data_7NG0 # _entry.id 7NG0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.349 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NG0 pdb_00007ng0 10.2210/pdb7ng0/pdb WWPDB D_1292113889 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7NG0 _pdbx_database_status.recvd_initial_deposition_date 2021-02-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jalal, A.S.B.' 1 0000-0001-7794-8834 'Tran, N.T.' 2 0000-0002-7186-3976 'Wu, L.J.' 3 0000-0003-2432-8820 'Ramakrishnan, K.' 4 0000-0002-6450-1299 'Rejzek, M.' 5 0000-0002-5091-544X 'Stevenson, C.E.M.' 6 0000-0001-6695-8201 'Lawson, D.M.' 7 0000-0002-7637-4303 'Errington, J.' 8 0000-0002-6977-9388 'Le, T.B.K.' 9 0000-0003-4764-8851 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 81 _citation.language ? _citation.page_first 3623 _citation.page_last 3636.e6 _citation.title 'CTP regulates membrane-binding activity of the nucleoid occlusion protein Noc.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2021.06.025 _citation.pdbx_database_id_PubMed 34270916 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jalal, A.S.B.' 1 ? primary 'Tran, N.T.' 2 ? primary 'Wu, L.J.' 3 ? primary 'Ramakrishnan, K.' 4 ? primary 'Rejzek, M.' 5 ? primary 'Gobbato, G.' 6 ? primary 'Stevenson, C.E.M.' 7 ? primary 'Lawson, D.M.' 8 ? primary 'Errington, J.' 9 ? primary 'Le, T.B.K.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7NG0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 105.067 _cell.length_a_esd ? _cell.length_b 106.562 _cell.length_b_esd ? _cell.length_c 42.215 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7NG0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nucleoid occlusion protein' 26393.756 1 ? ? ? ;The expressed protein corresponds to residues 71-284 of UniProtKB - G8N1K9. However, sequence alignments indicate that Met46 in this sequence represents the true start and thus the numbering used in this PDB entry reflects this i.e Met46 is now Met1. Therefore, in this revised numbering scheme the crystallized protein contains residues 26-239 of the wild type sequence. To this is appended an N-terminal methionine and a C-terminal sequence of KLAAALEHHHHHH, the latter being the nickel affinity tag from the pET21b expression plasmid. ; 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Noc # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEEVRHIPVKSIIPNRFQPRTMFDEEKIDELALTIRTHGIIQPIVVRECGNGRFEIIAGERRWRAVQKLGWTEIPAIIKN LNDKETASVALIENLQREELTPIEEAMAYAKLIELHDLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLQRAITERH ARALIALKDKEKQLKLLQEIIDKQLNVKQTEDRVLKLLEAGERKPKPKRKAFSRDKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEEVRHIPVKSIIPNRFQPRTMFDEEKIDELALTIRTHGIIQPIVVRECGNGRFEIIAGERRWRAVQKLGWTEIPAIIKN LNDKETASVALIENLQREELTPIEEAMAYAKLIELHDLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLQRAITERH ARALIALKDKEKQLKLLQEIIDKQLNVKQTEDRVLKLLEAGERKPKPKRKAFSRDKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLU n 1 4 VAL n 1 5 ARG n 1 6 HIS n 1 7 ILE n 1 8 PRO n 1 9 VAL n 1 10 LYS n 1 11 SER n 1 12 ILE n 1 13 ILE n 1 14 PRO n 1 15 ASN n 1 16 ARG n 1 17 PHE n 1 18 GLN n 1 19 PRO n 1 20 ARG n 1 21 THR n 1 22 MET n 1 23 PHE n 1 24 ASP n 1 25 GLU n 1 26 GLU n 1 27 LYS n 1 28 ILE n 1 29 ASP n 1 30 GLU n 1 31 LEU n 1 32 ALA n 1 33 LEU n 1 34 THR n 1 35 ILE n 1 36 ARG n 1 37 THR n 1 38 HIS n 1 39 GLY n 1 40 ILE n 1 41 ILE n 1 42 GLN n 1 43 PRO n 1 44 ILE n 1 45 VAL n 1 46 VAL n 1 47 ARG n 1 48 GLU n 1 49 CYS n 1 50 GLY n 1 51 ASN n 1 52 GLY n 1 53 ARG n 1 54 PHE n 1 55 GLU n 1 56 ILE n 1 57 ILE n 1 58 ALA n 1 59 GLY n 1 60 GLU n 1 61 ARG n 1 62 ARG n 1 63 TRP n 1 64 ARG n 1 65 ALA n 1 66 VAL n 1 67 GLN n 1 68 LYS n 1 69 LEU n 1 70 GLY n 1 71 TRP n 1 72 THR n 1 73 GLU n 1 74 ILE n 1 75 PRO n 1 76 ALA n 1 77 ILE n 1 78 ILE n 1 79 LYS n 1 80 ASN n 1 81 LEU n 1 82 ASN n 1 83 ASP n 1 84 LYS n 1 85 GLU n 1 86 THR n 1 87 ALA n 1 88 SER n 1 89 VAL n 1 90 ALA n 1 91 LEU n 1 92 ILE n 1 93 GLU n 1 94 ASN n 1 95 LEU n 1 96 GLN n 1 97 ARG n 1 98 GLU n 1 99 GLU n 1 100 LEU n 1 101 THR n 1 102 PRO n 1 103 ILE n 1 104 GLU n 1 105 GLU n 1 106 ALA n 1 107 MET n 1 108 ALA n 1 109 TYR n 1 110 ALA n 1 111 LYS n 1 112 LEU n 1 113 ILE n 1 114 GLU n 1 115 LEU n 1 116 HIS n 1 117 ASP n 1 118 LEU n 1 119 THR n 1 120 GLN n 1 121 GLU n 1 122 ALA n 1 123 LEU n 1 124 ALA n 1 125 GLN n 1 126 ARG n 1 127 LEU n 1 128 GLY n 1 129 LYS n 1 130 GLY n 1 131 GLN n 1 132 SER n 1 133 THR n 1 134 ILE n 1 135 ALA n 1 136 ASN n 1 137 LYS n 1 138 LEU n 1 139 ARG n 1 140 LEU n 1 141 LEU n 1 142 LYS n 1 143 LEU n 1 144 PRO n 1 145 GLN n 1 146 GLU n 1 147 VAL n 1 148 GLN n 1 149 GLU n 1 150 ALA n 1 151 LEU n 1 152 LEU n 1 153 GLN n 1 154 ARG n 1 155 ALA n 1 156 ILE n 1 157 THR n 1 158 GLU n 1 159 ARG n 1 160 HIS n 1 161 ALA n 1 162 ARG n 1 163 ALA n 1 164 LEU n 1 165 ILE n 1 166 ALA n 1 167 LEU n 1 168 LYS n 1 169 ASP n 1 170 LYS n 1 171 GLU n 1 172 LYS n 1 173 GLN n 1 174 LEU n 1 175 LYS n 1 176 LEU n 1 177 LEU n 1 178 GLN n 1 179 GLU n 1 180 ILE n 1 181 ILE n 1 182 ASP n 1 183 LYS n 1 184 GLN n 1 185 LEU n 1 186 ASN n 1 187 VAL n 1 188 LYS n 1 189 GLN n 1 190 THR n 1 191 GLU n 1 192 ASP n 1 193 ARG n 1 194 VAL n 1 195 LEU n 1 196 LYS n 1 197 LEU n 1 198 LEU n 1 199 GLU n 1 200 ALA n 1 201 GLY n 1 202 GLU n 1 203 ARG n 1 204 LYS n 1 205 PRO n 1 206 LYS n 1 207 PRO n 1 208 LYS n 1 209 ARG n 1 210 LYS n 1 211 ALA n 1 212 PHE n 1 213 SER n 1 214 ARG n 1 215 ASP n 1 216 LYS n 1 217 LEU n 1 218 ALA n 1 219 ALA n 1 220 ALA n 1 221 LEU n 1 222 GLU n 1 223 HIS n 1 224 HIS n 1 225 HIS n 1 226 HIS n 1 227 HIS n 1 228 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 228 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'noc, GTCCBUS3UF5_39100' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus thermoleovorans CCB_US3_UF5' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1111068 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant Rosetta _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G8N1K9_GEOTH _struct_ref.pdbx_db_accession G8N1K9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EEVRHIPVKSIIPNRFQPRTMFDEEKIDELALTIRTHGIIQPIVVRECGNGRFEIIAGERRWRAVQKLGWTEIPAIIKNL NDKETASVALIENLQREELTPIEEAMAYAKLIELHDLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLQRAITERHA RALIALKDKEKQLKLLQEIIDKQLNVKQTEDRVLKLLEAGERKPKPKRKAFSRD ; _struct_ref.pdbx_align_begin 71 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7NG0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 215 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G8N1K9 _struct_ref_seq.db_align_beg 71 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 284 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 26 _struct_ref_seq.pdbx_auth_seq_align_end 239 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7NG0 MET A 1 ? UNP G8N1K9 ? ? 'initiating methionine' 25 1 1 7NG0 LYS A 216 ? UNP G8N1K9 ? ? 'expression tag' 240 2 1 7NG0 LEU A 217 ? UNP G8N1K9 ? ? 'expression tag' 241 3 1 7NG0 ALA A 218 ? UNP G8N1K9 ? ? 'expression tag' 242 4 1 7NG0 ALA A 219 ? UNP G8N1K9 ? ? 'expression tag' 243 5 1 7NG0 ALA A 220 ? UNP G8N1K9 ? ? 'expression tag' 244 6 1 7NG0 LEU A 221 ? UNP G8N1K9 ? ? 'expression tag' 245 7 1 7NG0 GLU A 222 ? UNP G8N1K9 ? ? 'expression tag' 246 8 1 7NG0 HIS A 223 ? UNP G8N1K9 ? ? 'expression tag' 247 9 1 7NG0 HIS A 224 ? UNP G8N1K9 ? ? 'expression tag' 248 10 1 7NG0 HIS A 225 ? UNP G8N1K9 ? ? 'expression tag' 249 11 1 7NG0 HIS A 226 ? UNP G8N1K9 ? ? 'expression tag' 250 12 1 7NG0 HIS A 227 ? UNP G8N1K9 ? ? 'expression tag' 251 13 1 7NG0 HIS A 228 ? UNP G8N1K9 ? ? 'expression tag' 252 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NG0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.2 _exptl_crystal.description NULL _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details NULL _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-08-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7NG0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.950 _reflns.d_resolution_low 37.440 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5285 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.700 _reflns.pdbx_Rmerge_I_obs 0.281 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.293 _reflns.pdbx_Rpim_I_all 0.082 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.950 3.130 ? ? ? ? ? ? 835 100.000 ? ? ? ? 1.343 ? ? ? ? ? ? ? ? 12.700 ? ? ? ? 1.399 0.388 ? 1 1 0.855 ? ? 8.850 37.440 ? ? ? ? ? ? 229 99.300 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 10.700 ? ? ? ? 0.084 0.025 ? 2 1 1.000 ? ? # _refine.aniso_B[1][1] 12.8600 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -5.7400 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -7.1200 _refine.B_iso_max 141.430 _refine.B_iso_mean 74.312 _refine.B_iso_min 37.780 _refine.correlation_coeff_Fo_to_Fc 0.9230 _refine.correlation_coeff_Fo_to_Fc_free 0.9280 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7NG0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9500 _refine.ls_d_res_low 37.4400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4752 _refine.ls_number_reflns_R_free 522 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8900 _refine.ls_percent_reflns_R_free 9.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2693 _refine.ls_R_factor_R_free 0.2881 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2673 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7NFU _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4980 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 31.5130 _refine.overall_SU_ML 0.5240 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.9500 _refine_hist.d_res_low 37.4400 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1520 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 199 _refine_hist.pdbx_B_iso_mean_ligand 69.66 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1515 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 1537 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1511 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.331 1.636 2090 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.365 1.574 3455 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.716 5.000 198 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.441 23.421 76 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.869 15.000 273 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.992 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.066 0.200 221 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1736 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 316 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.9500 _refine_ls_shell.d_res_low 3.0270 _refine_ls_shell.number_reflns_all 382 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 342 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4430 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.4380 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7NG0 _struct.title 'Crystal structure of N- and C-terminally truncated Geobacillus thermoleovorans nucleoid occlusion protein Noc' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NG0 _struct_keywords.text 'CTP switch, chromosome segregation, protein-DNA recognition, peripheral membrane protein, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 24 ? GLY A 39 ? ASP A 48 GLY A 63 1 ? 16 HELX_P HELX_P2 AA2 GLY A 59 ? GLY A 70 ? GLY A 83 GLY A 94 1 ? 12 HELX_P HELX_P3 AA3 ASN A 82 ? GLN A 96 ? ASN A 106 GLN A 120 1 ? 15 HELX_P HELX_P4 AA4 THR A 101 ? HIS A 116 ? THR A 125 HIS A 140 1 ? 16 HELX_P HELX_P5 AA5 THR A 119 ? GLY A 128 ? THR A 143 GLY A 152 1 ? 10 HELX_P HELX_P6 AA6 GLY A 130 ? ARG A 139 ? GLY A 154 ARG A 163 1 ? 10 HELX_P HELX_P7 AA7 LEU A 140 ? LEU A 143 ? LEU A 164 LEU A 167 5 ? 4 HELX_P HELX_P8 AA8 PRO A 144 ? GLN A 153 ? PRO A 168 GLN A 177 1 ? 10 HELX_P HELX_P9 AA9 THR A 157 ? ALA A 166 ? THR A 181 ALA A 190 1 ? 10 HELX_P HELX_P10 AB1 ASP A 169 ? GLN A 184 ? ASP A 193 GLN A 208 1 ? 16 HELX_P HELX_P11 AB2 ASN A 186 ? ALA A 200 ? ASN A 210 ALA A 224 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 5 ? PRO A 8 ? ARG A 29 PRO A 32 AA1 2 GLU A 73 ? ILE A 78 ? GLU A 97 ILE A 102 AA1 3 ILE A 44 ? GLU A 48 ? ILE A 68 GLU A 72 AA1 4 PHE A 54 ? ALA A 58 ? PHE A 78 ALA A 82 AA1 5 ILE A 12 ? ILE A 13 ? ILE A 36 ILE A 37 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 5 ? N ARG A 29 O ALA A 76 ? O ALA A 100 AA1 2 3 O PRO A 75 ? O PRO A 99 N ILE A 44 ? N ILE A 68 AA1 3 4 N VAL A 45 ? N VAL A 69 O ILE A 57 ? O ILE A 81 AA1 4 5 O PHE A 54 ? O PHE A 78 N ILE A 13 ? N ILE A 37 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue SO4 A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLY A 59 ? GLY A 83 . ? 1_555 ? 2 AC1 5 GLU A 60 ? GLU A 84 . ? 1_555 ? 3 AC1 5 ARG A 61 ? ARG A 85 . ? 1_555 ? 4 AC1 5 ARG A 62 ? ARG A 86 . ? 1_555 ? 5 AC1 5 ARG A 97 ? ARG A 121 . ? 1_555 ? # _atom_sites.entry_id 7NG0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009518 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009384 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023688 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 25 ? ? ? A . n A 1 2 GLU 2 26 26 GLU GLU A . n A 1 3 GLU 3 27 27 GLU GLU A . n A 1 4 VAL 4 28 28 VAL VAL A . n A 1 5 ARG 5 29 29 ARG ARG A . n A 1 6 HIS 6 30 30 HIS HIS A . n A 1 7 ILE 7 31 31 ILE ILE A . n A 1 8 PRO 8 32 32 PRO PRO A . n A 1 9 VAL 9 33 33 VAL VAL A . n A 1 10 LYS 10 34 34 LYS LYS A . n A 1 11 SER 11 35 35 SER SER A . n A 1 12 ILE 12 36 36 ILE ILE A . n A 1 13 ILE 13 37 37 ILE ILE A . n A 1 14 PRO 14 38 38 PRO PRO A . n A 1 15 ASN 15 39 39 ASN ASN A . n A 1 16 ARG 16 40 40 ARG ARG A . n A 1 17 PHE 17 41 41 PHE PHE A . n A 1 18 GLN 18 42 42 GLN GLN A . n A 1 19 PRO 19 43 43 PRO PRO A . n A 1 20 ARG 20 44 44 ARG ARG A . n A 1 21 THR 21 45 45 THR THR A . n A 1 22 MET 22 46 46 MET MET A . n A 1 23 PHE 23 47 47 PHE PHE A . n A 1 24 ASP 24 48 48 ASP ASP A . n A 1 25 GLU 25 49 49 GLU GLU A . n A 1 26 GLU 26 50 50 GLU GLU A . n A 1 27 LYS 27 51 51 LYS LYS A . n A 1 28 ILE 28 52 52 ILE ILE A . n A 1 29 ASP 29 53 53 ASP ASP A . n A 1 30 GLU 30 54 54 GLU GLU A . n A 1 31 LEU 31 55 55 LEU LEU A . n A 1 32 ALA 32 56 56 ALA ALA A . n A 1 33 LEU 33 57 57 LEU LEU A . n A 1 34 THR 34 58 58 THR THR A . n A 1 35 ILE 35 59 59 ILE ILE A . n A 1 36 ARG 36 60 60 ARG ARG A . n A 1 37 THR 37 61 61 THR THR A . n A 1 38 HIS 38 62 62 HIS HIS A . n A 1 39 GLY 39 63 63 GLY GLY A . n A 1 40 ILE 40 64 64 ILE ILE A . n A 1 41 ILE 41 65 65 ILE ILE A . n A 1 42 GLN 42 66 66 GLN GLN A . n A 1 43 PRO 43 67 67 PRO PRO A . n A 1 44 ILE 44 68 68 ILE ILE A . n A 1 45 VAL 45 69 69 VAL VAL A . n A 1 46 VAL 46 70 70 VAL VAL A . n A 1 47 ARG 47 71 71 ARG ARG A . n A 1 48 GLU 48 72 72 GLU GLU A . n A 1 49 CYS 49 73 73 CYS CYS A . n A 1 50 GLY 50 74 74 GLY GLY A . n A 1 51 ASN 51 75 75 ASN ASN A . n A 1 52 GLY 52 76 76 GLY GLY A . n A 1 53 ARG 53 77 77 ARG ARG A . n A 1 54 PHE 54 78 78 PHE PHE A . n A 1 55 GLU 55 79 79 GLU GLU A . n A 1 56 ILE 56 80 80 ILE ILE A . n A 1 57 ILE 57 81 81 ILE ILE A . n A 1 58 ALA 58 82 82 ALA ALA A . n A 1 59 GLY 59 83 83 GLY GLY A . n A 1 60 GLU 60 84 84 GLU GLU A . n A 1 61 ARG 61 85 85 ARG ARG A . n A 1 62 ARG 62 86 86 ARG ARG A . n A 1 63 TRP 63 87 87 TRP TRP A . n A 1 64 ARG 64 88 88 ARG ARG A . n A 1 65 ALA 65 89 89 ALA ALA A . n A 1 66 VAL 66 90 90 VAL VAL A . n A 1 67 GLN 67 91 91 GLN GLN A . n A 1 68 LYS 68 92 92 LYS LYS A . n A 1 69 LEU 69 93 93 LEU LEU A . n A 1 70 GLY 70 94 94 GLY GLY A . n A 1 71 TRP 71 95 95 TRP TRP A . n A 1 72 THR 72 96 96 THR THR A . n A 1 73 GLU 73 97 97 GLU GLU A . n A 1 74 ILE 74 98 98 ILE ILE A . n A 1 75 PRO 75 99 99 PRO PRO A . n A 1 76 ALA 76 100 100 ALA ALA A . n A 1 77 ILE 77 101 101 ILE ILE A . n A 1 78 ILE 78 102 102 ILE ILE A . n A 1 79 LYS 79 103 103 LYS LYS A . n A 1 80 ASN 80 104 104 ASN ASN A . n A 1 81 LEU 81 105 105 LEU LEU A . n A 1 82 ASN 82 106 106 ASN ASN A . n A 1 83 ASP 83 107 107 ASP ASP A . n A 1 84 LYS 84 108 108 LYS LYS A . n A 1 85 GLU 85 109 109 GLU GLU A . n A 1 86 THR 86 110 110 THR THR A . n A 1 87 ALA 87 111 111 ALA ALA A . n A 1 88 SER 88 112 112 SER SER A . n A 1 89 VAL 89 113 113 VAL VAL A . n A 1 90 ALA 90 114 114 ALA ALA A . n A 1 91 LEU 91 115 115 LEU LEU A . n A 1 92 ILE 92 116 116 ILE ILE A . n A 1 93 GLU 93 117 117 GLU GLU A . n A 1 94 ASN 94 118 118 ASN ASN A . n A 1 95 LEU 95 119 119 LEU LEU A . n A 1 96 GLN 96 120 120 GLN GLN A . n A 1 97 ARG 97 121 121 ARG ARG A . n A 1 98 GLU 98 122 122 GLU GLU A . n A 1 99 GLU 99 123 123 GLU GLU A . n A 1 100 LEU 100 124 124 LEU LEU A . n A 1 101 THR 101 125 125 THR THR A . n A 1 102 PRO 102 126 126 PRO PRO A . n A 1 103 ILE 103 127 127 ILE ILE A . n A 1 104 GLU 104 128 128 GLU GLU A . n A 1 105 GLU 105 129 129 GLU GLU A . n A 1 106 ALA 106 130 130 ALA ALA A . n A 1 107 MET 107 131 131 MET MET A . n A 1 108 ALA 108 132 132 ALA ALA A . n A 1 109 TYR 109 133 133 TYR TYR A . n A 1 110 ALA 110 134 134 ALA ALA A . n A 1 111 LYS 111 135 135 LYS LYS A . n A 1 112 LEU 112 136 136 LEU LEU A . n A 1 113 ILE 113 137 137 ILE ILE A . n A 1 114 GLU 114 138 138 GLU GLU A . n A 1 115 LEU 115 139 139 LEU LEU A . n A 1 116 HIS 116 140 140 HIS HIS A . n A 1 117 ASP 117 141 141 ASP ASP A . n A 1 118 LEU 118 142 142 LEU LEU A . n A 1 119 THR 119 143 143 THR THR A . n A 1 120 GLN 120 144 144 GLN GLN A . n A 1 121 GLU 121 145 145 GLU GLU A . n A 1 122 ALA 122 146 146 ALA ALA A . n A 1 123 LEU 123 147 147 LEU LEU A . n A 1 124 ALA 124 148 148 ALA ALA A . n A 1 125 GLN 125 149 149 GLN GLN A . n A 1 126 ARG 126 150 150 ARG ARG A . n A 1 127 LEU 127 151 151 LEU LEU A . n A 1 128 GLY 128 152 152 GLY GLY A . n A 1 129 LYS 129 153 153 LYS LYS A . n A 1 130 GLY 130 154 154 GLY GLY A . n A 1 131 GLN 131 155 155 GLN GLN A . n A 1 132 SER 132 156 156 SER SER A . n A 1 133 THR 133 157 157 THR THR A . n A 1 134 ILE 134 158 158 ILE ILE A . n A 1 135 ALA 135 159 159 ALA ALA A . n A 1 136 ASN 136 160 160 ASN ASN A . n A 1 137 LYS 137 161 161 LYS LYS A . n A 1 138 LEU 138 162 162 LEU LEU A . n A 1 139 ARG 139 163 163 ARG ARG A . n A 1 140 LEU 140 164 164 LEU LEU A . n A 1 141 LEU 141 165 165 LEU LEU A . n A 1 142 LYS 142 166 166 LYS LYS A . n A 1 143 LEU 143 167 167 LEU LEU A . n A 1 144 PRO 144 168 168 PRO PRO A . n A 1 145 GLN 145 169 169 GLN GLN A . n A 1 146 GLU 146 170 170 GLU GLU A . n A 1 147 VAL 147 171 171 VAL VAL A . n A 1 148 GLN 148 172 172 GLN GLN A . n A 1 149 GLU 149 173 173 GLU GLU A . n A 1 150 ALA 150 174 174 ALA ALA A . n A 1 151 LEU 151 175 175 LEU LEU A . n A 1 152 LEU 152 176 176 LEU LEU A . n A 1 153 GLN 153 177 177 GLN GLN A . n A 1 154 ARG 154 178 178 ARG ARG A . n A 1 155 ALA 155 179 179 ALA ALA A . n A 1 156 ILE 156 180 180 ILE ILE A . n A 1 157 THR 157 181 181 THR THR A . n A 1 158 GLU 158 182 182 GLU GLU A . n A 1 159 ARG 159 183 183 ARG ARG A . n A 1 160 HIS 160 184 184 HIS HIS A . n A 1 161 ALA 161 185 185 ALA ALA A . n A 1 162 ARG 162 186 186 ARG ARG A . n A 1 163 ALA 163 187 187 ALA ALA A . n A 1 164 LEU 164 188 188 LEU LEU A . n A 1 165 ILE 165 189 189 ILE ILE A . n A 1 166 ALA 166 190 190 ALA ALA A . n A 1 167 LEU 167 191 191 LEU LEU A . n A 1 168 LYS 168 192 192 LYS LYS A . n A 1 169 ASP 169 193 193 ASP ASP A . n A 1 170 LYS 170 194 194 LYS LYS A . n A 1 171 GLU 171 195 195 GLU GLU A . n A 1 172 LYS 172 196 196 LYS LYS A . n A 1 173 GLN 173 197 197 GLN GLN A . n A 1 174 LEU 174 198 198 LEU LEU A . n A 1 175 LYS 175 199 199 LYS LYS A . n A 1 176 LEU 176 200 200 LEU LEU A . n A 1 177 LEU 177 201 201 LEU LEU A . n A 1 178 GLN 178 202 202 GLN GLN A . n A 1 179 GLU 179 203 203 GLU GLU A . n A 1 180 ILE 180 204 204 ILE ILE A . n A 1 181 ILE 181 205 205 ILE ILE A . n A 1 182 ASP 182 206 206 ASP ASP A . n A 1 183 LYS 183 207 207 LYS LYS A . n A 1 184 GLN 184 208 208 GLN GLN A . n A 1 185 LEU 185 209 209 LEU LEU A . n A 1 186 ASN 186 210 210 ASN ASN A . n A 1 187 VAL 187 211 211 VAL VAL A . n A 1 188 LYS 188 212 212 LYS LYS A . n A 1 189 GLN 189 213 213 GLN GLN A . n A 1 190 THR 190 214 214 THR THR A . n A 1 191 GLU 191 215 215 GLU GLU A . n A 1 192 ASP 192 216 216 ASP ASP A . n A 1 193 ARG 193 217 217 ARG ARG A . n A 1 194 VAL 194 218 218 VAL VAL A . n A 1 195 LEU 195 219 219 LEU LEU A . n A 1 196 LYS 196 220 220 LYS LYS A . n A 1 197 LEU 197 221 221 LEU LEU A . n A 1 198 LEU 198 222 222 LEU LEU A . n A 1 199 GLU 199 223 223 GLU GLU A . n A 1 200 ALA 200 224 224 ALA ALA A . n A 1 201 GLY 201 225 ? ? ? A . n A 1 202 GLU 202 226 ? ? ? A . n A 1 203 ARG 203 227 ? ? ? A . n A 1 204 LYS 204 228 ? ? ? A . n A 1 205 PRO 205 229 ? ? ? A . n A 1 206 LYS 206 230 ? ? ? A . n A 1 207 PRO 207 231 ? ? ? A . n A 1 208 LYS 208 232 ? ? ? A . n A 1 209 ARG 209 233 ? ? ? A . n A 1 210 LYS 210 234 ? ? ? A . n A 1 211 ALA 211 235 ? ? ? A . n A 1 212 PHE 212 236 ? ? ? A . n A 1 213 SER 213 237 ? ? ? A . n A 1 214 ARG 214 238 ? ? ? A . n A 1 215 ASP 215 239 ? ? ? A . n A 1 216 LYS 216 240 ? ? ? A . n A 1 217 LEU 217 241 ? ? ? A . n A 1 218 ALA 218 242 ? ? ? A . n A 1 219 ALA 219 243 ? ? ? A . n A 1 220 ALA 220 244 ? ? ? A . n A 1 221 LEU 221 245 ? ? ? A . n A 1 222 GLU 222 246 ? ? ? A . n A 1 223 HIS 223 247 ? ? ? A . n A 1 224 HIS 224 248 ? ? ? A . n A 1 225 HIS 225 249 ? ? ? A . n A 1 226 HIS 226 250 ? ? ? A . n A 1 227 HIS 227 251 ? ? ? A . n A 1 228 HIS 228 252 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id SO4 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 301 _pdbx_nonpoly_scheme.pdb_mon_id SO4 _pdbx_nonpoly_scheme.auth_mon_id SO4 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5850 ? 1 MORE -68 ? 1 'SSA (A^2)' 17930 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_554 -x,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -21.1075000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-02-17 2 'Structure model' 1 1 2021-07-28 3 'Structure model' 1 2 2021-09-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7NG0 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 34 ? CG ? A LYS 10 CG 2 1 Y 1 A LYS 34 ? CD ? A LYS 10 CD 3 1 Y 1 A LYS 34 ? CE ? A LYS 10 CE 4 1 Y 1 A LYS 34 ? NZ ? A LYS 10 NZ 5 1 Y 1 A ARG 40 ? CG ? A ARG 16 CG 6 1 Y 1 A ARG 40 ? CD ? A ARG 16 CD 7 1 Y 1 A ARG 40 ? NE ? A ARG 16 NE 8 1 Y 1 A ARG 40 ? CZ ? A ARG 16 CZ 9 1 Y 1 A ARG 40 ? NH1 ? A ARG 16 NH1 10 1 Y 1 A ARG 40 ? NH2 ? A ARG 16 NH2 11 1 Y 1 A MET 46 ? CG ? A MET 22 CG 12 1 Y 1 A MET 46 ? SD ? A MET 22 SD 13 1 Y 1 A MET 46 ? CE ? A MET 22 CE 14 1 Y 1 A GLU 50 ? CG ? A GLU 26 CG 15 1 Y 1 A GLU 50 ? CD ? A GLU 26 CD 16 1 Y 1 A GLU 50 ? OE1 ? A GLU 26 OE1 17 1 Y 1 A GLU 50 ? OE2 ? A GLU 26 OE2 18 1 Y 1 A ARG 60 ? CG ? A ARG 36 CG 19 1 Y 1 A ARG 60 ? CD ? A ARG 36 CD 20 1 Y 1 A ARG 60 ? NE ? A ARG 36 NE 21 1 Y 1 A ARG 60 ? CZ ? A ARG 36 CZ 22 1 Y 1 A ARG 60 ? NH1 ? A ARG 36 NH1 23 1 Y 1 A ARG 60 ? NH2 ? A ARG 36 NH2 24 1 Y 1 A THR 61 ? OG1 ? A THR 37 OG1 25 1 Y 1 A THR 61 ? CG2 ? A THR 37 CG2 26 1 Y 1 A ILE 64 ? CG1 ? A ILE 40 CG1 27 1 Y 1 A ILE 64 ? CG2 ? A ILE 40 CG2 28 1 Y 1 A ILE 64 ? CD1 ? A ILE 40 CD1 29 1 Y 1 A ASN 75 ? CG ? A ASN 51 CG 30 1 Y 1 A ASN 75 ? OD1 ? A ASN 51 OD1 31 1 Y 1 A ASN 75 ? ND2 ? A ASN 51 ND2 32 1 Y 1 A ARG 77 ? CG ? A ARG 53 CG 33 1 Y 1 A ARG 77 ? CD ? A ARG 53 CD 34 1 Y 1 A ARG 77 ? NE ? A ARG 53 NE 35 1 Y 1 A ARG 77 ? CZ ? A ARG 53 CZ 36 1 Y 1 A ARG 77 ? NH1 ? A ARG 53 NH1 37 1 Y 1 A ARG 77 ? NH2 ? A ARG 53 NH2 38 1 Y 1 A LYS 103 ? CG ? A LYS 79 CG 39 1 Y 1 A LYS 103 ? CD ? A LYS 79 CD 40 1 Y 1 A LYS 103 ? CE ? A LYS 79 CE 41 1 Y 1 A LYS 103 ? NZ ? A LYS 79 NZ 42 1 Y 1 A ASN 104 ? CG ? A ASN 80 CG 43 1 Y 1 A ASN 104 ? OD1 ? A ASN 80 OD1 44 1 Y 1 A ASN 104 ? ND2 ? A ASN 80 ND2 45 1 Y 1 A GLU 145 ? CG ? A GLU 121 CG 46 1 Y 1 A GLU 145 ? CD ? A GLU 121 CD 47 1 Y 1 A GLU 145 ? OE1 ? A GLU 121 OE1 48 1 Y 1 A GLU 145 ? OE2 ? A GLU 121 OE2 49 1 Y 1 A ARG 163 ? CG ? A ARG 139 CG 50 1 Y 1 A ARG 163 ? CD ? A ARG 139 CD 51 1 Y 1 A ARG 163 ? NE ? A ARG 139 NE 52 1 Y 1 A ARG 163 ? CZ ? A ARG 139 CZ 53 1 Y 1 A ARG 163 ? NH1 ? A ARG 139 NH1 54 1 Y 1 A ARG 163 ? NH2 ? A ARG 139 NH2 55 1 Y 1 A LYS 166 ? CG ? A LYS 142 CG 56 1 Y 1 A LYS 166 ? CD ? A LYS 142 CD 57 1 Y 1 A LYS 166 ? CE ? A LYS 142 CE 58 1 Y 1 A LYS 166 ? NZ ? A LYS 142 NZ 59 1 Y 1 A GLN 177 ? CG ? A GLN 153 CG 60 1 Y 1 A GLN 177 ? CD ? A GLN 153 CD 61 1 Y 1 A GLN 177 ? OE1 ? A GLN 153 OE1 62 1 Y 1 A GLN 177 ? NE2 ? A GLN 153 NE2 63 1 Y 1 A ARG 183 ? CG ? A ARG 159 CG 64 1 Y 1 A ARG 183 ? CD ? A ARG 159 CD 65 1 Y 1 A ARG 183 ? NE ? A ARG 159 NE 66 1 Y 1 A ARG 183 ? CZ ? A ARG 159 CZ 67 1 Y 1 A ARG 183 ? NH1 ? A ARG 159 NH1 68 1 Y 1 A ARG 183 ? NH2 ? A ARG 159 NH2 69 1 Y 1 A GLU 195 ? CG ? A GLU 171 CG 70 1 Y 1 A GLU 195 ? CD ? A GLU 171 CD 71 1 Y 1 A GLU 195 ? OE1 ? A GLU 171 OE1 72 1 Y 1 A GLU 195 ? OE2 ? A GLU 171 OE2 73 1 Y 1 A LYS 196 ? CG ? A LYS 172 CG 74 1 Y 1 A LYS 196 ? CD ? A LYS 172 CD 75 1 Y 1 A LYS 196 ? CE ? A LYS 172 CE 76 1 Y 1 A LYS 196 ? NZ ? A LYS 172 NZ 77 1 Y 1 A LYS 199 ? CG ? A LYS 175 CG 78 1 Y 1 A LYS 199 ? CD ? A LYS 175 CD 79 1 Y 1 A LYS 199 ? CE ? A LYS 175 CE 80 1 Y 1 A LYS 199 ? NZ ? A LYS 175 NZ 81 1 Y 1 A LYS 207 ? CE ? A LYS 183 CE 82 1 Y 1 A LYS 207 ? NZ ? A LYS 183 NZ 83 1 Y 1 A LYS 212 ? CG ? A LYS 188 CG 84 1 Y 1 A LYS 212 ? CD ? A LYS 188 CD 85 1 Y 1 A LYS 212 ? CE ? A LYS 188 CE 86 1 Y 1 A LYS 212 ? NZ ? A LYS 188 NZ 87 1 Y 1 A ARG 217 ? CG ? A ARG 193 CG 88 1 Y 1 A ARG 217 ? CD ? A ARG 193 CD 89 1 Y 1 A ARG 217 ? NE ? A ARG 193 NE 90 1 Y 1 A ARG 217 ? CZ ? A ARG 193 CZ 91 1 Y 1 A ARG 217 ? NH1 ? A ARG 193 NH1 92 1 Y 1 A ARG 217 ? NH2 ? A ARG 193 NH2 93 1 Y 1 A LYS 220 ? CG ? A LYS 196 CG 94 1 Y 1 A LYS 220 ? CD ? A LYS 196 CD 95 1 Y 1 A LYS 220 ? CE ? A LYS 196 CE 96 1 Y 1 A LYS 220 ? NZ ? A LYS 196 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 25 ? A MET 1 2 1 Y 1 A GLY 225 ? A GLY 201 3 1 Y 1 A GLU 226 ? A GLU 202 4 1 Y 1 A ARG 227 ? A ARG 203 5 1 Y 1 A LYS 228 ? A LYS 204 6 1 Y 1 A PRO 229 ? A PRO 205 7 1 Y 1 A LYS 230 ? A LYS 206 8 1 Y 1 A PRO 231 ? A PRO 207 9 1 Y 1 A LYS 232 ? A LYS 208 10 1 Y 1 A ARG 233 ? A ARG 209 11 1 Y 1 A LYS 234 ? A LYS 210 12 1 Y 1 A ALA 235 ? A ALA 211 13 1 Y 1 A PHE 236 ? A PHE 212 14 1 Y 1 A SER 237 ? A SER 213 15 1 Y 1 A ARG 238 ? A ARG 214 16 1 Y 1 A ASP 239 ? A ASP 215 17 1 Y 1 A LYS 240 ? A LYS 216 18 1 Y 1 A LEU 241 ? A LEU 217 19 1 Y 1 A ALA 242 ? A ALA 218 20 1 Y 1 A ALA 243 ? A ALA 219 21 1 Y 1 A ALA 244 ? A ALA 220 22 1 Y 1 A LEU 245 ? A LEU 221 23 1 Y 1 A GLU 246 ? A GLU 222 24 1 Y 1 A HIS 247 ? A HIS 223 25 1 Y 1 A HIS 248 ? A HIS 224 26 1 Y 1 A HIS 249 ? A HIS 225 27 1 Y 1 A HIS 250 ? A HIS 226 28 1 Y 1 A HIS 251 ? A HIS 227 29 1 Y 1 A HIS 252 ? A HIS 228 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Royal Society' 'United Kingdom' URF-R-201020 1 'Wellcome Trust' 'United Kingdom' 209500 2 'Royal Society' 'United Kingdom' RG150448 3 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BBS-E-J-000C0683 4 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'SULFATE ION' _pdbx_entity_nonpoly.comp_id SO4 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #