314 ? 0.5236 ? 1.2325 ? -0.0060 ? -0.4682 ? 0.4395 ? 0.4356 ? 0.0692 ? -0.2985 ? -0.3213 ? -0.1878 ? 0.0341 ? 6 'X-RAY DIFFRACTION' ? refined 11.1204 -4.2810 46.9568 0.1946 ? 0.0037 ? 0.0266 ? 0.5760 ? 0.0957 ? 0.3672 ? 5.2485 ? -1.4756 ? 2.0918 ? 4.3521 ? 0.9702 ? 2.7184 ? -0.2114 ? -0.6628 ? 0.1705 ? 0.2094 ? 0.5427 ? 0.2361 ? 0.5403 ? -0.5645 ? -0.0542 ? 7 'X-RAY DIFFRACTION' ? refined 7.9553 -3.9738 47.9642 0.3699 ? -0.0252 ? -0.0170 ? 0.6661 ? 0.0936 ? 0.1738 ? 6.1584 ? -2.5519 ? 0.6128 ? 6.2465 ? -1.8306 ? 2.7551 ? 0.1932 ? -0.4794 ? 0.0521 ? -0.0974 ? -0.2730 ? 0.0329 ? 0.4143 ? -0.3779 ? 0.0234 ? 8 'X-RAY DIFFRACTION' ? refined -39.4092 15.3002 12.5208 0.3726 ? 0.0196 ? 0.0638 ? 0.7265 ? 0.2152 ? 0.5608 ? 9.2025 ? 1.2207 ? -5.4286 ? 2.1739 ? 0.0363 ? 6.3547 ? 0.0816 ? 1.2629 ? 0.7770 ? -0.2194 ? 0.0151 ? -0.1578 ? -0.1484 ? 0.0315 ? -0.1562 ? 9 'X-RAY DIFFRACTION' ? refined -13.0672 20.0923 1.5267 0.3672 ? -0.0033 ? 0.0922 ? 0.7483 ? -0.0444 ? 0.3918 ? 3.6134 ? 0.7226 ? 0.8923 ? 2.9482 ? 0.2631 ? 5.2818 ? -0.1419 ? 0.4573 ? -0.3598 ? -0.2532 ? 0.3277 ? -0.1204 ? -0.2870 ? 0.0593 ? -0.1076 ? 10 'X-RAY DIFFRACTION' ? refined 18.9981 -27.0821 37.4490 0.5966 ? 0.0623 ? -0.0356 ? 0.6109 ? 0.1393 ? 0.4787 ? 6.6434 ? -6.0741 ? 5.4867 ? 5.4823 ? -4.6094 ? 5.7488 ? 0.6527 ? -0.0858 ? -0.6259 ? -0.6201 ? 0.0502 ? 0.6326 ? 0.4177 ? -0.5533 ? -0.6390 ? 11 'X-RAY DIFFRACTION' ? refined 12.4636 -3.8361 25.3207 0.3358 ? 0.0608 ? 0.0657 ? 0.5914 ? 0.0484 ? 0.3072 ? 1.9847 ? -0.1979 ? 0.5565 ? 5.4446 ? -1.1045 ? 4.4252 ? 0.1938 ? 0.4565 ? 0.1435 ? -0.7918 ? -0.4315 ? -0.2527 ? 0.2870 ? -0.0765 ? 0.3001 ? 12 'X-RAY DIFFRACTION' ? refined -5.8908 -17.5333 5.6878 0.8374 ? -0.3528 ? -0.0619 ? 1.1262 ? 0.3568 ? 0.7559 ? 4.9544 ? 0.0689 ? -1.5502 ? 7.1581 ? -0.5727 ? 3.7682 ? -1.2347 ? 1.1728 ? 0.3296 ? -1.1776 ? 0.6128 ? 0.1035 ? -0.0234 ? -0.0122 ? 0.1773 ? 13 'X-RAY DIFFRACTION' ? refined -7.0190 -15.5525 14.0322 0.4598 ? -0.1122 ? 0.0490 ? 1.0173 ? 0.3255 ? 0.8149 ? 8.2987 ? 1.8655 ? -2.0081 ? 4.7622 ? -1.1316 ? 4.6730 ? 0.0108 ? 0.3601 ? 1.3773 ? -0.5248 ? 0.5601 ? 0.6281 ? -0.3656 ? -0.1042 ? 0.1364 ? 14 'X-RAY DIFFRACTION' ? refined -7.2281 -14.0293 18.9796 0.5398 ? -0.1983 ? 0.1126 ? 0.6916 ? 0.1246 ? 0.6882 ? 3.2469 ? 2.5202 ? -1.0129 ? 3.6482 ? -1.1038 ? 3.9951 ? -0.0005 ? 0.4901 ? 0.9870 ? 1.3769 ? 0.2184 ? 1.4398 ? 0.0201 ? 0.0285 ? 0.0698 ? 15 'X-RAY DIFFRACTION' ? refined -3.4279 -12.4161 11.9936 0.7056 ? -0.1634 ? -0.1073 ? 1.0626 ? 0.3444 ? 0.5796 ? 4.0344 ? 2.5533 ? -1.8012 ? 4.4232 ? -0.1791 ? 1.1157 ? -0.0228 ? -0.0185 ? 0.5613 ? -0.7993 ? 0.4279 ? -0.1372 ? -0.8713 ? -0.1530 ? -0.0842 ? 16 'X-RAY DIFFRACTION' ? refined -12.1841 -41.1548 22.9186 0.3036 ? 0.0170 ? -0.0725 ? 0.7113 ? 0.0444 ? 0.2887 ? 3.8878 ? 0.6434 ? 0.2784 ? 7.2010 ? -1.9432 ? 2.6545 ? -0.0073 ? -0.3678 ? -0.1983 ? 0.2460 ? 0.1190 ? -0.0248 ? -0.0450 ? -0.3052 ? 0.0101 ? 17 'X-RAY DIFFRACTION' ? refined -8.5334 -39.8204 21.9886 0.3538 ? -0.0047 ? 0.0425 ? 0.5949 ? 0.0186 ? 0.3526 ? 3.1180 ? 0.6163 ? -0.4082 ? 6.4941 ? 0.9585 ? 1.5823 ? 0.2162 ? -0.0305 ? -0.0624 ? 0.1698 ? 0.1426 ? -0.6526 ? -0.3611 ? 0.1126 ? -0.0140 ? 18 'X-RAY DIFFRACTION' ? refined -14.8811 -36.4302 34.1288 0.6337 ? -0.0626 ? 0.0053 ? 0.6986 ? 0.0094 ? 0.3295 ? 2.7988 ? 1.9453 ? 0.6047 ? 2.9001 ? 0.1331 ? 0.9197 ? 0.1908 ? -0.7272 ? -0.4446 ? 1.7474 ? -0.1165 ? -0.4286 ? -0.1337 ? -0.1353 ? -0.0247 ? 19 'X-RAY DIFFRACTION' ? refined -14.2623 -35.5685 21.5984 0.3705 ? -0.0501 ? -0.0117 ? 0.5481 ? 0.0458 ? 0.2700 ? 4.4687 ? 1.2374 ? -0.2139 ? 4.1766 ? -1.5285 ? 2.5964 ? 0.0349 ? 0.3560 ? 0.6485 ? 0.0868 ? 0.4098 ? 0.5389 ? -0.5756 ? 0.0188 ? -0.0051 ? 20 'X-RAY DIFFRACTION' ? refined -14.6380 -33.1462 23.8501 0.3585 ? 0.0432 ? -0.0246 ? 0.7072 ? 0.1251 ? 0.3572 ? 7.0100 ? 1.6102 ? -1.8156 ? 6.9176 ? -0.9693 ? 3.7637 ? 0.4345 ? -0.7242 ? 0.2088 ? -0.0629 ? -0.3494 ? 0.3638 ? -0.3255 ? 0.4293 ? 0.0494 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 16 ? ? ? A 36 ? ? ;chain 'A' and (resid 16 through 36 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 37 ? ? ? A 55 ? ? ;chain 'A' and (resid 37 through 55 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 56 ? ? ? A 85 ? ? ;chain 'A' and (resid 56 through 85 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 86 ? ? ? A 103 ? ? ;chain 'A' and (resid 86 through 103 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 104 ? ? ? A 134 ? ? ;chain 'A' and (resid 104 through 134 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 135 ? ? ? A 148 ? ? ;chain 'A' and (resid 135 through 148 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 149 ? ? ? A 157 ? ? ;chain 'A' and (resid 149 through 157 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 16 ? ? ? B 85 ? ? ;chain 'B' and (resid 16 through 85 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 86 ? ? ? B 157 ? ? ;chain 'B' and (resid 86 through 157 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? C 16 ? ? ? C 85 ? ? ;chain 'C' and (resid 16 through 85 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? C 86 ? ? ? C 157 ? ? ;chain 'C' and (resid 86 through 157 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? D 16 ? ? ? D 25 ? ? ;chain 'D' and (resid 16 through 25 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? D 26 ? ? ? D 36 ? ? ;chain 'D' and (resid 26 through 36 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? D 37 ? ? ? D 68 ? ? ;chain 'D' and (resid 37 through 68 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? D 69 ? ? ? D 85 ? ? ;chain 'D' and (resid 69 through 85 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? D 86 ? ? ? D 103 ? ? ;chain 'D' and (resid 86 through 103 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? D 104 ? ? ? D 119 ? ? ;chain 'D' and (resid 104 through 119 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? D 120 ? ? ? D 135 ? ? ;chain 'D' and (resid 120 through 135 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? D 136 ? ? ? D 148 ? ? ;chain 'D' and (resid 136 through 148 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? D 149 ? ? ? D 157 ? ? ;chain 'D' and (resid 149 through 157 ) ; # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MoRDa ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLY 50 ? ? O A HOH 201 ? ? 2.12 2 1 O B THR 66 ? ? O B HOH 201 ? ? 2.13 3 1 NZ D LYS 35 ? ? O D GLU 71 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 47 ? ? -172.29 130.81 2 1 ASN A 117 ? ? -145.71 13.76 3 1 ASN B 117 ? ? -146.19 13.44 4 1 ASN C 117 ? ? -147.90 11.67 5 1 ASN D 117 ? ? -146.80 10.70 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 19 ? OH ? A TYR 19 OH 2 1 Y 1 A LYS 27 ? CG ? A LYS 27 CG 3 1 Y 1 A LYS 27 ? CD ? A LYS 27 CD 4 1 Y 1 A LYS 27 ? CE ? A LYS 27 CE 5 1 Y 1 A LYS 27 ? NZ ? A LYS 27 NZ 6 1 Y 1 A TYR 31 ? OH ? A TYR 31 OH 7 1 Y 1 A LYS 51 ? CG ? A LYS 51 CG 8 1 Y 1 A LYS 51 ? CD ? A LYS 51 CD 9 1 Y 1 A LYS 51 ? CE ? A LYS 51 CE 10 1 Y 1 A LYS 51 ? NZ ? A LYS 51 NZ 11 1 Y 1 A LYS 56 ? CG ? A LYS 56 CG 12 1 Y 1 A LYS 56 ? CD ? A LYS 56 CD 13 1 Y 1 A LYS 56 ? CE ? A LYS 56 CE 14 1 Y 1 A LYS 56 ? NZ ? A LYS 56 NZ 15 1 Y 1 A TYR 70 ? OH ? A TYR 70 OH 16 1 Y 1 A ARG 87 ? NH1 ? A ARG 87 NH1 17 1 Y 1 A ARG 87 ? NH2 ? A ARG 87 NH2 18 1 Y 1 A TYR 90 ? OH ? A TYR 90 OH 19 1 Y 1 A TYR 99 ? OH ? A TYR 99 OH 20 1 Y 1 A ARG 110 ? NH1 ? A ARG 110 NH1 21 1 Y 1 A ARG 110 ? NH2 ? A ARG 110 NH2 22 1 Y 1 A GLU 120 ? CG ? A GLU 120 CG 23 1 Y 1 A GLU 120 ? CD ? A GLU 120 CD 24 1 Y 1 A GLU 120 ? OE1 ? A GLU 120 OE1 25 1 Y 1 A GLU 120 ? OE2 ? A GLU 120 OE2 26 1 Y 1 A GLU 121 ? CG ? A GLU 121 CG 27 1 Y 1 A GLU 121 ? CD ? A GLU 121 CD 28 1 Y 1 A GLU 121 ? OE1 ? A GLU 121 OE1 29 1 Y 1 A GLU 121 ? OE2 ? A GLU 121 OE2 30 1 Y 1 B TYR 19 ? OH ? B TYR 19 OH 31 1 Y 1 B TYR 31 ? OH ? B TYR 31 OH 32 1 Y 1 B LYS 51 ? CG ? B LYS 51 CG 33 1 Y 1 B LYS 51 ? CD ? B LYS 51 CD 34 1 Y 1 B LYS 51 ? CE ? B LYS 51 CE 35 1 Y 1 B LYS 51 ? NZ ? B LYS 51 NZ 36 1 Y 1 B TYR 70 ? OH ? B TYR 70 OH 37 1 Y 1 B ARG 87 ? NH1 ? B ARG 87 NH1 38 1 Y 1 B ARG 87 ? NH2 ? B ARG 87 NH2 39 1 Y 1 B TYR 90 ? OH ? B TYR 90 OH 40 1 Y 1 B TYR 99 ? OH ? B TYR 99 OH 41 1 Y 1 B ARG 110 ? NH1 ? B ARG 110 NH1 42 1 Y 1 B ARG 110 ? NH2 ? B ARG 110 NH2 43 1 Y 1 B GLU 118 ? CG ? B GLU 118 CG 44 1 Y 1 B GLU 118 ? CD ? B GLU 118 CD 45 1 Y 1 B GLU 118 ? OE1 ? B GLU 118 OE1 46 1 Y 1 B GLU 118 ? OE2 ? B GLU 118 OE2 47 1 Y 1 B GLU 120 ? CG ? B GLU 120 CG 48 1 Y 1 B GLU 120 ? CD ? B GLU 120 CD 49 1 Y 1 B GLU 120 ? OE1 ? B GLU 120 OE1 50 1 Y 1 B GLU 120 ? OE2 ? B GLU 120 OE2 51 1 Y 1 B GLU 121 ? CG ? B GLU 121 CG 52 1 Y 1 B GLU 121 ? CD ? B GLU 121 CD 53 1 Y 1 B GLU 121 ? OE1 ? B GLU 121 OE1 54 1 Y 1 B GLU 121 ? OE2 ? B GLU 121 OE2 55 1 Y 1 C TYR 19 ? OH ? C TYR 19 OH 56 1 Y 1 C LYS 27 ? CG ? C LYS 27 CG 57 1 Y 1 C LYS 27 ? CD ? C LYS 27 CD 58 1 Y 1 C LYS 27 ? CE ? C LYS 27 CE 59 1 Y 1 C LYS 27 ? NZ ? C LYS 27 NZ 60 1 Y 1 C TYR 31 ? OH ? C TYR 31 OH 61 1 Y 1 C GLU 43 ? CG ? C GLU 43 CG 62 1 Y 1 C GLU 43 ? CD ? C GLU 43 CD 