data_7N68 # _entry.id 7N68 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7N68 pdb_00007n68 10.2210/pdb7n68/pdb WWPDB D_1000257418 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7N68 _pdbx_database_status.recvd_initial_deposition_date 2021-06-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cuypers, M.G.' 1 ? 'Slavish, J.P.' 2 ? 'Rankovic, Z.' 3 ? 'White, S.W.' 4 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? FR ? ? primary Eur.J.Med.Chem. EJMCA5 0493 0223-5234 ? ? 247 ? 115035 115035 ;Chemical scaffold recycling: Structure-guided conversion of an HIV integrase inhibitor into a potent influenza virus RNA-dependent RNA polymerase inhibitor designed to minimize resistance potential. ; 2023 ? 10.1016/j.ejmech.2022.115035 36603507 ? ? ? ? ? ? ? ? ? FR ? ? 1 Eur.J.Med.Chem. EJMCA5 0493 0223-5234 ? ? 247 ? 115035 115035 ;Chemical scaffold recycling: Structure-guided conversion of an HIV integrase inhibitor into a potent influenza virus RNA-dependent RNA polymerase inhibitor designed to minimize resistance potential. ; 2023 ? 10.1016/j.ejmech.2022.115035 36603507 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Slavish, P.J.' 1 ? primary 'Cuypers, M.G.' 2 ? primary 'Rimmer, M.A.' 3 ? primary 'Abdolvahabi, A.' 4 ? primary 'Jeevan, T.' 5 ? primary 'Kumar, G.' 6 ? primary 'Jarusiewicz, J.A.' 7 ? primary 'Vaithiyalingam, S.' 8 ? primary 'Jones, J.C.' 9 ? primary 'Bowling, J.J.' 10 ? primary 'Price, J.E.' 11 ? primary 'DuBois, R.M.' 12 ? primary 'Min, J.' 13 ? primary 'Webby, R.J.' 14 ? primary 'Rankovic, Z.' 15 ? primary 'White, S.W.' 16 ? 1 'Slavish, P.J.' 17 ? 1 'Cuypers, M.G.' 18 ? 1 'Rimmer, M.A.' 19 ? 1 'Abdolvahabi, A.' 20 ? 1 'Jeevan, T.' 21 ? 1 'Kumar, G.' 22 ? 1 'Jarusiewicz, J.A.' 23 ? 1 'Vaithiyalingam, S.' 24 ? 1 'Jones, J.C.' 25 ? 1 'Bowling, J.J.' 26 ? 1 'Price, J.E.' 27 ? 1 'DuBois, R.M.' 28 ? 1 'Min, J.' 29 ? 1 'Webby, R.J.' 30 ? 1 'Rankovic, Z.' 31 ? 1 'White, S.W.' 32 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7N68 _cell.details ? _cell.formula_units_Z ? _cell.length_a 90.330 _cell.length_a_esd ? _cell.length_b 90.330 _cell.length_b_esd ? _cell.length_c 132.690 _cell.length_c_esd ? _cell.volume 1082685.236 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7N68 _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall 'I 4 2' _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein,Polymerase acidic protein' 23148.344 1 3.1.-.-,3.1.-.- ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn 'Hexa Vinylpyrrolidone K15' 668.866 1 ? ? ? ? 4 non-polymer syn 'benzyl {2-[(5S)-5-hydroxy-4-oxo-6-{[2-(pyridin-4-yl)ethyl]carbamoyl}-4,5-dihydropyrimidin-2-yl]propan-2-yl}carbamate' 451.475 1 ? ? ? ? 5 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 6 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2,RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEII EGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKA DYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEII EGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKA DYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLU n 1 23 ASP n 1 24 PHE n 1 25 VAL n 1 26 ARG n 1 27 GLN n 1 28 CYS n 1 29 PHE n 1 30 ASN n 1 31 PRO n 1 32 MET n 1 33 ILE n 1 34 VAL n 1 35 GLU n 1 36 LEU n 1 37 ALA n 1 38 GLU n 1 39 LYS n 1 40 ALA n 1 41 MET n 1 42 LYS n 1 43 GLU n 1 44 TYR n 1 45 GLY n 1 46 GLU n 1 47 ASP n 1 48 PRO n 1 49 LYS n 1 50 ILE n 1 51 GLU n 1 52 THR n 1 53 ASN n 1 54 LYS n 1 55 PHE n 1 56 ALA n 1 57 ALA n 1 58 ILE n 1 59 CYS n 1 60 THR n 1 61 HIS n 1 62 LEU n 1 63 GLU n 1 64 VAL n 1 65 CYS n 1 66 PHE n 1 67 MET n 1 68 TYR n 1 69 SER n 1 70 ASP n 1 71 GLY n 1 72 GLY n 1 73 SER n 1 74 LYS n 1 75 HIS n 1 76 ARG n 1 77 PHE n 1 78 GLU n 1 79 ILE n 1 80 ILE n 1 81 GLU n 1 82 GLY n 1 83 ARG n 1 84 ASP n 1 85 ARG n 1 86 ILE n 1 87 MET n 1 88 ALA n 1 89 TRP n 1 90 THR n 1 91 VAL n 1 92 VAL n 1 93 ASN n 1 94 SER n 1 95 ILE n 1 96 CYS n 1 97 ASN n 1 98 THR n 1 99 THR n 1 100 GLY n 1 101 VAL n 1 102 GLU n 1 103 LYS n 1 104 PRO n 1 105 LYS n 1 106 PHE n 1 107 LEU n 1 108 PRO n 1 109 ASP n 1 110 LEU n 1 111 TYR n 1 112 ASP n 1 113 TYR n 1 114 LYS n 1 115 GLU n 1 116 ASN n 1 117 ARG n 1 118 PHE n 1 119 ILE n 1 120 GLU n 1 121 ILE n 1 122 GLY n 1 123 VAL n 1 124 THR n 1 125 ARG n 1 126 ARG n 1 127 GLU n 1 128 VAL n 1 129 HIS n 1 130 ILE n 1 131 TYR n 1 132 TYR n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 ALA n 1 137 ASN n 1 138 LYS n 1 139 ILE n 1 140 LYS n 1 141 SER n 1 142 GLU n 1 143 LYS n 1 144 THR n 1 145 HIS n 1 146 ILE n 1 147 HIS n 1 148 ILE n 1 149 PHE n 1 150 SER n 1 151 PHE n 1 152 THR n 1 153 GLY n 1 154 GLU n 1 155 GLU n 1 156 MET n 1 157 ALA n 1 158 THR n 1 159 LYS n 1 160 ALA n 1 161 ASP n 1 162 TYR n 1 163 THR n 1 164 LEU n 1 165 ASP n 1 166 GLU n 1 167 GLU n 1 168 SER n 1 169 ARG n 1 170 ALA n 1 171 ARG n 1 172 ILE n 1 173 LYS n 1 174 THR n 1 175 ARG n 1 176 LEU n 1 177 PHE n 1 178 THR n 1 179 ILE n 1 180 ARG n 1 181 GLN n 1 182 GLU n 1 183 MET n 1 184 ALA n 1 185 SER n 1 186 ARG n 1 187 SER n 1 188 LEU n 1 189 TRP n 1 190 ASP n 1 191 SER n 1 192 PHE n 1 193 ARG n 1 194 GLN n 1 195 SER n 1 196 GLU n 1 197 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 70 ? ? PA ? 'swl A/California/04/2009 H1N1' ? ? ? ? 'Influenza A virus (strain swl A/California/04/2009 H1N1)' 641501 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 71 197 ? ? PA ? 'swl A/California/04/2009 H1N1' ? ? ? ? 'Influenza A virus (strain swl A/California/04/2009 H1N1)' 641501 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP C3W5S0_I09A0 C3W5S0 ? 1 MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 1 2 UNP C3W5S0_I09A0 C3W5S0 ? 1 ;KHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7N68 A 21 ? 70 ? C3W5S0 1 ? 50 ? 1 50 2 2 7N68 A 74 ? 197 ? C3W5S0 73 ? 196 ? 73 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7N68 MET A 1 ? UNP C3W5S0 ? ? 'expression tag' -19 1 1 7N68 GLY A 2 ? UNP C3W5S0 ? ? 'expression tag' -18 2 1 7N68 SER A 3 ? UNP C3W5S0 ? ? 'expression tag' -17 3 1 7N68 SER A 4 ? UNP C3W5S0 ? ? 'expression tag' -16 4 1 7N68 HIS A 5 ? UNP C3W5S0 ? ? 'expression tag' -15 5 1 7N68 HIS A 6 ? UNP C3W5S0 ? ? 'expression tag' -14 6 1 7N68 HIS A 7 ? UNP C3W5S0 ? ? 'expression tag' -13 7 1 7N68 HIS A 8 ? UNP C3W5S0 ? ? 'expression tag' -12 8 1 7N68 HIS A 9 ? UNP C3W5S0 ? ? 'expression tag' -11 9 1 7N68 HIS A 10 ? UNP C3W5S0 ? ? 'expression tag' -10 10 1 7N68 SER A 11 ? UNP C3W5S0 ? ? 'expression tag' -9 11 1 7N68 SER A 12 ? UNP C3W5S0 ? ? 'expression tag' -8 12 1 7N68 GLY A 13 ? UNP C3W5S0 ? ? 'expression tag' -7 13 1 7N68 LEU A 14 ? UNP C3W5S0 ? ? 'expression tag' -6 14 1 7N68 VAL A 15 ? UNP C3W5S0 ? ? 'expression tag' -5 15 1 7N68 PRO A 16 ? UNP C3W5S0 ? ? 'expression tag' -4 16 1 7N68 ARG A 17 ? UNP C3W5S0 ? ? 'expression tag' -3 17 1 7N68 GLY A 18 ? UNP C3W5S0 ? ? 'expression tag' -2 18 1 7N68 SER A 19 ? UNP C3W5S0 ? ? 'expression tag' -1 19 1 7N68 HIS A 20 ? UNP C3W5S0 ? ? 'expression tag' 0 20 1 7N68 GLY A 71 ? UNP C3W5S0 ? ? linker 51 21 1 7N68 GLY A 72 ? UNP C3W5S0 ? ? linker 52 22 1 7N68 SER A 73 ? UNP C3W5S0 ? ? linker 53 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0VL non-polymer . 'benzyl {2-[(5S)-5-hydroxy-4-oxo-6-{[2-(pyridin-4-yl)ethyl]carbamoyl}-4,5-dihydropyrimidin-2-yl]propan-2-yl}carbamate' ? 'C23 H25 N5 O5' 451.475 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QQ4 non-polymer . 'Hexa Vinylpyrrolidone K15' "1,1',1'',1''',1'''',1'''''-[(3R,5R,7R,9S,11R)-dodecane-1,3,5,7,9,11-hexayl]hexa(pyrrolidin-2-one)" 'C36 H56 N6 O6' 668.866 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7N68 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES PH 7.8, 1 M AMMONIUM SULFATE, 10 MM MNCL2, 10 MM MGCL2, 0.5% PVP K15' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-08-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 51.51 _reflns.entry_id 7N68 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.26 _reflns.d_resolution_low 46.01 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12492 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.2 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.26 _reflns_shell.d_res_low 2.33 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1132 _reflns_shell.percent_possible_all 96.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.354 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.759 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 72.32 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7N68 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.26 _refine.ls_d_res_low 39.72 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12486 _refine.ls_number_reflns_R_free 620 _refine.ls_number_reflns_R_work 11866 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.34 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2093 _refine.ls_R_factor_R_free 0.2314 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2081 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5VPT _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.8437 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3143 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.26 _refine_hist.d_res_low 39.72 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 1556 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1448 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 86 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0032 ? 1575 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6975 ? 2131 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0438 ? 221 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0048 ? 270 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.9093 ? 232 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.26 2.49 . . 132 2954 95.45 . . . 0.3119 . 0.3022 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.49 2.85 . . 179 2859 93.36 . . . 0.3310 . 0.2816 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.85 3.59 . . 161 2999 95.87 . . . 0.2821 . 0.2339 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.59 39.72 . . 148 3054 92.78 . . . 0.1754 . 0.1716 . . . . . . . . . . . # _struct.entry_id 7N68 _struct.title 'The crystal structure of wild type PA endonuclease (2009/H1N1/CALIFORNIA) in complex with SJ000988288' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7N68 _struct_keywords.text 'NUCLEASE, INFLUENZA, INHIBITOR RESISTANCE, VIRAL PROTEIN-Inhibitor complex' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN/Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 5 ? H N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 19 ? PHE A 29 ? SER A -1 PHE A 9 1 ? 11 HELX_P HELX_P2 AA2 ASN A 30 ? TYR A 44 ? ASN A 10 TYR A 24 1 ? 15 HELX_P HELX_P3 AA3 GLU A 51 ? GLY A 71 ? GLU A 31 GLY A 51 1 ? 21 HELX_P HELX_P4 AA4 ASP A 84 ? GLY A 100 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 127 ? LYS A 140 ? GLU A 126 LYS A 139 1 ? 14 HELX_P HELX_P6 AA6 LYS A 159 ? ASP A 161 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 165 ? ARG A 186 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 188 ? GLU A 196 ? LEU A 187 GLU A 195 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 61 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 201 1_555 ? ? ? ? ? ? ? 2.213 ? ? metalc2 metalc ? ? A GLU 81 OE2 ? ? ? 1_555 C MN . MN ? ? A GLU 80 A MN 202 1_555 ? ? ? ? ? ? ? 2.594 ? ? metalc3 metalc ? ? A ASP 109 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 201 1_555 ? ? ? ? ? ? ? 2.103 ? ? metalc4 metalc ? ? A ASP 109 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 202 1_555 ? ? ? ? ? ? ? 2.127 ? ? metalc5 metalc ? ? A GLU 120 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 119 A MN 201 1_555 ? ? ? ? ? ? ? 2.210 ? ? metalc6 metalc ? ? A ILE 121 O ? ? ? 1_555 B MN . MN ? ? A ILE 120 A MN 201 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 E 0VL . O4 ? ? A MN 201 A 0VL 204 1_555 ? ? ? ? ? ? ? 2.060 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 E 0VL . O5 ? ? A MN 201 A 0VL 204 1_555 ? ? ? ? ? ? ? 2.008 ? ? metalc9 metalc ? ? C MN . MN ? ? ? 1_555 E 0VL . O4 ? ? A MN 202 A 0VL 204 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc10 metalc ? ? C MN . MN ? ? ? 1_555 H HOH . O ? ? A MN 202 A HOH 301 1_555 ? ? ? ? ? ? ? 2.461 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 H HOH . O ? ? A MN 202 A HOH 302 1_555 ? ? ? ? ? ? ? 2.416 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 77 ? ILE A 79 ? PHE A 76 ILE A 78 AA1 2 LEU A 110 ? ASP A 112 ? LEU A 109 ASP A 111 AA1 3 ARG A 117 ? THR A 124 ? ARG A 116 THR A 123 AA1 4 HIS A 145 ? SER A 150 ? HIS A 144 SER A 149 AA1 5 GLU A 155 ? ALA A 157 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 78 ? N GLU A 77 O TYR A 111 ? O TYR A 110 AA1 2 3 N ASP A 112 ? N ASP A 111 O ARG A 117 ? O ARG A 116 AA1 3 4 N GLY A 122 ? N GLY A 121 O PHE A 149 ? O PHE A 148 AA1 4 5 N ILE A 148 ? N ILE A 147 O MET A 156 ? O MET A 155 # _atom_sites.entry_id 7N68 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011071 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011071 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007536 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 -4 PRO PRO A . n A 1 17 ARG 17 -3 -3 ARG ARG A . n A 1 18 GLY 18 -2 -2 GLY GLY A . n A 1 19 SER 19 -1 -1 SER SER A . n A 1 20 HIS 20 0 0 HIS HIS A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 GLU 22 2 2 GLU GLU A . n A 1 23 ASP 23 3 3 ASP ASP A . n A 1 24 PHE 24 4 4 PHE PHE A . n A 1 25 VAL 25 5 5 VAL VAL A . n A 1 26 ARG 26 6 6 ARG ARG A . n A 1 27 GLN 27 7 7 GLN GLN A . n A 1 28 CYS 28 8 8 CYS CYS A . n A 1 29 PHE 29 9 9 PHE PHE A . n A 1 30 ASN 30 10 10 ASN ASN A . n A 1 31 PRO 31 11 11 PRO PRO A . n A 1 32 MET 32 12 12 MET MET A . n A 1 33 ILE 33 13 13 ILE ILE A . n A 1 34 VAL 34 14 14 VAL VAL A . n A 1 35 GLU 35 15 15 GLU GLU A . n A 1 36 LEU 36 16 16 LEU LEU A . n A 1 37 ALA 37 17 17 ALA ALA A . n A 1 38 GLU 38 18 18 GLU GLU A . n A 1 39 LYS 39 19 19 LYS LYS A . n A 1 40 ALA 40 20 20 ALA ALA A . n A 1 41 MET 41 21 21 MET MET A . n A 1 42 LYS 42 22 22 LYS LYS A . n A 1 43 GLU 43 23 23 GLU GLU A . n A 1 44 TYR 44 24 24 TYR TYR A . n A 1 45 GLY 45 25 25 GLY GLY A . n A 1 46 GLU 46 26 26 GLU GLU A . n A 1 47 ASP 47 27 27 ASP ASP A . n A 1 48 PRO 48 28 28 PRO PRO A . n A 1 49 LYS 49 29 29 LYS LYS A . n A 1 50 ILE 50 30 30 ILE ILE A . n A 1 51 GLU 51 31 31 GLU GLU A . n A 1 52 THR 52 32 32 THR THR A . n A 1 53 ASN 53 33 33 ASN ASN A . n A 1 54 LYS 54 34 34 LYS LYS A . n A 1 55 PHE 55 35 35 PHE PHE A . n A 1 56 ALA 56 36 36 ALA ALA A . n A 1 57 ALA 57 37 37 ALA ALA A . n A 1 58 ILE 58 38 38 ILE ILE A . n A 1 59 CYS 59 39 39 CYS CYS A . n A 1 60 THR 60 40 40 THR THR A . n A 1 61 HIS 61 41 41 HIS HIS A . n A 1 62 LEU 62 42 42 LEU LEU A . n A 1 63 GLU 63 43 43 GLU GLU A . n A 1 64 VAL 64 44 44 VAL VAL A . n A 1 65 CYS 65 45 45 CYS CYS A . n A 1 66 PHE 66 46 46 PHE PHE A . n A 1 67 MET 67 47 47 MET MET A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 SER 69 49 49 SER SER A . n A 1 70 ASP 70 50 50 ASP ASP A . n A 1 71 GLY 71 51 51 GLY GLY A . n A 1 72 GLY 72 52 52 GLY GLY A . n A 1 73 SER 73 53 53 SER SER A . n A 1 74 LYS 74 73 73 LYS LYS A . n A 1 75 HIS 75 74 74 HIS HIS A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 PHE 77 76 76 PHE PHE A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 ILE 79 78 78 ILE ILE A . n A 1 80 ILE 80 79 79 ILE ILE A . n A 1 81 GLU 81 80 80 GLU GLU A . n A 1 82 GLY 82 81 81 GLY GLY A . n A 1 83 ARG 83 82 82 ARG ARG A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 ARG 85 84 84 ARG ARG A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 MET 87 86 86 MET MET A . n A 1 88 ALA 88 87 87 ALA ALA A . n A 1 89 TRP 89 88 88 TRP TRP A . n A 1 90 THR 90 89 89 THR THR A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 ASN 93 92 92 ASN ASN A . n A 1 94 SER 94 93 93 SER SER A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 CYS 96 95 95 CYS CYS A . n A 1 97 ASN 97 96 96 ASN ASN A . n A 1 98 THR 98 97 97 THR THR A . n A 1 99 THR 99 98 98 THR THR A . n A 1 100 GLY 100 99 99 GLY GLY A . n A 1 101 VAL 101 100 100 VAL VAL A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 PRO 104 103 103 PRO PRO A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 PHE 106 105 105 PHE PHE A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 PRO 108 107 107 PRO PRO A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 LEU 110 109 109 LEU LEU A . n A 1 111 TYR 111 110 110 TYR TYR A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 TYR 113 112 112 TYR TYR A . n A 1 114 LYS 114 113 113 LYS LYS A . n A 1 115 GLU 115 114 114 GLU GLU A . n A 1 116 ASN 116 115 115 ASN ASN A . n A 1 117 ARG 117 116 116 ARG ARG A . n A 1 118 PHE 118 117 117 PHE PHE A . n A 1 119 ILE 119 118 118 ILE ILE A . n A 1 120 GLU 120 119 119 GLU GLU A . n A 1 121 ILE 121 120 120 ILE ILE A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 THR 124 123 123 THR THR A . n A 1 125 ARG 125 124 124 ARG ARG A . n A 1 126 ARG 126 125 125 ARG ARG A . n A 1 127 GLU 127 126 126 GLU GLU A . n A 1 128 VAL 128 127 127 VAL VAL A . n A 1 129 HIS 129 128 128 HIS HIS A . n A 1 130 ILE 130 129 129 ILE ILE A . n A 1 131 TYR 131 130 130 TYR TYR A . n A 1 132 TYR 132 131 131 TYR TYR A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 GLU 134 133 133 GLU GLU A . n A 1 135 LYS 135 134 134 LYS LYS A . n A 1 136 ALA 136 135 135 ALA ALA A . n A 1 137 ASN 137 136 136 ASN ASN A . n A 1 138 LYS 138 137 137 LYS LYS A . n A 1 139 ILE 139 138 138 ILE ILE A . n A 1 140 LYS 140 139 139 LYS LYS A . n A 1 141 SER 141 140 140 SER SER A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 LYS 143 142 142 LYS LYS A . n A 1 144 THR 144 143 143 THR THR A . n A 1 145 HIS 145 144 144 HIS HIS A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 HIS 147 146 146 HIS HIS A . n A 1 148 ILE 148 147 147 ILE ILE A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 SER 150 149 149 SER SER A . n A 1 151 PHE 151 150 150 PHE PHE A . n A 1 152 THR 152 151 151 THR THR A . n A 1 153 GLY 153 152 152 GLY GLY A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 GLU 155 154 154 GLU GLU A . n A 1 156 MET 156 155 155 MET MET A . n A 1 157 ALA 157 156 156 ALA ALA A . n A 1 158 THR 158 157 157 THR THR A . n A 1 159 LYS 159 158 158 LYS LYS A . n A 1 160 ALA 160 159 159 ALA ALA A . n A 1 161 ASP 161 160 160 ASP ASP A . n A 1 162 TYR 162 161 161 TYR TYR A . n A 1 163 THR 163 162 162 THR THR A . n A 1 164 LEU 164 163 163 LEU LEU A . n A 1 165 ASP 165 164 164 ASP ASP A . n A 1 166 GLU 166 165 165 GLU GLU A . n A 1 167 GLU 167 166 166 GLU GLU A . n A 1 168 SER 168 167 167 SER SER A . n A 1 169 ARG 169 168 168 ARG ARG A . n A 1 170 ALA 170 169 169 ALA ALA A . n A 1 171 ARG 171 170 170 ARG ARG A . n A 1 172 ILE 172 171 171 ILE ILE A . n A 1 173 LYS 173 172 172 LYS LYS A . n A 1 174 THR 174 173 173 THR THR A . n A 1 175 ARG 175 174 174 ARG ARG A . n A 1 176 LEU 176 175 175 LEU LEU A . n A 1 177 PHE 177 176 176 PHE PHE A . n A 1 178 THR 178 177 177 THR THR A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 GLN 181 180 180 GLN GLN A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 MET 183 182 182 MET MET A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 SER 185 184 184 SER SER A . n A 1 186 ARG 186 185 185 ARG ARG A . n A 1 187 SER 187 186 186 SER SER A . n A 1 188 LEU 188 187 187 LEU LEU A . n A 1 189 TRP 189 188 188 TRP TRP A . n A 1 190 ASP 190 189 189 ASP ASP A . n A 1 191 SER 191 190 190 SER SER A . n A 1 192 PHE 192 191 191 PHE PHE A . n A 1 193 ARG 193 192 192 ARG ARG A . n A 1 194 GLN 194 193 193 GLN GLN A . n A 1 195 SER 195 194 194 SER SER A . n A 1 196 GLU 196 195 195 GLU GLU A . n A 1 197 ARG 197 196 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 201 201 MN MN A . C 2 MN 1 202 202 MN MN A . D 3 QQ4 1 203 401 QQ4 PVP A . E 4 0VL 1 204 402 0VL 288 A . F 5 SO4 1 205 1 SO4 SO4 A . G 5 SO4 1 206 2 SO4 SO4 A . H 6 HOH 1 301 2 HOH HOH A . H 6 HOH 2 302 1 HOH HOH A . H 6 HOH 3 303 20 HOH HOH A . H 6 HOH 4 304 4 HOH HOH A . H 6 HOH 5 305 9 HOH HOH A . H 6 HOH 6 306 17 HOH HOH A . H 6 HOH 7 307 19 HOH HOH A . H 6 HOH 8 308 10 HOH HOH A . H 6 HOH 9 309 12 HOH HOH A . H 6 HOH 10 310 3 HOH HOH A . H 6 HOH 11 311 8 HOH HOH A . H 6 HOH 12 312 13 HOH HOH A . H 6 HOH 13 313 14 HOH HOH A . H 6 HOH 14 314 11 HOH HOH A . H 6 HOH 15 315 18 HOH HOH A . H 6 HOH 16 316 15 HOH HOH A . H 6 HOH 17 317 16 HOH HOH A . H 6 HOH 18 318 21 HOH HOH A . H 6 HOH 19 319 7 HOH HOH A . H 6 HOH 20 320 6 HOH HOH A . H 6 HOH 21 321 22 HOH HOH A . H 6 HOH 22 322 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details octameric _pdbx_struct_assembly.oligomeric_count 8 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 20940 ? 1 MORE -343 ? 1 'SSA (A^2)' 59940 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 99.7 ? 2 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 167.7 ? 3 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 89.9 ? 4 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 82.8 ? 5 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 95.7 ? 6 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 121 ? A ILE 120 ? 1_555 88.6 ? 7 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O4 ? E 0VL . ? A 0VL 204 ? 1_555 109.2 ? 8 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O4 ? E 0VL . ? A 0VL 204 ? 1_555 97.3 ? 9 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O4 ? E 0VL . ? A 0VL 204 ? 1_555 76.9 ? 10 O ? A ILE 121 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O4 ? E 0VL . ? A 0VL 204 ? 1_555 160.4 ? 11 NE2 ? A HIS 61 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? E 0VL . ? A 0VL 204 ? 1_555 79.3 ? 12 OD2 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? E 0VL . ? A 0VL 204 ? 1_555 178.1 ? 13 OE2 ? A GLU 120 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? E 0VL . ? A 0VL 204 ? 1_555 91.3 ? 14 O ? A ILE 121 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? E 0VL . ? A 0VL 204 ? 1_555 85.8 ? 15 O4 ? E 0VL . ? A 0VL 204 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? E 0VL . ? A 0VL 204 ? 1_555 81.5 ? 16 OE2 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 94.9 ? 17 OE2 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O4 ? E 0VL . ? A 0VL 204 ? 1_555 112.1 ? 18 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O4 ? E 0VL . ? A 0VL 204 ? 1_555 84.4 ? 19 OE2 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 107.5 ? 20 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 99.1 ? 21 O4 ? E 0VL . ? A 0VL 204 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 139.8 ? 22 OE2 ? A GLU 81 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 176.1 ? 23 OD1 ? A ASP 109 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 88.5 ? 24 O4 ? E 0VL . ? A 0VL 204 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 66.3 ? 25 O ? H HOH . ? A HOH 301 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 73.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-08 2 'Structure model' 1 1 2023-10-11 3 'Structure model' 1 2 2023-10-18 4 'Structure model' 1 3 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' citation 7 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.country' 2 4 'Structure model' '_citation.journal_abbrev' 3 4 'Structure model' '_citation.journal_id_ASTM' 4 4 'Structure model' '_citation.journal_id_CSD' 5 4 'Structure model' '_citation.journal_id_ISSN' 6 4 'Structure model' '_citation.journal_volume' 7 4 'Structure model' '_citation.page_first' 8 4 'Structure model' '_citation.page_last' 9 4 'Structure model' '_citation.pdbx_database_id_DOI' 10 4 'Structure model' '_citation.pdbx_database_id_PubMed' 11 4 'Structure model' '_citation.title' 12 4 'Structure model' '_citation.year' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z 3 y,-x,z 4 x,-y,-z 5 -x,y,-z 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z 9 x+1/2,y+1/2,z+1/2 10 -y+1/2,x+1/2,z+1/2 11 y+1/2,-x+1/2,z+1/2 12 x+1/2,-y+1/2,-z+1/2 13 -x+1/2,y+1/2,-z+1/2 14 -x+1/2,-y+1/2,z+1/2 15 y+1/2,x+1/2,-z+1/2 16 -y+1/2,-x+1/2,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 9.42880116327 23.7688008237 7.10915696117 0.639088579322 ? -0.0155037702029 ? -0.223396640778 ? 0.460453366246 ? 0.0677691306367 ? 0.544587915801 ? 5.73620752492 ? -0.50723999004 ? -1.46215171772 ? 1.60658504035 ? 1.82265225551 ? 4.31317033138 ? 0.103336613621 ? 0.9635681558 ? 0.539952909505 ? -0.44993268317 ? -0.253657726882 ? -0.0292352729874 ? -0.536945559585 ? -0.461303069903 ? 0.119770176044 ? 2 'X-RAY DIFFRACTION' ? refined -3.67813921076 23.8373024509 21.9842355333 0.660515217079 ? -0.0289745750427 ? -0.161030908937 ? 0.45701430587 ? -0.210974345278 ? 0.558467797218 ? 5.56487167022 ? -0.36168664318 ? -0.735744950609 ? 1.78644936125 ? 0.748685798912 ? 3.27848696842 ? -0.131872946255 ? -0.325967048433 ? 0.253364058685 ? 0.521196648484 ? -0.173623863721 ? -0.0141578279143 ? -0.34953152006 ? -0.182269653522 ? 0.240056372848 ? 3 'X-RAY DIFFRACTION' ? refined 6.9256625996 31.2661673229 27.6925413633 1.19080828549 ? -0.0887155969874 ? -0.286369318122 ? 0.608314740695 ? -0.145712094218 ? 0.638253314279 ? 5.21468305915 ? -0.43769176087 ? -3.48226460602 ? 4.44777270916 ? 2.09450307702 ? 6.30148240504 ? 0.588750884542 ? -0.467599709681 ? 1.00720972384 ? 0.141889153164 ? -0.29426988651 ? -0.153305205574 ? -1.33587813292 ? 0.204141304991 ? -0.203973179705 ? 4 'X-RAY DIFFRACTION' ? refined 16.962115262 21.7139845497 20.7554766015 0.678715355228 ? -0.195779844875 ? -0.266748341231 ? 0.465530422277 ? 0.00636549279468 ? 0.609769172542 ? 4.80049366421 ? -0.428791562876 ? -2.576983123 ? 0.719632624552 ? -0.182391690118 ? 6.51275588612 ? 0.102956076105 ? -0.427018696631 ? 0.616275852644 ? 0.367676831405 ? -0.209008647757 ? -0.198018916035 ? -0.751805145085 ? 0.694148205913 ? 0.0981376058957 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A -4 ? A 55 A 50 ? ? ;chain 'A' and (resid -4 through 50 ) ; 2 'X-RAY DIFFRACTION' 2 A 56 A 51 ? A 112 A 126 ? ? ;chain 'A' and (resid 51 through 126 ) ; 3 'X-RAY DIFFRACTION' 3 A 113 A 127 ? A 135 A 149 ? ? ;chain 'A' and (resid 127 through 149 ) ; 4 'X-RAY DIFFRACTION' 4 A 136 A 150 ? A 181 A 195 ? ? ;chain 'A' and (resid 150 through 195 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 7N68 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 MN A MN 202 ? ? O3 A 0VL 204 ? ? 1.53 2 1 O A HOH 320 ? ? O A HOH 322 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 125 ? ? -92.79 -154.70 2 1 LYS A 139 ? ? 60.31 -57.06 3 1 SER A 140 ? ? -58.64 104.32 4 1 THR A 162 ? ? 68.51 -54.54 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 15 ? CD ? A GLU 35 CD 2 1 Y 1 A GLU 15 ? OE1 ? A GLU 35 OE1 3 1 Y 1 A GLU 15 ? OE2 ? A GLU 35 OE2 4 1 Y 1 A LYS 34 ? CE ? A LYS 54 CE 5 1 Y 1 A LYS 34 ? NZ ? A LYS 54 NZ 6 1 Y 1 A LYS 73 ? CE ? A LYS 74 CE 7 1 Y 1 A LYS 73 ? NZ ? A LYS 74 NZ 8 1 Y 1 A GLU 101 ? CG ? A GLU 102 CG 9 1 Y 1 A GLU 101 ? CD ? A GLU 102 CD 10 1 Y 1 A GLU 101 ? OE1 ? A GLU 102 OE1 11 1 Y 1 A GLU 101 ? OE2 ? A GLU 102 OE2 12 1 Y 1 A LYS 104 ? CG ? A LYS 105 CG 13 1 Y 1 A LYS 104 ? CD ? A LYS 105 CD 14 1 Y 1 A LYS 104 ? CE ? A LYS 105 CE 15 1 Y 1 A LYS 104 ? NZ ? A LYS 105 NZ 16 1 Y 1 A LYS 113 ? CE ? A LYS 114 CE 17 1 Y 1 A LYS 113 ? NZ ? A LYS 114 NZ 18 1 Y 1 A LEU 132 ? CG ? A LEU 133 CG 19 1 Y 1 A LEU 132 ? CD1 ? A LEU 133 CD1 20 1 Y 1 A LEU 132 ? CD2 ? A LEU 133 CD2 21 1 Y 1 A LYS 134 ? CD ? A LYS 135 CD 22 1 Y 1 A LYS 134 ? CE ? A LYS 135 CE 23 1 Y 1 A LYS 134 ? NZ ? A LYS 135 NZ 24 1 Y 1 A LYS 137 ? CG ? A LYS 138 CG 25 1 Y 1 A LYS 137 ? CD ? A LYS 138 CD 26 1 Y 1 A LYS 137 ? CE ? A LYS 138 CE 27 1 Y 1 A LYS 137 ? NZ ? A LYS 138 NZ 28 1 Y 1 A LYS 139 ? CE ? A LYS 140 CE 29 1 Y 1 A LYS 139 ? NZ ? A LYS 140 NZ 30 1 Y 1 A GLU 141 ? CG ? A GLU 142 CG 31 1 Y 1 A GLU 141 ? CD ? A GLU 142 CD 32 1 Y 1 A GLU 141 ? OE1 ? A GLU 142 OE1 33 1 Y 1 A GLU 141 ? OE2 ? A GLU 142 OE2 34 1 Y 1 A LYS 142 ? CG ? A LYS 143 CG 35 1 Y 1 A LYS 142 ? CD ? A LYS 143 CD 36 1 Y 1 A LYS 142 ? CE ? A LYS 143 CE 37 1 Y 1 A LYS 142 ? NZ ? A LYS 143 NZ 38 1 Y 1 A LYS 158 ? CD ? A LYS 159 CD 39 1 Y 1 A LYS 158 ? CE ? A LYS 159 CE 40 1 Y 1 A LYS 158 ? NZ ? A LYS 159 NZ 41 1 Y 1 A GLU 165 ? CG ? A GLU 166 CG 42 1 Y 1 A GLU 165 ? CD ? A GLU 166 CD 43 1 Y 1 A GLU 165 ? OE1 ? A GLU 166 OE1 44 1 Y 1 A GLU 165 ? OE2 ? A GLU 166 OE2 45 1 Y 1 A GLN 193 ? CG ? A GLN 194 CG 46 1 Y 1 A GLN 193 ? CD ? A GLN 194 CD 47 1 Y 1 A GLN 193 ? OE1 ? A GLN 194 OE1 48 1 Y 1 A GLN 193 ? NE2 ? A GLN 194 NE2 49 1 N 1 A QQ4 203 ? C12 ? D QQ4 1 C12 50 1 N 1 A QQ4 203 ? C19 ? D QQ4 1 C19 51 1 N 1 A QQ4 203 ? C20 ? D QQ4 1 C20 52 1 N 1 A QQ4 203 ? C21 ? D QQ4 1 C21 53 1 N 1 A QQ4 203 ? C42 ? D QQ4 1 C42 54 1 N 1 A QQ4 203 ? N02 ? D QQ4 1 N02 55 1 N 1 A QQ4 203 ? O05 ? D QQ4 1 O05 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A ARG 196 ? A ARG 197 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0VL C1 C N N 1 0VL C2 C N N 2 0VL C3 C N N 3 0VL C4 C N N 4 0VL N5 N Y N 5 0VL C6 C Y N 6 0VL C7 C Y N 7 0VL C8 C Y N 8 0VL C9 C Y N 9 0VL C10 C Y N 10 0VL C14 C N N 11 0VL C15 C N N 12 0VL C18 C Y N 13 0VL C19 C Y N 14 0VL C20 C Y N 15 0VL C21 C Y N 16 0VL C22 C N N 17 0VL C23 C N N 18 0VL C11 C Y N 19 0VL C12 C N N 20 0VL C13 C N N 21 0VL C16 C N N 22 0VL C17 C Y N 23 0VL C5 C N N 24 0VL N1 N N N 25 0VL N2 N N N 26 0VL N3 N N N 27 0VL N4 N N N 28 0VL O1 O N N 29 0VL O2 O N N 30 0VL O3 O N N 31 0VL O4 O N N 32 0VL O5 O N N 33 0VL H1 H N N 34 0VL H2 H N N 35 0VL H3 H N N 36 0VL H4 H N N 37 0VL H5 H N N 38 0VL H6 H N N 39 0VL H7 H N N 40 0VL H8 H N N 41 0VL H9 H N N 42 0VL H10 H N N 43 0VL H11 H N N 44 0VL H12 H N N 45 0VL H13 H N N 46 0VL H14 H N N 47 0VL H15 H N N 48 0VL H16 H N N 49 0VL H18 H N N 50 0VL H19 H N N 51 0VL H20 H N N 52 0VL H21 H N N 53 0VL H22 H N N 54 0VL H23 H N N 55 0VL H24 H N N 56 0VL H25 H N N 57 0VL H17 H N N 58 ALA N N N N 59 ALA CA C N S 60 ALA C C N N 61 ALA O O N N 62 ALA CB C N N 63 ALA OXT O N N 64 ALA H H N N 65 ALA H2 H N N 66 ALA HA H N N 67 ALA HB1 H N N 68 ALA HB2 H N N 69 ALA HB3 H N N 70 ALA HXT H N N 71 ARG N N N N 72 ARG CA C N S 73 ARG C C N N 74 ARG O O N N 75 ARG CB C N N 76 ARG CG C N N 77 ARG CD C N N 78 ARG NE N N N 79 ARG CZ C N N 80 ARG NH1 N N N 81 ARG NH2 N N N 82 ARG OXT O N N 83 ARG H H N N 84 ARG H2 H N N 85 ARG HA H N N 86 ARG HB2 H N N 87 ARG HB3 H N N 88 ARG HG2 H N N 89 ARG HG3 H N N 90 ARG HD2 H N N 91 ARG HD3 H N N 92 ARG HE H N N 93 ARG HH11 H N N 94 ARG HH12 H N N 95 ARG HH21 H N N 96 ARG HH22 H N N 97 ARG HXT H N N 98 ASN N N N N 99 ASN CA C N S 100 ASN C C N N 101 ASN O O N N 102 ASN CB C N N 103 ASN CG C N N 104 ASN OD1 O N N 105 ASN ND2 N N N 106 ASN OXT O N N 107 ASN H H N N 108 ASN H2 H N N 109 ASN HA H N N 110 ASN HB2 H N N 111 ASN HB3 H N N 112 ASN HD21 H N N 113 ASN HD22 H N N 114 ASN HXT H N N 115 ASP N N N N 116 ASP CA C N S 117 ASP C C N N 118 ASP O O N N 119 ASP CB C N N 120 ASP CG C N N 121 ASP OD1 O N N 122 ASP OD2 O N N 123 ASP OXT O N N 124 ASP H H N N 125 ASP H2 H N N 126 ASP HA H N N 127 ASP HB2 H N N 128 ASP HB3 H N N 129 ASP HD2 H N N 130 ASP HXT H N N 131 CYS N N N N 132 CYS CA C N R 133 CYS C C N N 134 CYS O O N N 135 CYS CB C N N 136 CYS SG S N N 137 CYS OXT O N N 138 CYS H H N N 139 CYS H2 H N N 140 CYS HA H N N 141 CYS HB2 H N N 142 CYS HB3 H N N 143 CYS HG H N N 144 CYS HXT H N N 145 GLN N N N N 146 GLN CA C N S 147 GLN C C N N 148 GLN O O N N 149 GLN CB C N N 150 GLN CG C N N 151 GLN CD C N N 152 GLN OE1 O N N 153 GLN NE2 N N N 154 GLN OXT O N N 155 GLN H H N N 156 GLN H2 H N N 157 GLN HA H N N 158 GLN HB2 H N N 159 GLN HB3 H N N 160 GLN HG2 H N N 161 GLN HG3 H N N 162 GLN HE21 H N N 163 GLN HE22 H N N 164 GLN HXT H N N 165 GLU N N N N 166 GLU CA C N S 167 GLU C C N N 168 GLU O O N N 169 GLU CB C N N 170 GLU CG C N N 171 GLU CD C N N 172 GLU OE1 O N N 173 GLU OE2 O N N 174 GLU OXT O N N 175 GLU H H N N 176 GLU H2 H N N 177 GLU HA H N N 178 GLU HB2 H N N 179 GLU HB3 H N N 180 GLU HG2 H N N 181 GLU HG3 H N N 182 GLU HE2 H N N 183 GLU HXT H N N 184 GLY N N N N 185 GLY CA C N N 186 GLY C C N N 187 GLY O O N N 188 GLY OXT O N N 189 GLY H H N N 190 GLY H2 H N N 191 GLY HA2 H N N 192 GLY HA3 H N N 193 GLY HXT H N N 194 HIS N N N N 195 HIS CA C N S 196 HIS C C N N 197 HIS O O N N 198 HIS CB C N N 199 HIS CG C Y N 200 HIS ND1 N Y N 201 HIS CD2 C Y N 202 HIS CE1 C Y N 203 HIS NE2 N Y N 204 HIS OXT O N N 205 HIS H H N N 206 HIS H2 H N N 207 HIS HA H N N 208 HIS HB2 H N N 209 HIS HB3 H N N 210 HIS HD1 H N N 211 HIS HD2 H N N 212 HIS HE1 H N N 213 HIS HE2 H N N 214 HIS HXT H N N 215 HOH O O N N 216 HOH H1 H N N 217 HOH H2 H N N 218 ILE N N N N 219 ILE CA C N S 220 ILE C C N N 221 ILE O O N N 222 ILE CB C N S 223 ILE CG1 C N N 224 ILE CG2 C N N 225 ILE CD1 C N N 226 ILE OXT O N N 227 ILE H H N N 228 ILE H2 H N N 229 ILE HA H N N 230 ILE HB H N N 231 ILE HG12 H N N 232 ILE HG13 H N N 233 ILE HG21 H N N 234 ILE HG22 H N N 235 ILE HG23 H N N 236 ILE HD11 H N N 237 ILE HD12 H N N 238 ILE HD13 H N N 239 ILE HXT H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 MET N N N N 288 MET CA C N S 289 MET C C N N 290 MET O O N N 291 MET CB C N N 292 MET CG C N N 293 MET SD S N N 294 MET CE C N N 295 MET OXT O N N 296 MET H H N N 297 MET H2 H N N 298 MET HA H N N 299 MET HB2 H N N 300 MET HB3 H N N 301 MET HG2 H N N 302 MET HG3 H N N 303 MET HE1 H N N 304 MET HE2 H N N 305 MET HE3 H N N 306 MET HXT H N N 307 MN MN MN N N 308 PHE N N N N 309 PHE CA C N S 310 PHE C C N N 311 PHE O O N N 312 PHE CB C N N 313 PHE CG C Y N 314 PHE CD1 C Y N 315 PHE CD2 C Y N 316 PHE CE1 C Y N 317 PHE CE2 C Y N 318 PHE CZ C Y N 319 PHE OXT O N N 320 PHE H H N N 321 PHE H2 H N N 322 PHE HA H N N 323 PHE HB2 H N N 324 PHE HB3 H N N 325 PHE HD1 H N N 326 PHE HD2 H N N 327 PHE HE1 H N N 328 PHE HE2 H N N 329 PHE HZ H N N 330 PHE HXT H N N 331 PRO N N N N 332 PRO CA C N S 333 PRO C C N N 334 PRO O O N N 335 PRO CB C N N 336 PRO CG C N N 337 PRO CD C N N 338 PRO OXT O N N 339 PRO H H N N 340 PRO HA H N N 341 PRO HB2 H N N 342 PRO HB3 H N N 343 PRO HG2 H N N 344 PRO HG3 H N N 345 PRO HD2 H N N 346 PRO HD3 H N N 347 PRO HXT H N N 348 QQ4 C12 C N N 349 QQ4 C11 C N N 350 QQ4 C10 C N N 351 QQ4 C01 C N R 352 QQ4 C02 C N N 353 QQ4 C03 C N R 354 QQ4 C04 C N N 355 QQ4 C05 C N R 356 QQ4 C06 C N N 357 QQ4 C07 C N S 358 QQ4 C08 C N N 359 QQ4 C09 C N R 360 QQ4 C19 C N N 361 QQ4 C20 C N N 362 QQ4 C21 C N N 363 QQ4 C22 C N N 364 QQ4 C23 C N N 365 QQ4 C24 C N N 366 QQ4 C25 C N N 367 QQ4 C26 C N N 368 QQ4 C27 C N N 369 QQ4 C28 C N N 370 QQ4 C29 C N N 371 QQ4 C30 C N N 372 QQ4 C31 C N N 373 QQ4 C32 C N N 374 QQ4 C33 C N N 375 QQ4 C34 C N N 376 QQ4 C35 C N N 377 QQ4 C36 C N N 378 QQ4 C37 C N N 379 QQ4 C38 C N N 380 QQ4 C39 C N N 381 QQ4 C40 C N N 382 QQ4 C41 C N N 383 QQ4 C42 C N N 384 QQ4 N02 N N N 385 QQ4 N03 N N N 386 QQ4 N04 N N N 387 QQ4 N05 N N N 388 QQ4 N06 N N N 389 QQ4 N07 N N N 390 QQ4 O02 O N N 391 QQ4 O03 O N N 392 QQ4 O04 O N N 393 QQ4 O05 O N N 394 QQ4 O06 O N N 395 QQ4 O07 O N N 396 QQ4 H1 H N N 397 QQ4 H2 H N N 398 QQ4 H3 H N N 399 QQ4 H4 H N N 400 QQ4 H5 H N N 401 QQ4 H6 H N N 402 QQ4 H7 H N N 403 QQ4 H8 H N N 404 QQ4 H9 H N N 405 QQ4 H10 H N N 406 QQ4 H11 H N N 407 QQ4 H12 H N N 408 QQ4 H13 H N N 409 QQ4 H14 H N N 410 QQ4 H15 H N N 411 QQ4 H16 H N N 412 QQ4 H17 H N N 413 QQ4 H18 H N N 414 QQ4 H19 H N N 415 QQ4 H20 H N N 416 QQ4 H21 H N N 417 QQ4 H22 H N N 418 QQ4 H23 H N N 419 QQ4 H24 H N N 420 QQ4 H25 H N N 421 QQ4 H26 H N N 422 QQ4 H27 H N N 423 QQ4 H28 H N N 424 QQ4 H29 H N N 425 QQ4 H30 H N N 426 QQ4 H31 H N N 427 QQ4 H32 H N N 428 QQ4 H33 H N N 429 QQ4 H34 H N N 430 QQ4 H35 H N N 431 QQ4 H36 H N N 432 QQ4 H37 H N N 433 QQ4 H38 H N N 434 QQ4 H39 H N N 435 QQ4 H40 H N N 436 QQ4 H41 H N N 437 QQ4 H42 H N N 438 QQ4 H43 H N N 439 QQ4 H44 H N N 440 QQ4 H45 H N N 441 QQ4 H46 H N N 442 QQ4 H47 H N N 443 QQ4 H48 H N N 444 QQ4 H49 H N N 445 QQ4 H50 H N N 446 QQ4 H51 H N N 447 QQ4 H52 H N N 448 QQ4 H53 H N N 449 QQ4 H54 H N N 450 QQ4 H55 H N N 451 QQ4 H56 H N N 452 SER N N N N 453 SER CA C N S 454 SER C C N N 455 SER O O N N 456 SER CB C N N 457 SER OG O N N 458 SER OXT O N N 459 SER H H N N 460 SER H2 H N N 461 SER HA H N N 462 SER HB2 H N N 463 SER HB3 H N N 464 SER HG H N N 465 SER HXT H N N 466 SO4 S S N N 467 SO4 O1 O N N 468 SO4 O2 O N N 469 SO4 O3 O N N 470 SO4 O4 O N N 471 THR N N N N 472 THR CA C N S 473 THR C C N N 474 THR O O N N 475 THR CB C N R 476 THR OG1 O N N 477 THR CG2 C N N 478 THR OXT O N N 479 THR H H N N 480 THR H2 H N N 481 THR HA H N N 482 THR HB H N N 483 THR HG1 H N N 484 THR HG21 H N N 485 THR HG22 H N N 486 THR HG23 H N N 487 THR HXT H N N 488 TRP N N N N 489 TRP CA C N S 490 TRP C C N N 491 TRP O O N N 492 TRP CB C N N 493 TRP CG C Y N 494 TRP CD1 C Y N 495 TRP CD2 C Y N 496 TRP NE1 N Y N 497 TRP CE2 C Y N 498 TRP CE3 C Y N 499 TRP CZ2 C Y N 500 TRP CZ3 C Y N 501 TRP CH2 C Y N 502 TRP OXT O N N 503 TRP H H N N 504 TRP H2 H N N 505 TRP HA H N N 506 TRP HB2 H N N 507 TRP HB3 H N N 508 TRP HD1 H N N 509 TRP HE1 H N N 510 TRP HE3 H N N 511 TRP HZ2 H N N 512 TRP HZ3 H N N 513 TRP HH2 H N N 514 TRP HXT H N N 515 TYR N N N N 516 TYR CA C N S 517 TYR C C N N 518 TYR O O N N 519 TYR CB C N N 520 TYR CG C Y N 521 TYR CD1 C Y N 522 TYR CD2 C Y N 523 TYR CE1 C Y N 524 TYR CE2 C Y N 525 TYR CZ C Y N 526 TYR OH O N N 527 TYR OXT O N N 528 TYR H H N N 529 TYR H2 H N N 530 TYR HA H N N 531 TYR HB2 H N N 532 TYR HB3 H N N 533 TYR HD1 H N N 534 TYR HD2 H N N 535 TYR HE1 H N N 536 TYR HE2 H N N 537 TYR HH H N N 538 TYR HXT H N N 539 VAL N N N N 540 VAL CA C N S 541 VAL C C N N 542 VAL O O N N 543 VAL CB C N N 544 VAL CG1 C N N 545 VAL CG2 C N N 546 VAL OXT O N N 547 VAL H H N N 548 VAL H2 H N N 549 VAL HA H N N 550 VAL HB H N N 551 VAL HG11 H N N 552 VAL HG12 H N N 553 VAL HG13 H N N 554 VAL HG21 H N N 555 VAL HG22 H N N 556 VAL HG23 H N N 557 VAL HXT H N N 558 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0VL N5 C20 doub Y N 1 0VL N5 C19 sing Y N 2 0VL C20 C21 sing Y N 3 0VL C19 C18 doub Y N 4 0VL C21 C17 doub Y N 5 0VL C18 C17 sing Y N 6 0VL C17 C16 sing N N 7 0VL C16 C15 sing N N 8 0VL C3 C2 sing N N 9 0VL C15 N4 sing N N 10 0VL C1 C2 sing N N 11 0VL C2 N1 sing N N 12 0VL C2 C12 sing N N 13 0VL N4 C14 sing N N 14 0VL N1 C4 sing N N 15 0VL N3 C12 doub N N 16 0VL N3 C13 sing N N 17 0VL O2 C4 doub N N 18 0VL C12 N2 sing N N 19 0VL C4 O1 sing N N 20 0VL C14 C13 sing N N 21 0VL C14 O3 doub N N 22 0VL C13 C22 doub N N 23 0VL C5 O1 sing N N 24 0VL C5 C6 sing N N 25 0VL N2 C23 sing N N 26 0VL C7 C6 doub Y N 27 0VL C7 C8 sing Y N 28 0VL C6 C11 sing Y N 29 0VL C22 C23 sing N N 30 0VL C22 O4 sing N N 31 0VL C23 O5 doub N N 32 0VL C8 C9 doub Y N 33 0VL C11 C10 doub Y N 34 0VL C9 C10 sing Y N 35 0VL C1 H1 sing N N 36 0VL C1 H2 sing N N 37 0VL C1 H3 sing N N 38 0VL C3 H4 sing N N 39 0VL C3 H5 sing N N 40 0VL C3 H6 sing N N 41 0VL C7 H7 sing N N 42 0VL C8 H8 sing N N 43 0VL C9 H9 sing N N 44 0VL C10 H10 sing N N 45 0VL C15 H11 sing N N 46 0VL C15 H12 sing N N 47 0VL C18 H13 sing N N 48 0VL C19 H14 sing N N 49 0VL C20 H15 sing N N 50 0VL C21 H16 sing N N 51 0VL C11 H18 sing N N 52 0VL C16 H19 sing N N 53 0VL C16 H20 sing N N 54 0VL C5 H21 sing N N 55 0VL C5 H22 sing N N 56 0VL N1 H23 sing N N 57 0VL N4 H24 sing N N 58 0VL O4 H25 sing N N 59 0VL N2 H17 sing N N 60 ALA N CA sing N N 61 ALA N H sing N N 62 ALA N H2 sing N N 63 ALA CA C sing N N 64 ALA CA CB sing N N 65 ALA CA HA sing N N 66 ALA C O doub N N 67 ALA C OXT sing N N 68 ALA CB HB1 sing N N 69 ALA CB HB2 sing N N 70 ALA CB HB3 sing N N 71 ALA OXT HXT sing N N 72 ARG N CA sing N N 73 ARG N H sing N N 74 ARG N H2 sing N N 75 ARG CA C sing N N 76 ARG CA CB sing N N 77 ARG CA HA sing N N 78 ARG C O doub N N 79 ARG C OXT sing N N 80 ARG CB CG sing N N 81 ARG CB HB2 sing N N 82 ARG CB HB3 sing N N 83 ARG CG CD sing N N 84 ARG CG HG2 sing N N 85 ARG CG HG3 sing N N 86 ARG CD NE sing N N 87 ARG CD HD2 sing N N 88 ARG CD HD3 sing N N 89 ARG NE CZ sing N N 90 ARG NE HE sing N N 91 ARG CZ NH1 sing N N 92 ARG CZ NH2 doub N N 93 ARG NH1 HH11 sing N N 94 ARG NH1 HH12 sing N N 95 ARG NH2 HH21 sing N N 96 ARG NH2 HH22 sing N N 97 ARG OXT HXT sing N N 98 ASN N CA sing N N 99 ASN N H sing N N 100 ASN N H2 sing N N 101 ASN CA C sing N N 102 ASN CA CB sing N N 103 ASN CA HA sing N N 104 ASN C O doub N N 105 ASN C OXT sing N N 106 ASN CB CG sing N N 107 ASN CB HB2 sing N N 108 ASN CB HB3 sing N N 109 ASN CG OD1 doub N N 110 ASN CG ND2 sing N N 111 ASN ND2 HD21 sing N N 112 ASN ND2 HD22 sing N N 113 ASN OXT HXT sing N N 114 ASP N CA sing N N 115 ASP N H sing N N 116 ASP N H2 sing N N 117 ASP CA C sing N N 118 ASP CA CB sing N N 119 ASP CA HA sing N N 120 ASP C O doub N N 121 ASP C OXT sing N N 122 ASP CB CG sing N N 123 ASP CB HB2 sing N N 124 ASP CB HB3 sing N N 125 ASP CG OD1 doub N N 126 ASP CG OD2 sing N N 127 ASP OD2 HD2 sing N N 128 ASP OXT HXT sing N N 129 CYS N CA sing N N 130 CYS N H sing N N 131 CYS N H2 sing N N 132 CYS CA C sing N N 133 CYS CA CB sing N N 134 CYS CA HA sing N N 135 CYS C O doub N N 136 CYS C OXT sing N N 137 CYS CB SG sing N N 138 CYS CB HB2 sing N N 139 CYS CB HB3 sing N N 140 CYS SG HG sing N N 141 CYS OXT HXT sing N N 142 GLN N CA sing N N 143 GLN N H sing N N 144 GLN N H2 sing N N 145 GLN CA C sing N N 146 GLN CA CB sing N N 147 GLN CA HA sing N N 148 GLN C O doub N N 149 GLN C OXT sing N N 150 GLN CB CG sing N N 151 GLN CB HB2 sing N N 152 GLN CB HB3 sing N N 153 GLN CG CD sing N N 154 GLN CG HG2 sing N N 155 GLN CG HG3 sing N N 156 GLN CD OE1 doub N N 157 GLN CD NE2 sing N N 158 GLN NE2 HE21 sing N N 159 GLN NE2 HE22 sing N N 160 GLN OXT HXT sing N N 161 GLU N CA sing N N 162 GLU N H sing N N 163 GLU N H2 sing N N 164 GLU CA C sing N N 165 GLU CA CB sing N N 166 GLU CA HA sing N N 167 GLU C O doub N N 168 GLU C OXT sing N N 169 GLU CB CG sing N N 170 GLU CB HB2 sing N N 171 GLU CB HB3 sing N N 172 GLU CG CD sing N N 173 GLU CG HG2 sing N N 174 GLU CG HG3 sing N N 175 GLU CD OE1 doub N N 176 GLU CD OE2 sing N N 177 GLU OE2 HE2 sing N N 178 GLU OXT HXT sing N N 179 GLY N CA sing N N 180 GLY N H sing N N 181 GLY N H2 sing N N 182 GLY CA C sing N N 183 GLY CA HA2 sing N N 184 GLY CA HA3 sing N N 185 GLY C O doub N N 186 GLY C OXT sing N N 187 GLY OXT HXT sing N N 188 HIS N CA sing N N 189 HIS N H sing N N 190 HIS N H2 sing N N 191 HIS CA C sing N N 192 HIS CA CB sing N N 193 HIS CA HA sing N N 194 HIS C O doub N N 195 HIS C OXT sing N N 196 HIS CB CG sing N N 197 HIS CB HB2 sing N N 198 HIS CB HB3 sing N N 199 HIS CG ND1 sing Y N 200 HIS CG CD2 doub Y N 201 HIS ND1 CE1 doub Y N 202 HIS ND1 HD1 sing N N 203 HIS CD2 NE2 sing Y N 204 HIS CD2 HD2 sing N N 205 HIS CE1 NE2 sing Y N 206 HIS CE1 HE1 sing N N 207 HIS NE2 HE2 sing N N 208 HIS OXT HXT sing N N 209 HOH O H1 sing N N 210 HOH O H2 sing N N 211 ILE N CA sing N N 212 ILE N H sing N N 213 ILE N H2 sing N N 214 ILE CA C sing N N 215 ILE CA CB sing N N 216 ILE CA HA sing N N 217 ILE C O doub N N 218 ILE C OXT sing N N 219 ILE CB CG1 sing N N 220 ILE CB CG2 sing N N 221 ILE CB HB sing N N 222 ILE CG1 CD1 sing N N 223 ILE CG1 HG12 sing N N 224 ILE CG1 HG13 sing N N 225 ILE CG2 HG21 sing N N 226 ILE CG2 HG22 sing N N 227 ILE CG2 HG23 sing N N 228 ILE CD1 HD11 sing N N 229 ILE CD1 HD12 sing N N 230 ILE CD1 HD13 sing N N 231 ILE OXT HXT sing N N 232 LEU N CA sing N N 233 LEU N H sing N N 234 LEU N H2 sing N N 235 LEU CA C sing N N 236 LEU CA CB sing N N 237 LEU CA HA sing N N 238 LEU C O doub N N 239 LEU C OXT sing N N 240 LEU CB CG sing N N 241 LEU CB HB2 sing N N 242 LEU CB HB3 sing N N 243 LEU CG CD1 sing N N 244 LEU CG CD2 sing N N 245 LEU CG HG sing N N 246 LEU CD1 HD11 sing N N 247 LEU CD1 HD12 sing N N 248 LEU CD1 HD13 sing N N 249 LEU CD2 HD21 sing N N 250 LEU CD2 HD22 sing N N 251 LEU CD2 HD23 sing N N 252 LEU OXT HXT sing N N 253 LYS N CA sing N N 254 LYS N H sing N N 255 LYS N H2 sing N N 256 LYS CA C sing N N 257 LYS CA CB sing N N 258 LYS CA HA sing N N 259 LYS C O doub N N 260 LYS C OXT sing N N 261 LYS CB CG sing N N 262 LYS CB HB2 sing N N 263 LYS CB HB3 sing N N 264 LYS CG CD sing N N 265 LYS CG HG2 sing N N 266 LYS CG HG3 sing N N 267 LYS CD CE sing N N 268 LYS CD HD2 sing N N 269 LYS CD HD3 sing N N 270 LYS CE NZ sing N N 271 LYS CE HE2 sing N N 272 LYS CE HE3 sing N N 273 LYS NZ HZ1 sing N N 274 LYS NZ HZ2 sing N N 275 LYS NZ HZ3 sing N N 276 LYS OXT HXT sing N N 277 MET N CA sing N N 278 MET N H sing N N 279 MET N H2 sing N N 280 MET CA C sing N N 281 MET CA CB sing N N 282 MET CA HA sing N N 283 MET C O doub N N 284 MET C OXT sing N N 285 MET CB CG sing N N 286 MET CB HB2 sing N N 287 MET CB HB3 sing N N 288 MET CG SD sing N N 289 MET CG HG2 sing N N 290 MET CG HG3 sing N N 291 MET SD CE sing N N 292 MET CE HE1 sing N N 293 MET CE HE2 sing N N 294 MET CE HE3 sing N N 295 MET OXT HXT sing N N 296 PHE N CA sing N N 297 PHE N H sing N N 298 PHE N H2 sing N N 299 PHE CA C sing N N 300 PHE CA CB sing N N 301 PHE CA HA sing N N 302 PHE C O doub N N 303 PHE C OXT sing N N 304 PHE CB CG sing N N 305 PHE CB HB2 sing N N 306 PHE CB HB3 sing N N 307 PHE CG CD1 doub Y N 308 PHE CG CD2 sing Y N 309 PHE CD1 CE1 sing Y N 310 PHE CD1 HD1 sing N N 311 PHE CD2 CE2 doub Y N 312 PHE CD2 HD2 sing N N 313 PHE CE1 CZ doub Y N 314 PHE CE1 HE1 sing N N 315 PHE CE2 CZ sing Y N 316 PHE CE2 HE2 sing N N 317 PHE CZ HZ sing N N 318 PHE OXT HXT sing N N 319 PRO N CA sing N N 320 PRO N CD sing N N 321 PRO N H sing N N 322 PRO CA C sing N N 323 PRO CA CB sing N N 324 PRO CA HA sing N N 325 PRO C O doub N N 326 PRO C OXT sing N N 327 PRO CB CG sing N N 328 PRO CB HB2 sing N N 329 PRO CB HB3 sing N N 330 PRO CG CD sing N N 331 PRO CG HG2 sing N N 332 PRO CG HG3 sing N N 333 PRO CD HD2 sing N N 334 PRO CD HD3 sing N N 335 PRO OXT HXT sing N N 336 QQ4 C21 C20 sing N N 337 QQ4 C21 N02 sing N N 338 QQ4 C20 C19 sing N N 339 QQ4 C19 C42 sing N N 340 QQ4 N02 C12 sing N N 341 QQ4 N02 C42 sing N N 342 QQ4 C12 C11 sing N N 343 QQ4 C42 O05 doub N N 344 QQ4 C38 C41 sing N N 345 QQ4 C38 N07 sing N N 346 QQ4 C41 C40 sing N N 347 QQ4 C10 C09 sing N N 348 QQ4 C11 C01 sing N N 349 QQ4 C40 C39 sing N N 350 QQ4 N07 C09 sing N N 351 QQ4 N07 C39 sing N N 352 QQ4 C01 C02 sing N N 353 QQ4 C01 N03 sing N N 354 QQ4 C08 C09 sing N N 355 QQ4 C08 C07 sing N N 356 QQ4 C02 C03 sing N N 357 QQ4 C39 O07 doub N N 358 QQ4 C26 C27 sing N N 359 QQ4 C26 N04 sing N N 360 QQ4 C22 N03 sing N N 361 QQ4 C22 C25 sing N N 362 QQ4 N03 C23 sing N N 363 QQ4 C06 C07 sing N N 364 QQ4 C06 C05 sing N N 365 QQ4 C07 N06 sing N N 366 QQ4 C27 C28 sing N N 367 QQ4 C03 N04 sing N N 368 QQ4 C03 C04 sing N N 369 QQ4 C25 C24 sing N N 370 QQ4 N04 C29 sing N N 371 QQ4 C04 C05 sing N N 372 QQ4 O04 C30 doub N N 373 QQ4 C23 O02 doub N N 374 QQ4 C23 C24 sing N N 375 QQ4 C05 N05 sing N N 376 QQ4 N06 C34 sing N N 377 QQ4 N06 C37 sing N N 378 QQ4 C34 C35 sing N N 379 QQ4 C28 C29 sing N N 380 QQ4 C29 O03 doub N N 381 QQ4 C30 N05 sing N N 382 QQ4 C30 C31 sing N N 383 QQ4 N05 C33 sing N N 384 QQ4 C37 O06 doub N N 385 QQ4 C37 C36 sing N N 386 QQ4 C35 C36 sing N N 387 QQ4 C31 C32 sing N N 388 QQ4 C33 C32 sing N N 389 QQ4 C12 H1 sing N N 390 QQ4 C12 H2 sing N N 391 QQ4 C11 H3 sing N N 392 QQ4 C11 H4 sing N N 393 QQ4 C10 H5 sing N N 394 QQ4 C10 H6 sing N N 395 QQ4 C10 H7 sing N N 396 QQ4 C01 H8 sing N N 397 QQ4 C02 H9 sing N N 398 QQ4 C02 H10 sing N N 399 QQ4 C03 H11 sing N N 400 QQ4 C04 H12 sing N N 401 QQ4 C04 H13 sing N N 402 QQ4 C05 H14 sing N N 403 QQ4 C06 H15 sing N N 404 QQ4 C06 H16 sing N N 405 QQ4 C07 H17 sing N N 406 QQ4 C08 H18 sing N N 407 QQ4 C08 H19 sing N N 408 QQ4 C09 H20 sing N N 409 QQ4 C19 H21 sing N N 410 QQ4 C19 H22 sing N N 411 QQ4 C20 H23 sing N N 412 QQ4 C20 H24 sing N N 413 QQ4 C21 H25 sing N N 414 QQ4 C21 H26 sing N N 415 QQ4 C22 H27 sing N N 416 QQ4 C22 H28 sing N N 417 QQ4 C24 H29 sing N N 418 QQ4 C24 H30 sing N N 419 QQ4 C25 H31 sing N N 420 QQ4 C25 H32 sing N N 421 QQ4 C26 H33 sing N N 422 QQ4 C26 H34 sing N N 423 QQ4 C27 H35 sing N N 424 QQ4 C27 H36 sing N N 425 QQ4 C28 H37 sing N N 426 QQ4 C28 H38 sing N N 427 QQ4 C31 H39 sing N N 428 QQ4 C31 H40 sing N N 429 QQ4 C32 H41 sing N N 430 QQ4 C32 H42 sing N N 431 QQ4 C33 H43 sing N N 432 QQ4 C33 H44 sing N N 433 QQ4 C34 H45 sing N N 434 QQ4 C34 H46 sing N N 435 QQ4 C35 H47 sing N N 436 QQ4 C35 H48 sing N N 437 QQ4 C36 H49 sing N N 438 QQ4 C36 H50 sing N N 439 QQ4 C38 H51 sing N N 440 QQ4 C38 H52 sing N N 441 QQ4 C40 H53 sing N N 442 QQ4 C40 H54 sing N N 443 QQ4 C41 H55 sing N N 444 QQ4 C41 H56 sing N N 445 SER N CA sing N N 446 SER N H sing N N 447 SER N H2 sing N N 448 SER CA C sing N N 449 SER CA CB sing N N 450 SER CA HA sing N N 451 SER C O doub N N 452 SER C OXT sing N N 453 SER CB OG sing N N 454 SER CB HB2 sing N N 455 SER CB HB3 sing N N 456 SER OG HG sing N N 457 SER OXT HXT sing N N 458 SO4 S O1 doub N N 459 SO4 S O2 doub N N 460 SO4 S O3 sing N N 461 SO4 S O4 sing N N 462 THR N CA sing N N 463 THR N H sing N N 464 THR N H2 sing N N 465 THR CA C sing N N 466 THR CA CB sing N N 467 THR CA HA sing N N 468 THR C O doub N N 469 THR C OXT sing N N 470 THR CB OG1 sing N N 471 THR CB CG2 sing N N 472 THR CB HB sing N N 473 THR OG1 HG1 sing N N 474 THR CG2 HG21 sing N N 475 THR CG2 HG22 sing N N 476 THR CG2 HG23 sing N N 477 THR OXT HXT sing N N 478 TRP N CA sing N N 479 TRP N H sing N N 480 TRP N H2 sing N N 481 TRP CA C sing N N 482 TRP CA CB sing N N 483 TRP CA HA sing N N 484 TRP C O doub N N 485 TRP C OXT sing N N 486 TRP CB CG sing N N 487 TRP CB HB2 sing N N 488 TRP CB HB3 sing N N 489 TRP CG CD1 doub Y N 490 TRP CG CD2 sing Y N 491 TRP CD1 NE1 sing Y N 492 TRP CD1 HD1 sing N N 493 TRP CD2 CE2 doub Y N 494 TRP CD2 CE3 sing Y N 495 TRP NE1 CE2 sing Y N 496 TRP NE1 HE1 sing N N 497 TRP CE2 CZ2 sing Y N 498 TRP CE3 CZ3 doub Y N 499 TRP CE3 HE3 sing N N 500 TRP CZ2 CH2 doub Y N 501 TRP CZ2 HZ2 sing N N 502 TRP CZ3 CH2 sing Y N 503 TRP CZ3 HZ3 sing N N 504 TRP CH2 HH2 sing N N 505 TRP OXT HXT sing N N 506 TYR N CA sing N N 507 TYR N H sing N N 508 TYR N H2 sing N N 509 TYR CA C sing N N 510 TYR CA CB sing N N 511 TYR CA HA sing N N 512 TYR C O doub N N 513 TYR C OXT sing N N 514 TYR CB CG sing N N 515 TYR CB HB2 sing N N 516 TYR CB HB3 sing N N 517 TYR CG CD1 doub Y N 518 TYR CG CD2 sing Y N 519 TYR CD1 CE1 sing Y N 520 TYR CD1 HD1 sing N N 521 TYR CD2 CE2 doub Y N 522 TYR CD2 HD2 sing N N 523 TYR CE1 CZ doub Y N 524 TYR CE1 HE1 sing N N 525 TYR CE2 CZ sing Y N 526 TYR CE2 HE2 sing N N 527 TYR CZ OH sing N N 528 TYR OH HH sing N N 529 TYR OXT HXT sing N N 530 VAL N CA sing N N 531 VAL N H sing N N 532 VAL N H2 sing N N 533 VAL CA C sing N N 534 VAL CA CB sing N N 535 VAL CA HA sing N N 536 VAL C O doub N N 537 VAL C OXT sing N N 538 VAL CB CG1 sing N N 539 VAL CB CG2 sing N N 540 VAL CB HB sing N N 541 VAL CG1 HG11 sing N N 542 VAL CG1 HG12 sing N N 543 VAL CG1 HG13 sing N N 544 VAL CG2 HG21 sing N N 545 VAL CG2 HG22 sing N N 546 VAL CG2 HG23 sing N N 547 VAL OXT HXT sing N N 548 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 0VL _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 0VL _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'Hexa Vinylpyrrolidone K15' QQ4 4 'benzyl {2-[(5S)-5-hydroxy-4-oxo-6-{[2-(pyridin-4-yl)ethyl]carbamoyl}-4,5-dihydropyrimidin-2-yl]propan-2-yl}carbamate' 0VL 5 'SULFATE ION' SO4 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5VPT _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'I 4 2 2' _space_group.name_Hall 'I 4 2' _space_group.IT_number 97 _space_group.crystal_system tetragonal _space_group.id 1 #