63 1 Y 1 C GLU 43 ? OE1 ? C GLU 43 OE1 64 1 Y 1 C GLU 43 ? OE2 ? C GLU 43 OE2 65 1 Y 1 C LYS 56 ? CG ? C LYS 56 CG 66 1 Y 1 C LYS 56 ? CD ? C LYS 56 CD 67 1 Y 1 C LYS 56 ? CE ? C LYS 56 CE 68 1 Y 1 C LYS 56 ? NZ ? C LYS 56 NZ 69 1 Y 1 C LYS 68 ? CG ? C LYS 68 CG 70 1 Y 1 C LYS 68 ? CD ? C LYS 68 CD 71 1 Y 1 C LYS 68 ? CE ? C LYS 68 CE 72 1 Y 1 C LYS 68 ? NZ ? C LYS 68 NZ 73 1 Y 1 C TYR 70 ? OH ? C TYR 70 OH 74 1 Y 1 C ARG 87 ? NH1 ? C ARG 87 NH1 75 1 Y 1 C ARG 87 ? NH2 ? C ARG 87 NH2 76 1 Y 1 C TYR 90 ? OH ? C TYR 90 OH 77 1 Y 1 C TYR 99 ? OH ? C TYR 99 OH 78 1 Y 1 C ARG 110 ? NH1 ? C ARG 110 NH1 79 1 Y 1 C ARG 110 ? NH2 ? C ARG 110 NH2 80 1 Y 1 C GLU 120 ? CG ? C GLU 120 CG 81 1 Y 1 C GLU 120 ? CD ? C GLU 120 CD 82 1 Y 1 C GLU 120 ? OE1 ? C GLU 120 OE1 83 1 Y 1 C GLU 120 ? OE2 ? C GLU 120 OE2 84 1 Y 1 C GLU 121 ? CG ? C GLU 121 CG 85 1 Y 1 C GLU 121 ? CD ? C GLU 121 CD 86 1 Y 1 C GLU 121 ? OE1 ? C GLU 121 OE1 87 1 Y 1 C GLU 121 ? OE2 ? C GLU 121 OE2 88 1 Y 1 D TYR 19 ? OH ? D TYR 19 OH 89 1 Y 1 D LYS 28 ? CG ? D LYS 28 CG 90 1 Y 1 D LYS 28 ? CD ? D LYS 28 CD 91 1 Y 1 D LYS 28 ? CE ? D LYS 28 CE 92 1 Y 1 D LYS 28 ? NZ ? D LYS 28 NZ 93 1 Y 1 D TYR 31 ? OH ? D TYR 31 OH 94 1 Y 1 D GLU 43 ? CG ? D GLU 43 CG 95 1 Y 1 D GLU 43 ? CD ? D GLU 43 CD 96 1 Y 1 D GLU 43 ? OE1 ? D GLU 43 OE1 97 1 Y 1 D GLU 43 ? OE2 ? D GLU 43 OE2 98 1 Y 1 D THR 46 ? OG1 ? D THR 46 OG1 99 1 Y 1 D THR 46 ? CG2 ? D THR 46 CG2 100 1 Y 1 D LYS 56 ? CG ? D LYS 56 CG 101 1 Y 1 D LYS 56 ? CD ? D LYS 56 CD 102 1 Y 1 D LYS 56 ? CE ? D LYS 56 CE 103 1 Y 1 D LYS 56 ? NZ ? D LYS 56 NZ 104 1 Y 1 D TYR 70 ? OH ? D TYR 70 OH 105 1 Y 1 D ASN 84 ? CG ? D ASN 84 CG 106 1 Y 1 D ASN 84 ? OD1 ? D ASN 84 OD1 107 1 Y 1 D ASN 84 ? ND2 ? D ASN 84 ND2 108 1 Y 1 D ARG 87 ? NH1 ? D ARG 87 NH1 109 1 Y 1 D ARG 87 ? NH2 ? D ARG 87 NH2 110 1 Y 1 D TYR 90 ? OH ? D TYR 90 OH 111 1 Y 1 D TYR 99 ? OH ? D TYR 99 OH 112 1 Y 1 D ARG 110 ? NH1 ? D ARG 110 NH1 113 1 Y 1 D ARG 110 ? NH2 ? D ARG 110 NH2 114 1 Y 1 D LYS 114 ? CG ? D LYS 114 CG 115 1 Y 1 D LYS 114 ? CD ? D LYS 114 CD 116 1 Y 1 D LYS 114 ? CE ? D LYS 114 CE 117 1 Y 1 D LYS 114 ? NZ ? D LYS 114 NZ 118 1 Y 1 D GLU 120 ? CG ? D GLU 120 CG 119 1 Y 1 D GLU 120 ? CD ? D GLU 120 CD 120 1 Y 1 D GLU 120 ? OE1 ? D GLU 120 OE1 121 1 Y 1 D GLU 120 ? OE2 ? D GLU 120 OE2 122 1 Y 1 D GLU 121 ? CG ? D GLU 121 CG 123 1 Y 1 D GLU 121 ? CD ? D GLU 121 CD 124 1 Y 1 D GLU 121 ? OE1 ? D GLU 121 OE1 125 1 Y 1 D GLU 121 ? OE2 ? D GLU 121 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A PHE 8 ? A PHE 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 B MET 1 ? B MET 1 17 1 Y 1 B SER 2 ? B SER 2 18 1 Y 1 B ASP 3 ? B ASP 3 19 1 Y 1 B GLU 4 ? B GLU 4 20 1 Y 1 B ASP 5 ? B ASP 5 21 1 Y 1 B GLN 6 ? B GLN 6 22 1 Y 1 B THR 7 ? B THR 7 23 1 Y 1 B PHE 8 ? B PHE 8 24 1 Y 1 B GLU 9 ? B GLU 9 25 1 Y 1 B SER 10 ? B SER 10 26 1 Y 1 B ALA 11 ? B ALA 11 27 1 Y 1 B SER 12 ? B SER 12 28 1 Y 1 B SER 13 ? B SER 13 29 1 Y 1 B GLY 14 ? B GLY 14 30 1 Y 1 B ALA 15 ? B ALA 15 31 1 Y 1 C MET 1 ? C MET 1 32 1 Y 1 C SER 2 ? C SER 2 33 1 Y 1 C ASP 3 ? C ASP 3 34 1 Y 1 C GLU 4 ? C GLU 4 35 1 Y 1 C ASP 5 ? C ASP 5 36 1 Y 1 C GLN 6 ? C GLN 6 37 1 Y 1 C THR 7 ? C THR 7 38 1 Y 1 C PHE 8 ? C PHE 8 39 1 Y 1 C GLU 9 ? C GLU 9 40 1 Y 1 C SER 10 ? C SER 10 41 1 Y 1 C ALA 11 ? C ALA 11 42 1 Y 1 C SER 12 ? C SER 12 43 1 Y 1 C SER 13 ? C SER 13 44 1 Y 1 C GLY 14 ? C GLY 14 45 1 Y 1 C ALA 15 ? C ALA 15 46 1 Y 1 C LYS 48 ? C LYS 48 47 1 Y 1 C THR 49 ? C THR 49 48 1 Y 1 C GLY 50 ? C GLY 50 49 1 Y 1 C LYS 51 ? C LYS 51 50 1 Y 1 C HIS 52 ? C HIS 52 51 1 Y 1 C GLY 53 ? C GLY 53 52 1 Y 1 C HIS 54 ? C HIS 54 53 1 Y 1 C ALA 55 ? C ALA 55 54 1 Y 1 D MET 1 ? D MET 1 55 1 Y 1 D SER 2 ? D SER 2 56 1 Y 1 D ASP 3 ? D ASP 3 57 1 Y 1 D GLU 4 ? D GLU 4 58 1 Y 1 D ASP 5 ? D ASP 5 59 1 Y 1 D GLN 6 ? D GLN 6 60 1 Y 1 D THR 7 ? D THR 7 61 1 Y 1 D PHE 8 ? D PHE 8 62 1 Y 1 D GLU 9 ? D GLU 9 63 1 Y 1 D SER 10 ? D SER 10 64 1 Y 1 D ALA 11 ? D ALA 11 65 1 Y 1 D SER 12 ? D SER 12 66 1 Y 1 D SER 13 ? D SER 13 67 1 Y 1 D GLY 14 ? D GLY 14 68 1 Y 1 D ALA 15 ? D ALA 15 69 1 Y 1 D SER 47 ? D SER 47 70 1 Y 1 D LYS 48 ? D LYS 48 71 1 Y 1 D THR 49 ? D THR 49 72 1 Y 1 D GLY 50 ? D GLY 50 73 1 Y 1 D LYS 51 ? D LYS 51 74 1 Y 1 D HIS 52 ? D HIS 52 75 1 Y 1 D GLY 53 ? D GLY 53 76 1 Y 1 D HIS 54 ? D HIS 54 77 1 Y 1 D ALA 55 ? D ALA 55 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5DLQ _pdbx_initial_refinement_model.details 'pdb entry 5dlq as per Morda' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #