data_7NND # _entry.id 7NND # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NND pdb_00007nnd 10.2210/pdb7nnd/pdb WWPDB D_1292114327 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-12 2 'Structure model' 1 1 2022-01-26 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7NND _pdbx_database_status.recvd_initial_deposition_date 2021-02-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Centorrino, F.' 1 ? 'Ottmann, C.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Curr Res Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2665-928X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 21 _citation.page_last 28 _citation.title 'Fragment-based exploration of the 14-3-3/Amot-p130 interface.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.crstbi.2021.12.003 _citation.pdbx_database_id_PubMed 35036934 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Centorrino, F.' 1 ? primary 'Andlovic, B.' 2 ? primary 'Cossar, P.' 3 ? primary 'Brunsveld, L.' 4 ? primary 'Ottmann, C.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 28226.518 1 ? ? ? ? 2 polymer syn 'Amot-p130 phosphopeptide (pS175)' 1626.817 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 non-polymer syn '5-[1-(2-azanylethyl)imidazol-4-yl]-4-phenyl-thiophene-2-carboximidamide' 311.405 1 ? ? ? ? 6 water nat water 18.015 357 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Epithelial cell marker protein 1,Stratifin' 2 Angiomotin # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELS(CSO)EERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNE EGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAY QEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ADNAGEEGGEAPQEPQS ; ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNA GEEGGEAPQEPQS ; A ? 2 'polypeptide(L)' no yes 'GHVRSL(SEP)ERLMQM' GHVRSLSERLMQM P ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CHLORIDE ION' CL 4 'MAGNESIUM ION' MG 5 '5-[1-(2-azanylethyl)imidazol-4-yl]-4-phenyl-thiophene-2-carboximidamide' K7N 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ARG n 1 9 ALA n 1 10 SER n 1 11 LEU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 ALA n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLU n 1 26 ASP n 1 27 MET n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 MET n 1 32 LYS n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 CSO n 1 44 GLU n 1 45 GLU n 1 46 ARG n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ALA n 1 63 ALA n 1 64 TRP n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 ILE n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 SER n 1 75 ASN n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 TYR n 1 90 ARG n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 CYS n 1 102 ASP n 1 103 THR n 1 104 VAL n 1 105 LEU n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 HIS n 1 112 LEU n 1 113 ILE n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 ASP n 1 119 ALA n 1 120 GLU n 1 121 SER n 1 122 ARG n 1 123 VAL n 1 124 PHE n 1 125 TYR n 1 126 LEU n 1 127 LYS n 1 128 MET n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 TYR n 1 133 TYR n 1 134 ARG n 1 135 TYR n 1 136 LEU n 1 137 ALA n 1 138 GLU n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 ARG n 1 148 ILE n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ALA n 1 153 ARG n 1 154 SER n 1 155 ALA n 1 156 TYR n 1 157 GLN n 1 158 GLU n 1 159 ALA n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 SER n 1 164 LYS n 1 165 LYS n 1 166 GLU n 1 167 MET n 1 168 PRO n 1 169 PRO n 1 170 THR n 1 171 ASN n 1 172 PRO n 1 173 ILE n 1 174 ARG n 1 175 LEU n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 LEU n 1 180 ASN n 1 181 PHE n 1 182 SER n 1 183 VAL n 1 184 PHE n 1 185 HIS n 1 186 TYR n 1 187 GLU n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 ALA n 1 196 ILE n 1 197 SER n 1 198 LEU n 1 199 ALA n 1 200 LYS n 1 201 THR n 1 202 THR n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ALA n 1 207 MET n 1 208 ALA n 1 209 ASP n 1 210 LEU n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 SER n 1 215 GLU n 1 216 ASP n 1 217 SER n 1 218 TYR n 1 219 LYS n 1 220 ASP n 1 221 SER n 1 222 THR n 1 223 LEU n 1 224 ILE n 1 225 MET n 1 226 GLN n 1 227 LEU n 1 228 LEU n 1 229 ARG n 1 230 ASP n 1 231 ASN n 1 232 LEU n 1 233 THR n 1 234 LEU n 1 235 TRP n 1 236 THR n 1 237 ALA n 1 238 ASP n 1 239 ASN n 1 240 ALA n 1 241 GLY n 1 242 GLU n 1 243 GLU n 1 244 GLY n 1 245 GLY n 1 246 GLU n 1 247 ALA n 1 248 PRO n 1 249 GLN n 1 250 GLU n 1 251 PRO n 1 252 GLN n 1 253 SER n 2 1 GLY n 2 2 HIS n 2 3 VAL n 2 4 ARG n 2 5 SER n 2 6 LEU n 2 7 SEP n 2 8 GLU n 2 9 ARG n 2 10 LEU n 2 11 MET n 2 12 GLN n 2 13 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 253 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SFN, HME1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 13 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K7N non-polymer . '5-[1-(2-azanylethyl)imidazol-4-yl]-4-phenyl-thiophene-2-carboximidamide' ? 'C16 H17 N5 S' 311.405 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 MET 3 -2 -2 MET MET A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ARG 8 3 3 ARG ARG A . n A 1 9 ALA 9 4 4 ALA ALA A . n A 1 10 SER 10 5 5 SER SER A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 GLN 13 8 8 GLN GLN A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 GLU 22 17 17 GLU GLU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 TYR 24 19 19 TYR TYR A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 ASP 26 21 21 ASP ASP A . n A 1 27 MET 27 22 22 MET MET A . n A 1 28 ALA 28 23 23 ALA ALA A . n A 1 29 ALA 29 24 24 ALA ALA A . n A 1 30 PHE 30 25 25 PHE PHE A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LEU 41 36 36 LEU LEU A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 CSO 43 38 38 CSO CSO A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ASN 47 42 42 ASN ASN A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 GLY 58 53 53 GLY GLY A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 GLN 60 55 55 GLN GLN A . n A 1 61 ARG 61 56 56 ARG ARG A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ARG 65 60 60 ARG ARG A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 SER 69 64 64 SER SER A . n A 1 70 ILE 70 65 65 ILE ILE A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 GLN 72 67 67 GLN GLN A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 GLU 76 71 71 GLU GLU A . n A 1 77 GLU 77 72 ? ? ? A . n A 1 78 GLY 78 73 ? ? ? A . n A 1 79 SER 79 74 74 SER SER A . n A 1 80 GLU 80 75 75 GLU GLU A . n A 1 81 GLU 81 76 76 GLU GLU A . n A 1 82 LYS 82 77 ? ? ? A . n A 1 83 GLY 83 78 78 GLY GLY A . n A 1 84 PRO 84 79 79 PRO PRO A . n A 1 85 GLU 85 80 80 GLU GLU A . n A 1 86 VAL 86 81 81 VAL VAL A . n A 1 87 ARG 87 82 82 ARG ARG A . n A 1 88 GLU 88 83 83 GLU GLU A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 ARG 90 85 85 ARG ARG A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 THR 95 90 90 THR THR A . n A 1 96 GLU 96 91 91 GLU GLU A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLN 98 93 93 GLN GLN A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 CYS 101 96 96 CYS CYS A . n A 1 102 ASP 102 97 97 ASP ASP A . n A 1 103 THR 103 98 98 THR THR A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 LEU 105 100 100 LEU LEU A . n A 1 106 GLY 106 101 101 GLY GLY A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ASP 109 104 104 ASP ASP A . n A 1 110 SER 110 105 105 SER SER A . n A 1 111 HIS 111 106 106 HIS HIS A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 ILE 113 108 108 ILE ILE A . n A 1 114 LYS 114 109 109 LYS LYS A . n A 1 115 GLU 115 110 110 GLU GLU A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 ASP 118 113 113 ASP ASP A . n A 1 119 ALA 119 114 114 ALA ALA A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 SER 121 116 116 SER SER A . n A 1 122 ARG 122 117 117 ARG ARG A . n A 1 123 VAL 123 118 118 VAL VAL A . n A 1 124 PHE 124 119 119 PHE PHE A . n A 1 125 TYR 125 120 120 TYR TYR A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 MET 128 123 123 MET MET A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 GLY 130 125 125 GLY GLY A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 TYR 135 130 130 TYR TYR A . n A 1 136 LEU 136 131 131 LEU LEU A . n A 1 137 ALA 137 132 132 ALA ALA A . n A 1 138 GLU 138 133 133 GLU GLU A . n A 1 139 VAL 139 134 134 VAL VAL A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 THR 141 136 136 THR THR A . n A 1 142 GLY 142 137 ? ? ? A . n A 1 143 ASP 143 138 ? ? ? A . n A 1 144 ASP 144 139 139 ASP ASP A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 ILE 149 144 144 ILE ILE A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 ALA 152 147 147 ALA ALA A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 SER 154 149 149 SER SER A . n A 1 155 ALA 155 150 150 ALA ALA A . n A 1 156 TYR 156 151 151 TYR TYR A . n A 1 157 GLN 157 152 152 GLN GLN A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 ALA 159 154 154 ALA ALA A . n A 1 160 MET 160 155 155 MET MET A . n A 1 161 ASP 161 156 156 ASP ASP A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 SER 163 158 158 SER SER A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 LYS 165 160 160 LYS LYS A . n A 1 166 GLU 166 161 161 GLU GLU A . n A 1 167 MET 167 162 162 MET MET A . n A 1 168 PRO 168 163 163 PRO PRO A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 THR 170 165 165 THR THR A . n A 1 171 ASN 171 166 166 ASN ASN A . n A 1 172 PRO 172 167 167 PRO PRO A . n A 1 173 ILE 173 168 168 ILE ILE A . n A 1 174 ARG 174 169 169 ARG ARG A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 LEU 177 172 172 LEU LEU A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LEU 179 174 174 LEU LEU A . n A 1 180 ASN 180 175 175 ASN ASN A . n A 1 181 PHE 181 176 176 PHE PHE A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 VAL 183 178 178 VAL VAL A . n A 1 184 PHE 184 179 179 PHE PHE A . n A 1 185 HIS 185 180 180 HIS HIS A . n A 1 186 TYR 186 181 181 TYR TYR A . n A 1 187 GLU 187 182 182 GLU GLU A . n A 1 188 ILE 188 183 183 ILE ILE A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 ASN 190 185 185 ASN ASN A . n A 1 191 SER 191 186 186 SER SER A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLU 194 189 189 GLU GLU A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 ILE 196 191 191 ILE ILE A . n A 1 197 SER 197 192 192 SER SER A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ALA 199 194 194 ALA ALA A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 THR 201 196 196 THR THR A . n A 1 202 THR 202 197 197 THR THR A . n A 1 203 PHE 203 198 198 PHE PHE A . n A 1 204 ASP 204 199 199 ASP ASP A . n A 1 205 GLU 205 200 200 GLU GLU A . n A 1 206 ALA 206 201 201 ALA ALA A . n A 1 207 MET 207 202 202 MET MET A . n A 1 208 ALA 208 203 203 ALA ALA A . n A 1 209 ASP 209 204 204 ASP ASP A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 HIS 211 206 206 HIS HIS A . n A 1 212 THR 212 207 207 THR THR A . n A 1 213 LEU 213 208 208 LEU LEU A . n A 1 214 SER 214 209 209 SER SER A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ASP 216 211 211 ASP ASP A . n A 1 217 SER 217 212 212 SER SER A . n A 1 218 TYR 218 213 213 TYR TYR A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ASP 220 215 215 ASP ASP A . n A 1 221 SER 221 216 216 SER SER A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 MET 225 220 220 MET MET A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 LEU 228 223 223 LEU LEU A . n A 1 229 ARG 229 224 224 ARG ARG A . n A 1 230 ASP 230 225 225 ASP ASP A . n A 1 231 ASN 231 226 226 ASN ASN A . n A 1 232 LEU 232 227 227 LEU LEU A . n A 1 233 THR 233 228 228 THR THR A . n A 1 234 LEU 234 229 229 LEU LEU A . n A 1 235 TRP 235 230 230 TRP TRP A . n A 1 236 THR 236 231 231 THR THR A . n A 1 237 ALA 237 232 ? ? ? A . n A 1 238 ASP 238 233 ? ? ? A . n A 1 239 ASN 239 234 ? ? ? A . n A 1 240 ALA 240 235 ? ? ? A . n A 1 241 GLY 241 236 ? ? ? A . n A 1 242 GLU 242 237 ? ? ? A . n A 1 243 GLU 243 238 ? ? ? A . n A 1 244 GLY 244 239 ? ? ? A . n A 1 245 GLY 245 240 ? ? ? A . n A 1 246 GLU 246 241 ? ? ? A . n A 1 247 ALA 247 242 ? ? ? A . n A 1 248 PRO 248 243 ? ? ? A . n A 1 249 GLN 249 244 ? ? ? A . n A 1 250 GLU 250 245 ? ? ? A . n A 1 251 PRO 251 246 ? ? ? A . n A 1 252 GLN 252 247 ? ? ? A . n A 1 253 SER 253 248 ? ? ? A . n B 2 1 GLY 1 169 ? ? ? P . n B 2 2 HIS 2 170 ? ? ? P . n B 2 3 VAL 3 171 ? ? ? P . n B 2 4 ARG 4 172 172 ARG ARG P . n B 2 5 SER 5 173 173 SER SER P . n B 2 6 LEU 6 174 174 LEU LEU P . n B 2 7 SEP 7 175 175 SEP SEP P . n B 2 8 GLU 8 176 176 GLU GLU P . n B 2 9 ARG 9 177 177 ARG ARG P . n B 2 10 LEU 10 178 178 LEU LEU P . n B 2 11 MET 11 179 179 MET MET P . n B 2 12 GLN 12 180 180 GLN GLN P . n B 2 13 MET 13 181 ? ? ? P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CL 1 301 1 CL CL A . D 4 MG 1 302 2 MG MG A . E 5 K7N 1 303 1 K7N LIG A . F 6 HOH 1 401 292 HOH HOH A . F 6 HOH 2 402 114 HOH HOH A . F 6 HOH 3 403 163 HOH HOH A . F 6 HOH 4 404 245 HOH HOH A . F 6 HOH 5 405 407 HOH HOH A . F 6 HOH 6 406 110 HOH HOH A . F 6 HOH 7 407 218 HOH HOH A . F 6 HOH 8 408 6 HOH HOH A . F 6 HOH 9 409 321 HOH HOH A . F 6 HOH 10 410 206 HOH HOH A . F 6 HOH 11 411 101 HOH HOH A . F 6 HOH 12 412 159 HOH HOH A . F 6 HOH 13 413 299 HOH HOH A . F 6 HOH 14 414 241 HOH HOH A . F 6 HOH 15 415 233 HOH HOH A . F 6 HOH 16 416 152 HOH HOH A . F 6 HOH 17 417 170 HOH HOH A . F 6 HOH 18 418 290 HOH HOH A . F 6 HOH 19 419 329 HOH HOH A . F 6 HOH 20 420 87 HOH HOH A . F 6 HOH 21 421 392 HOH HOH A . F 6 HOH 22 422 30 HOH HOH A . F 6 HOH 23 423 56 HOH HOH A . F 6 HOH 24 424 16 HOH HOH A . F 6 HOH 25 425 172 HOH HOH A . F 6 HOH 26 426 186 HOH HOH A . F 6 HOH 27 427 9 HOH HOH A . F 6 HOH 28 428 243 HOH HOH A . F 6 HOH 29 429 121 HOH HOH A . F 6 HOH 30 430 251 HOH HOH A . F 6 HOH 31 431 297 HOH HOH A . F 6 HOH 32 432 355 HOH HOH A . F 6 HOH 33 433 33 HOH HOH A . F 6 HOH 34 434 84 HOH HOH A . F 6 HOH 35 435 399 HOH HOH A . F 6 HOH 36 436 80 HOH HOH A . F 6 HOH 37 437 176 HOH HOH A . F 6 HOH 38 438 197 HOH HOH A . F 6 HOH 39 439 49 HOH HOH A . F 6 HOH 40 440 256 HOH HOH A . F 6 HOH 41 441 8 HOH HOH A . F 6 HOH 42 442 5 HOH HOH A . F 6 HOH 43 443 184 HOH HOH A . F 6 HOH 44 444 139 HOH HOH A . F 6 HOH 45 445 155 HOH HOH A . F 6 HOH 46 446 25 HOH HOH A . F 6 HOH 47 447 29 HOH HOH A . F 6 HOH 48 448 204 HOH HOH A . F 6 HOH 49 449 54 HOH HOH A . F 6 HOH 50 450 190 HOH HOH A . F 6 HOH 51 451 162 HOH HOH A . F 6 HOH 52 452 88 HOH HOH A . F 6 HOH 53 453 255 HOH HOH A . F 6 HOH 54 454 414 HOH HOH A . F 6 HOH 55 455 210 HOH HOH A . F 6 HOH 56 456 63 HOH HOH A . F 6 HOH 57 457 64 HOH HOH A . F 6 HOH 58 458 92 HOH HOH A . F 6 HOH 59 459 73 HOH HOH A . F 6 HOH 60 460 272 HOH HOH A . F 6 HOH 61 461 341 HOH HOH A . F 6 HOH 62 462 250 HOH HOH A . F 6 HOH 63 463 185 HOH HOH A . F 6 HOH 64 464 175 HOH HOH A . F 6 HOH 65 465 83 HOH HOH A . F 6 HOH 66 466 27 HOH HOH A . F 6 HOH 67 467 127 HOH HOH A . F 6 HOH 68 468 202 HOH HOH A . F 6 HOH 69 469 177 HOH HOH A . F 6 HOH 70 470 217 HOH HOH A . F 6 HOH 71 471 3 HOH HOH A . F 6 HOH 72 472 4 HOH HOH A . F 6 HOH 73 473 61 HOH HOH A . F 6 HOH 74 474 169 HOH HOH A . F 6 HOH 75 475 23 HOH HOH A . F 6 HOH 76 476 2 HOH HOH A . F 6 HOH 77 477 77 HOH HOH A . F 6 HOH 78 478 59 HOH HOH A . F 6 HOH 79 479 135 HOH HOH A . F 6 HOH 80 480 81 HOH HOH A . F 6 HOH 81 481 203 HOH HOH A . F 6 HOH 82 482 249 HOH HOH A . F 6 HOH 83 483 144 HOH HOH A . F 6 HOH 84 484 21 HOH HOH A . F 6 HOH 85 485 68 HOH HOH A . F 6 HOH 86 486 229 HOH HOH A . F 6 HOH 87 487 400 HOH HOH A . F 6 HOH 88 488 17 HOH HOH A . F 6 HOH 89 489 10 HOH HOH A . F 6 HOH 90 490 32 HOH HOH A . F 6 HOH 91 491 354 HOH HOH A . F 6 HOH 92 492 239 HOH HOH A . F 6 HOH 93 493 205 HOH HOH A . F 6 HOH 94 494 160 HOH HOH A . F 6 HOH 95 495 276 HOH HOH A . F 6 HOH 96 496 230 HOH HOH A . F 6 HOH 97 497 142 HOH HOH A . F 6 HOH 98 498 13 HOH HOH A . F 6 HOH 99 499 113 HOH HOH A . F 6 HOH 100 500 234 HOH HOH A . F 6 HOH 101 501 151 HOH HOH A . F 6 HOH 102 502 306 HOH HOH A . F 6 HOH 103 503 34 HOH HOH A . F 6 HOH 104 504 116 HOH HOH A . F 6 HOH 105 505 308 HOH HOH A . F 6 HOH 106 506 12 HOH HOH A . F 6 HOH 107 507 94 HOH HOH A . F 6 HOH 108 508 104 HOH HOH A . F 6 HOH 109 509 335 HOH HOH A . F 6 HOH 110 510 201 HOH HOH A . F 6 HOH 111 511 22 HOH HOH A . F 6 HOH 112 512 44 HOH HOH A . F 6 HOH 113 513 240 HOH HOH A . F 6 HOH 114 514 182 HOH HOH A . F 6 HOH 115 515 24 HOH HOH A . F 6 HOH 116 516 156 HOH HOH A . F 6 HOH 117 517 26 HOH HOH A . F 6 HOH 118 518 72 HOH HOH A . F 6 HOH 119 519 50 HOH HOH A . F 6 HOH 120 520 47 HOH HOH A . F 6 HOH 121 521 132 HOH HOH A . F 6 HOH 122 522 271 HOH HOH A . F 6 HOH 123 523 91 HOH HOH A . F 6 HOH 124 524 45 HOH HOH A . F 6 HOH 125 525 35 HOH HOH A . F 6 HOH 126 526 216 HOH HOH A . F 6 HOH 127 527 158 HOH HOH A . F 6 HOH 128 528 100 HOH HOH A . F 6 HOH 129 529 336 HOH HOH A . F 6 HOH 130 530 280 HOH HOH A . F 6 HOH 131 531 181 HOH HOH A . F 6 HOH 132 532 58 HOH HOH A . F 6 HOH 133 533 89 HOH HOH A . F 6 HOH 134 534 82 HOH HOH A . F 6 HOH 135 535 188 HOH HOH A . F 6 HOH 136 536 194 HOH HOH A . F 6 HOH 137 537 146 HOH HOH A . F 6 HOH 138 538 285 HOH HOH A . F 6 HOH 139 539 19 HOH HOH A . F 6 HOH 140 540 7 HOH HOH A . F 6 HOH 141 541 316 HOH HOH A . F 6 HOH 142 542 38 HOH HOH A . F 6 HOH 143 543 60 HOH HOH A . F 6 HOH 144 544 14 HOH HOH A . F 6 HOH 145 545 78 HOH HOH A . F 6 HOH 146 546 231 HOH HOH A . F 6 HOH 147 547 303 HOH HOH A . F 6 HOH 148 548 147 HOH HOH A . F 6 HOH 149 549 62 HOH HOH A . F 6 HOH 150 550 385 HOH HOH A . F 6 HOH 151 551 171 HOH HOH A . F 6 HOH 152 552 268 HOH HOH A . F 6 HOH 153 553 55 HOH HOH A . F 6 HOH 154 554 53 HOH HOH A . F 6 HOH 155 555 52 HOH HOH A . F 6 HOH 156 556 261 HOH HOH A . F 6 HOH 157 557 342 HOH HOH A . F 6 HOH 158 558 103 HOH HOH A . F 6 HOH 159 559 200 HOH HOH A . F 6 HOH 160 560 238 HOH HOH A . F 6 HOH 161 561 65 HOH HOH A . F 6 HOH 162 562 167 HOH HOH A . F 6 HOH 163 563 124 HOH HOH A . F 6 HOH 164 564 71 HOH HOH A . F 6 HOH 165 565 28 HOH HOH A . F 6 HOH 166 566 344 HOH HOH A . F 6 HOH 167 567 140 HOH HOH A . F 6 HOH 168 568 79 HOH HOH A . F 6 HOH 169 569 157 HOH HOH A . F 6 HOH 170 570 112 HOH HOH A . F 6 HOH 171 571 221 HOH HOH A . F 6 HOH 172 572 93 HOH HOH A . F 6 HOH 173 573 123 HOH HOH A . F 6 HOH 174 574 42 HOH HOH A . F 6 HOH 175 575 166 HOH HOH A . F 6 HOH 176 576 86 HOH HOH A . F 6 HOH 177 577 39 HOH HOH A . F 6 HOH 178 578 95 HOH HOH A . F 6 HOH 179 579 128 HOH HOH A . F 6 HOH 180 580 46 HOH HOH A . F 6 HOH 181 581 220 HOH HOH A . F 6 HOH 182 582 317 HOH HOH A . F 6 HOH 183 583 191 HOH HOH A . F 6 HOH 184 584 362 HOH HOH A . F 6 HOH 185 585 57 HOH HOH A . F 6 HOH 186 586 168 HOH HOH A . F 6 HOH 187 587 244 HOH HOH A . F 6 HOH 188 588 15 HOH HOH A . F 6 HOH 189 589 254 HOH HOH A . F 6 HOH 190 590 76 HOH HOH A . F 6 HOH 191 591 298 HOH HOH A . F 6 HOH 192 592 368 HOH HOH A . F 6 HOH 193 593 126 HOH HOH A . F 6 HOH 194 594 178 HOH HOH A . F 6 HOH 195 595 223 HOH HOH A . F 6 HOH 196 596 338 HOH HOH A . F 6 HOH 197 597 267 HOH HOH A . F 6 HOH 198 598 313 HOH HOH A . F 6 HOH 199 599 90 HOH HOH A . F 6 HOH 200 600 18 HOH HOH A . F 6 HOH 201 601 263 HOH HOH A . F 6 HOH 202 602 130 HOH HOH A . F 6 HOH 203 603 300 HOH HOH A . F 6 HOH 204 604 20 HOH HOH A . F 6 HOH 205 605 153 HOH HOH A . F 6 HOH 206 606 179 HOH HOH A . F 6 HOH 207 607 109 HOH HOH A . F 6 HOH 208 608 48 HOH HOH A . F 6 HOH 209 609 138 HOH HOH A . F 6 HOH 210 610 193 HOH HOH A . F 6 HOH 211 611 328 HOH HOH A . F 6 HOH 212 612 361 HOH HOH A . F 6 HOH 213 613 270 HOH HOH A . F 6 HOH 214 614 187 HOH HOH A . F 6 HOH 215 615 345 HOH HOH A . F 6 HOH 216 616 269 HOH HOH A . F 6 HOH 217 617 40 HOH HOH A . F 6 HOH 218 618 294 HOH HOH A . F 6 HOH 219 619 265 HOH HOH A . F 6 HOH 220 620 199 HOH HOH A . F 6 HOH 221 621 225 HOH HOH A . F 6 HOH 222 622 403 HOH HOH A . F 6 HOH 223 623 207 HOH HOH A . F 6 HOH 224 624 41 HOH HOH A . F 6 HOH 225 625 108 HOH HOH A . F 6 HOH 226 626 215 HOH HOH A . F 6 HOH 227 627 129 HOH HOH A . F 6 HOH 228 628 386 HOH HOH A . F 6 HOH 229 629 332 HOH HOH A . F 6 HOH 230 630 174 HOH HOH A . F 6 HOH 231 631 346 HOH HOH A . F 6 HOH 232 632 98 HOH HOH A . F 6 HOH 233 633 388 HOH HOH A . F 6 HOH 234 634 363 HOH HOH A . F 6 HOH 235 635 143 HOH HOH A . F 6 HOH 236 636 117 HOH HOH A . F 6 HOH 237 637 131 HOH HOH A . F 6 HOH 238 638 275 HOH HOH A . F 6 HOH 239 639 198 HOH HOH A . F 6 HOH 240 640 278 HOH HOH A . F 6 HOH 241 641 319 HOH HOH A . F 6 HOH 242 642 343 HOH HOH A . F 6 HOH 243 643 324 HOH HOH A . F 6 HOH 244 644 356 HOH HOH A . F 6 HOH 245 645 43 HOH HOH A . F 6 HOH 246 646 228 HOH HOH A . F 6 HOH 247 647 75 HOH HOH A . F 6 HOH 248 648 394 HOH HOH A . F 6 HOH 249 649 323 HOH HOH A . F 6 HOH 250 650 347 HOH HOH A . F 6 HOH 251 651 289 HOH HOH A . F 6 HOH 252 652 247 HOH HOH A . F 6 HOH 253 653 295 HOH HOH A . F 6 HOH 254 654 145 HOH HOH A . F 6 HOH 255 655 165 HOH HOH A . F 6 HOH 256 656 291 HOH HOH A . F 6 HOH 257 657 137 HOH HOH A . F 6 HOH 258 658 212 HOH HOH A . F 6 HOH 259 659 315 HOH HOH A . F 6 HOH 260 660 122 HOH HOH A . F 6 HOH 261 661 389 HOH HOH A . F 6 HOH 262 662 318 HOH HOH A . F 6 HOH 263 663 296 HOH HOH A . F 6 HOH 264 664 227 HOH HOH A . F 6 HOH 265 665 224 HOH HOH A . F 6 HOH 266 666 246 HOH HOH A . F 6 HOH 267 667 180 HOH HOH A . F 6 HOH 268 668 375 HOH HOH A . F 6 HOH 269 669 358 HOH HOH A . F 6 HOH 270 670 314 HOH HOH A . F 6 HOH 271 671 211 HOH HOH A . F 6 HOH 272 672 337 HOH HOH A . F 6 HOH 273 673 264 HOH HOH A . F 6 HOH 274 674 330 HOH HOH A . F 6 HOH 275 675 222 HOH HOH A . F 6 HOH 276 676 214 HOH HOH A . F 6 HOH 277 677 312 HOH HOH A . F 6 HOH 278 678 326 HOH HOH A . F 6 HOH 279 679 252 HOH HOH A . F 6 HOH 280 680 141 HOH HOH A . F 6 HOH 281 681 277 HOH HOH A . F 6 HOH 282 682 304 HOH HOH A . F 6 HOH 283 683 288 HOH HOH A . F 6 HOH 284 684 148 HOH HOH A . F 6 HOH 285 685 31 HOH HOH A . F 6 HOH 286 686 107 HOH HOH A . F 6 HOH 287 687 195 HOH HOH A . F 6 HOH 288 688 119 HOH HOH A . F 6 HOH 289 689 51 HOH HOH A . F 6 HOH 290 690 37 HOH HOH A . F 6 HOH 291 691 134 HOH HOH A . F 6 HOH 292 692 67 HOH HOH A . F 6 HOH 293 693 125 HOH HOH A . F 6 HOH 294 694 120 HOH HOH A . F 6 HOH 295 695 102 HOH HOH A . F 6 HOH 296 696 293 HOH HOH A . F 6 HOH 297 697 401 HOH HOH A . F 6 HOH 298 698 334 HOH HOH A . F 6 HOH 299 699 253 HOH HOH A . F 6 HOH 300 700 96 HOH HOH A . F 6 HOH 301 701 353 HOH HOH A . F 6 HOH 302 702 232 HOH HOH A . F 6 HOH 303 703 115 HOH HOH A . F 6 HOH 304 704 133 HOH HOH A . F 6 HOH 305 705 105 HOH HOH A . F 6 HOH 306 706 97 HOH HOH A . F 6 HOH 307 707 164 HOH HOH A . F 6 HOH 308 708 196 HOH HOH A . F 6 HOH 309 709 242 HOH HOH A . F 6 HOH 310 710 307 HOH HOH A . F 6 HOH 311 711 161 HOH HOH A . F 6 HOH 312 712 36 HOH HOH A . F 6 HOH 313 713 322 HOH HOH A . F 6 HOH 314 714 331 HOH HOH A . F 6 HOH 315 715 192 HOH HOH A . F 6 HOH 316 716 357 HOH HOH A . F 6 HOH 317 717 257 HOH HOH A . F 6 HOH 318 718 248 HOH HOH A . F 6 HOH 319 719 301 HOH HOH A . F 6 HOH 320 720 374 HOH HOH A . F 6 HOH 321 721 136 HOH HOH A . F 6 HOH 322 722 286 HOH HOH A . F 6 HOH 323 723 283 HOH HOH A . F 6 HOH 324 724 219 HOH HOH A . F 6 HOH 325 725 74 HOH HOH A . F 6 HOH 326 726 287 HOH HOH A . F 6 HOH 327 727 305 HOH HOH A . F 6 HOH 328 728 377 HOH HOH A . F 6 HOH 329 729 70 HOH HOH A . F 6 HOH 330 730 262 HOH HOH A . F 6 HOH 331 731 208 HOH HOH A . F 6 HOH 332 732 189 HOH HOH A . F 6 HOH 333 733 367 HOH HOH A . G 6 HOH 1 201 260 HOH HOH P . G 6 HOH 2 202 415 HOH HOH P . G 6 HOH 3 203 85 HOH HOH P . G 6 HOH 4 204 154 HOH HOH P . G 6 HOH 5 205 183 HOH HOH P . G 6 HOH 6 206 69 HOH HOH P . G 6 HOH 7 207 348 HOH HOH P . G 6 HOH 8 208 213 HOH HOH P . G 6 HOH 9 209 11 HOH HOH P . G 6 HOH 10 210 149 HOH HOH P . G 6 HOH 11 211 279 HOH HOH P . G 6 HOH 12 212 236 HOH HOH P . G 6 HOH 13 213 412 HOH HOH P . G 6 HOH 14 214 209 HOH HOH P . G 6 HOH 15 215 284 HOH HOH P . G 6 HOH 16 216 309 HOH HOH P . G 6 HOH 17 217 226 HOH HOH P . G 6 HOH 18 218 150 HOH HOH P . G 6 HOH 19 219 333 HOH HOH P . G 6 HOH 20 220 106 HOH HOH P . G 6 HOH 21 221 173 HOH HOH P . G 6 HOH 22 222 282 HOH HOH P . G 6 HOH 23 223 311 HOH HOH P . G 6 HOH 24 224 259 HOH HOH P . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 67 ? CG ? A GLN 72 CG 2 1 Y 1 A GLN 67 ? CD ? A GLN 72 CD 3 1 Y 1 A GLN 67 ? OE1 ? A GLN 72 OE1 4 1 Y 1 A GLN 67 ? NE2 ? A GLN 72 NE2 5 1 Y 1 A LYS 68 ? CD ? A LYS 73 CD 6 1 Y 1 A LYS 68 ? CE ? A LYS 73 CE 7 1 Y 1 A LYS 68 ? NZ ? A LYS 73 NZ 8 1 Y 1 A SER 74 ? OG ? A SER 79 OG 9 1 Y 1 A GLU 76 ? CG ? A GLU 81 CG 10 1 Y 1 A GLU 76 ? CD ? A GLU 81 CD 11 1 Y 1 A GLU 76 ? OE1 ? A GLU 81 OE1 12 1 Y 1 A GLU 76 ? OE2 ? A GLU 81 OE2 13 1 Y 1 A LYS 140 ? CD ? A LYS 145 CD 14 1 Y 1 A LYS 140 ? CE ? A LYS 145 CE 15 1 Y 1 A LYS 140 ? NZ ? A LYS 145 NZ 16 1 Y 1 A LYS 160 ? CE ? A LYS 165 CE 17 1 Y 1 A LYS 160 ? NZ ? A LYS 165 NZ 18 1 Y 1 A LYS 214 ? CD ? A LYS 219 CD 19 1 Y 1 A LYS 214 ? CE ? A LYS 219 CE 20 1 Y 1 A LYS 214 ? NZ ? A LYS 219 NZ 21 1 Y 1 A LEU 229 ? CG ? A LEU 234 CG 22 1 Y 1 A LEU 229 ? CD1 ? A LEU 234 CD1 23 1 Y 1 A LEU 229 ? CD2 ? A LEU 234 CD2 24 1 Y 1 P GLN 180 ? CG ? B GLN 12 CG 25 1 Y 1 P GLN 180 ? CD ? B GLN 12 CD 26 1 Y 1 P GLN 180 ? OE1 ? B GLN 12 OE1 27 1 Y 1 P GLN 180 ? NE2 ? B GLN 12 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7NND _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.835 _cell.length_a_esd ? _cell.length_b 111.600 _cell.length_b_esd ? _cell.length_c 62.702 _cell.length_c_esd ? _cell.volume 572641.481 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7NND _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NND _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.43 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.095 M Hepes pH 7.5, 26% PEG 400, 0.19 M CaCl2 and 5% Glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-03-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91587 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91587 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 13.38 _reflns.entry_id 7NND _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.40 _reflns.d_resolution_low 62.72 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 55890 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.0 _reflns.pdbx_Rmerge_I_obs 0.036 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.40 _reflns_shell.d_res_low 1.44 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4058 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.230 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.915 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 19.60 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7NND _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.40 _refine.ls_d_res_low 45.46 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 55890 _refine.ls_number_reflns_R_free 2776 _refine.ls_number_reflns_R_work 53114 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.36 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1539 _refine.ls_R_factor_R_free 0.1723 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1529 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4JC3 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.0430 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0952 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.40 _refine_hist.d_res_low 45.46 _refine_hist.number_atoms_solvent 357 _refine_hist.number_atoms_total 2257 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1876 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0081 ? 1997 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0129 ? 2699 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0610 ? 296 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0062 ? 353 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.7886 ? 763 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.40 1.42 . . 148 2521 94.95 . . . 0.2004 . 0.1968 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.42 1.45 . . 138 2605 97.72 . . . 0.1795 . 0.1806 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.45 1.48 . . 115 2633 97.62 . . . 0.1797 . 0.1692 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.48 1.51 . . 122 2645 97.98 . . . 0.1998 . 0.1605 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.51 1.54 . . 139 2584 97.81 . . . 0.1925 . 0.1683 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.54 1.58 . . 144 2588 96.85 . . . 0.1947 . 0.1600 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.58 1.62 . . 135 2629 98.01 . . . 0.1707 . 0.1558 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.62 1.66 . . 139 2612 98.36 . . . 0.1850 . 0.1547 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.66 1.71 . . 146 2648 98.35 . . . 0.1766 . 0.1534 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.71 1.76 . . 132 2646 98.76 . . . 0.1847 . 0.1589 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.76 1.83 . . 153 2648 98.98 . . . 0.1776 . 0.1543 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.83 1.90 . . 127 2632 97.53 . . . 0.1658 . 0.1580 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.90 1.99 . . 140 2674 99.40 . . . 0.1750 . 0.1511 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.99 2.09 . . 127 2678 98.94 . . . 0.1502 . 0.1480 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.09 2.22 . . 124 2716 99.61 . . . 0.1915 . 0.1447 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.22 2.39 . . 147 2690 99.44 . . . 0.1592 . 0.1352 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.39 2.63 . . 147 2672 98.81 . . . 0.1605 . 0.1420 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.63 3.02 . . 169 2714 99.97 . . . 0.1591 . 0.1526 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.02 3.80 . . 151 2724 99.55 . . . 0.1692 . 0.1448 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.80 45.46 . . 133 2855 98.58 . . . 0.1802 . 0.1641 . . . . . . . . . . . # _struct.entry_id 7NND _struct.title 'Crystal structure of 14-3-3 sigma in complex with 13mer Amot-p130 peptide and fragment 09' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NND _struct_keywords.text 'protein-peptide complex fragment soaking, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP 1433S_HUMAN P31947 ? 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG EAPQEPQS ; 1 2 UNP AMOT_HUMAN Q4VCS5 ? 2 GHVRSLSERLMQM 169 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7NND A 6 ? 253 ? P31947 1 ? 248 ? 1 248 2 2 7NND P 1 ? 13 ? Q4VCS5 169 ? 181 ? 169 181 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7NND GLY A 1 ? UNP P31947 ? ? 'expression tag' -4 1 1 7NND ALA A 2 ? UNP P31947 ? ? 'expression tag' -3 2 1 7NND MET A 3 ? UNP P31947 ? ? 'expression tag' -2 3 1 7NND GLY A 4 ? UNP P31947 ? ? 'expression tag' -1 4 1 7NND SER A 5 ? UNP P31947 ? ? 'expression tag' 0 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5110 ? 1 MORE -54 ? 1 'SSA (A^2)' 23200 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ALA A 21 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 AA2 ARG A 23 ? GLU A 36 ? ARG A 18 GLU A 31 1 ? 14 HELX_P HELX_P3 AA3 SER A 42 ? ASN A 75 ? SER A 37 ASN A 70 1 ? 34 HELX_P HELX_P4 AA4 PRO A 84 ? SER A 110 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 AA5 HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6 HELX_P HELX_P6 AA6 ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P7 AA7 LYS A 145 ? MET A 167 ? LYS A 140 MET A 162 1 ? 23 HELX_P HELX_P8 AA8 ASN A 171 ? ILE A 188 ? ASN A 166 ILE A 183 1 ? 18 HELX_P HELX_P9 AA9 SER A 191 ? ALA A 208 ? SER A 186 ALA A 203 1 ? 18 HELX_P HELX_P10 AB1 ASP A 209 ? LEU A 213 ? ASP A 204 LEU A 208 5 ? 5 HELX_P HELX_P11 AB2 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 42 C ? ? ? 1_555 A CSO 43 N A ? A SER 37 A CSO 38 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A SER 42 C ? ? ? 1_555 A CSO 43 N B ? A SER 37 A CSO 38 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale3 covale both ? A CSO 43 C A ? ? 1_555 A GLU 44 N ? ? A CSO 38 A GLU 39 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A CSO 43 C B ? ? 1_555 A GLU 44 N ? ? A CSO 38 A GLU 39 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale5 covale both ? B LEU 6 C ? ? ? 1_555 B SEP 7 N ? ? P LEU 174 P SEP 175 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale6 covale both ? B SEP 7 C ? ? ? 1_555 B GLU 8 N ? ? P SEP 175 P GLU 176 1_555 ? ? ? ? ? ? ? 1.331 ? ? metalc1 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 2 A MG 302 1_555 ? ? ? ? ? ? ? 2.460 ? ? metalc2 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 2 A MG 302 3_454 ? ? ? ? ? ? ? 2.460 ? ? metalc3 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 427 1_555 ? ? ? ? ? ? ? 2.571 ? ? metalc4 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 427 3_454 ? ? ? ? ? ? ? 2.570 ? ? metalc5 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 643 1_555 ? ? ? ? ? ? ? 2.466 ? ? metalc6 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 643 3_454 ? ? ? ? ? ? ? 2.465 ? ? metalc7 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 649 1_555 ? ? ? ? ? ? ? 2.637 ? ? metalc8 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 649 3_454 ? ? ? ? ? ? ? 2.637 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 0.0 ? 2 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 427 ? 1_555 76.3 ? 3 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 427 ? 1_555 76.3 ? 4 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 427 ? 3_454 80.8 ? 5 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 427 ? 3_454 80.8 ? 6 O ? F HOH . ? A HOH 427 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 427 ? 3_454 148.2 ? 7 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 1_555 82.8 ? 8 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 1_555 82.8 ? 9 O ? F HOH . ? A HOH 427 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 1_555 129.6 ? 10 O ? F HOH . ? A HOH 427 ? 3_454 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 1_555 67.6 ? 11 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 3_454 143.6 ? 12 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 3_454 143.6 ? 13 O ? F HOH . ? A HOH 427 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 3_454 67.6 ? 14 O ? F HOH . ? A HOH 427 ? 3_454 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 3_454 129.6 ? 15 O ? F HOH . ? A HOH 643 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 643 ? 3_454 124.1 ? 16 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 1_555 81.2 ? 17 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 1_555 81.2 ? 18 O ? F HOH . ? A HOH 427 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 1_555 83.3 ? 19 O ? F HOH . ? A HOH 427 ? 3_454 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 1_555 114.7 ? 20 O ? F HOH . ? A HOH 643 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 1_555 48.2 ? 21 O ? F HOH . ? A HOH 643 ? 3_454 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 1_555 98.6 ? 22 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 3_454 162.1 ? 23 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 3_454 162.1 ? 24 O ? F HOH . ? A HOH 427 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 3_454 114.7 ? 25 O ? F HOH . ? A HOH 427 ? 3_454 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 3_454 83.3 ? 26 O ? F HOH . ? A HOH 643 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 3_454 98.6 ? 27 O ? F HOH . ? A HOH 643 ? 3_454 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 3_454 48.2 ? 28 O ? F HOH . ? A HOH 649 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 649 ? 3_454 113.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.46 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG A SER 0 ? ? O A HOH 406 ? ? 1.58 2 1 O A HOH 406 ? ? O A HOH 625 ? ? 1.95 3 1 O A HOH 610 ? ? O A HOH 623 ? ? 1.96 4 1 N A ASP 139 ? ? O A HOH 401 ? ? 1.97 5 1 O A HOH 581 ? ? O A HOH 594 ? ? 2.04 6 1 O A GLU 76 ? ? N A GLY 78 ? ? 2.07 7 1 O A HOH 643 ? ? O A HOH 649 ? ? 2.09 8 1 O A HOH 504 ? ? O A HOH 701 ? ? 2.09 9 1 O A HOH 402 ? ? O A HOH 591 ? ? 2.09 10 1 O A HOH 408 ? ? O A HOH 460 ? ? 2.12 11 1 O A HOH 401 ? ? O A HOH 482 ? ? 2.13 12 1 O A HOH 401 ? ? O A HOH 618 ? ? 2.14 13 1 O A GLU 161 ? ? O A HOH 402 ? ? 2.15 14 1 O A HOH 408 ? ? O A HOH 445 ? ? 2.16 15 1 O A HOH 592 ? ? O A HOH 674 ? ? 2.16 16 1 O A HOH 637 ? ? O A HOH 714 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 733 ? ? 1_555 O A HOH 733 ? ? 3_455 1.83 2 1 O A HOH 495 ? ? 1_555 O A HOH 661 ? ? 4_555 1.95 3 1 O A HOH 665 ? ? 1_555 O A HOH 687 ? ? 6_445 2.01 4 1 O A HOH 623 ? ? 1_555 O A HOH 623 ? ? 3_454 2.06 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -109.39 76.08 2 1 HIS A 106 ? ? -144.86 38.94 3 1 SER A 186 ? ? -118.55 64.57 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CSO 43 A CSO 38 ? CYS 'modified residue' 2 B SEP 7 P SEP 175 ? SER 'modified residue' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id MG _pdbx_struct_special_symmetry.auth_seq_id 302 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id MG _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # _pdbx_entry_details.entry_id 7NND _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 72 ? A GLU 77 2 1 Y 1 A GLY 73 ? A GLY 78 3 1 Y 1 A LYS 77 ? A LYS 82 4 1 Y 1 A GLY 137 ? A GLY 142 5 1 Y 1 A ASP 138 ? A ASP 143 6 1 Y 1 A ALA 232 ? A ALA 237 7 1 Y 1 A ASP 233 ? A ASP 238 8 1 Y 1 A ASN 234 ? A ASN 239 9 1 Y 1 A ALA 235 ? A ALA 240 10 1 Y 1 A GLY 236 ? A GLY 241 11 1 Y 1 A GLU 237 ? A GLU 242 12 1 Y 1 A GLU 238 ? A GLU 243 13 1 Y 1 A GLY 239 ? A GLY 244 14 1 Y 1 A GLY 240 ? A GLY 245 15 1 Y 1 A GLU 241 ? A GLU 246 16 1 Y 1 A ALA 242 ? A ALA 247 17 1 Y 1 A PRO 243 ? A PRO 248 18 1 Y 1 A GLN 244 ? A GLN 249 19 1 Y 1 A GLU 245 ? A GLU 250 20 1 Y 1 A PRO 246 ? A PRO 251 21 1 Y 1 A GLN 247 ? A GLN 252 22 1 Y 1 A SER 248 ? A SER 253 23 1 Y 1 P GLY 169 ? B GLY 1 24 1 Y 1 P HIS 170 ? B HIS 2 25 1 Y 1 P VAL 171 ? B VAL 3 26 1 Y 1 P MET 181 ? B MET 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CSO N N N N 75 CSO CA C N R 76 CSO CB C N N 77 CSO SG S N N 78 CSO C C N N 79 CSO O O N N 80 CSO OXT O N N 81 CSO OD O N N 82 CSO H H N N 83 CSO H2 H N N 84 CSO HA H N N 85 CSO HB2 H N N 86 CSO HB3 H N N 87 CSO HXT H N N 88 CSO HD H N N 89 CYS N N N N 90 CYS CA C N R 91 CYS C C N N 92 CYS O O N N 93 CYS CB C N N 94 CYS SG S N N 95 CYS OXT O N N 96 CYS H H N N 97 CYS H2 H N N 98 CYS HA H N N 99 CYS HB2 H N N 100 CYS HB3 H N N 101 CYS HG H N N 102 CYS HXT H N N 103 GLN N N N N 104 GLN CA C N S 105 GLN C C N N 106 GLN O O N N 107 GLN CB C N N 108 GLN CG C N N 109 GLN CD C N N 110 GLN OE1 O N N 111 GLN NE2 N N N 112 GLN OXT O N N 113 GLN H H N N 114 GLN H2 H N N 115 GLN HA H N N 116 GLN HB2 H N N 117 GLN HB3 H N N 118 GLN HG2 H N N 119 GLN HG3 H N N 120 GLN HE21 H N N 121 GLN HE22 H N N 122 GLN HXT H N N 123 GLU N N N N 124 GLU CA C N S 125 GLU C C N N 126 GLU O O N N 127 GLU CB C N N 128 GLU CG C N N 129 GLU CD C N N 130 GLU OE1 O N N 131 GLU OE2 O N N 132 GLU OXT O N N 133 GLU H H N N 134 GLU H2 H N N 135 GLU HA H N N 136 GLU HB2 H N N 137 GLU HB3 H N N 138 GLU HG2 H N N 139 GLU HG3 H N N 140 GLU HE2 H N N 141 GLU HXT H N N 142 GLY N N N N 143 GLY CA C N N 144 GLY C C N N 145 GLY O O N N 146 GLY OXT O N N 147 GLY H H N N 148 GLY H2 H N N 149 GLY HA2 H N N 150 GLY HA3 H N N 151 GLY HXT H N N 152 HIS N N N N 153 HIS CA C N S 154 HIS C C N N 155 HIS O O N N 156 HIS CB C N N 157 HIS CG C Y N 158 HIS ND1 N Y N 159 HIS CD2 C Y N 160 HIS CE1 C Y N 161 HIS NE2 N Y N 162 HIS OXT O N N 163 HIS H H N N 164 HIS H2 H N N 165 HIS HA H N N 166 HIS HB2 H N N 167 HIS HB3 H N N 168 HIS HD1 H N N 169 HIS HD2 H N N 170 HIS HE1 H N N 171 HIS HE2 H N N 172 HIS HXT H N N 173 HOH O O N N 174 HOH H1 H N N 175 HOH H2 H N N 176 ILE N N N N 177 ILE CA C N S 178 ILE C C N N 179 ILE O O N N 180 ILE CB C N S 181 ILE CG1 C N N 182 ILE CG2 C N N 183 ILE CD1 C N N 184 ILE OXT O N N 185 ILE H H N N 186 ILE H2 H N N 187 ILE HA H N N 188 ILE HB H N N 189 ILE HG12 H N N 190 ILE HG13 H N N 191 ILE HG21 H N N 192 ILE HG22 H N N 193 ILE HG23 H N N 194 ILE HD11 H N N 195 ILE HD12 H N N 196 ILE HD13 H N N 197 ILE HXT H N N 198 K7N C13 C Y N 199 K7N C15 C Y N 200 K7N C17 C N N 201 K7N C20 C N N 202 K7N C01 C Y N 203 K7N C02 C Y N 204 K7N C03 C Y N 205 K7N C04 C Y N 206 K7N C05 C Y N 207 K7N C06 C Y N 208 K7N C07 C Y N 209 K7N C08 C Y N 210 K7N C09 C Y N 211 K7N C11 C Y N 212 K7N C12 C Y N 213 K7N C18 C N N 214 K7N N14 N Y N 215 K7N N16 N Y N 216 K7N N19 N N N 217 K7N N21 N N N 218 K7N N22 N N N 219 K7N S10 S Y N 220 K7N H131 H N N 221 K7N H151 H N N 222 K7N H171 H N N 223 K7N H172 H N N 224 K7N H011 H N N 225 K7N H021 H N N 226 K7N H031 H N N 227 K7N H051 H N N 228 K7N H061 H N N 229 K7N H081 H N N 230 K7N H181 H N N 231 K7N H182 H N N 232 K7N H191 H N N 233 K7N H192 H N N 234 K7N H211 H N N 235 K7N H222 H N N 236 K7N H221 H N N 237 LEU N N N N 238 LEU CA C N S 239 LEU C C N N 240 LEU O O N N 241 LEU CB C N N 242 LEU CG C N N 243 LEU CD1 C N N 244 LEU CD2 C N N 245 LEU OXT O N N 246 LEU H H N N 247 LEU H2 H N N 248 LEU HA H N N 249 LEU HB2 H N N 250 LEU HB3 H N N 251 LEU HG H N N 252 LEU HD11 H N N 253 LEU HD12 H N N 254 LEU HD13 H N N 255 LEU HD21 H N N 256 LEU HD22 H N N 257 LEU HD23 H N N 258 LEU HXT H N N 259 LYS N N N N 260 LYS CA C N S 261 LYS C C N N 262 LYS O O N N 263 LYS CB C N N 264 LYS CG C N N 265 LYS CD C N N 266 LYS CE C N N 267 LYS NZ N N N 268 LYS OXT O N N 269 LYS H H N N 270 LYS H2 H N N 271 LYS HA H N N 272 LYS HB2 H N N 273 LYS HB3 H N N 274 LYS HG2 H N N 275 LYS HG3 H N N 276 LYS HD2 H N N 277 LYS HD3 H N N 278 LYS HE2 H N N 279 LYS HE3 H N N 280 LYS HZ1 H N N 281 LYS HZ2 H N N 282 LYS HZ3 H N N 283 LYS HXT H N N 284 MET N N N N 285 MET CA C N S 286 MET C C N N 287 MET O O N N 288 MET CB C N N 289 MET CG C N N 290 MET SD S N N 291 MET CE C N N 292 MET OXT O N N 293 MET H H N N 294 MET H2 H N N 295 MET HA H N N 296 MET HB2 H N N 297 MET HB3 H N N 298 MET HG2 H N N 299 MET HG3 H N N 300 MET HE1 H N N 301 MET HE2 H N N 302 MET HE3 H N N 303 MET HXT H N N 304 MG MG MG N N 305 PHE N N N N 306 PHE CA C N S 307 PHE C C N N 308 PHE O O N N 309 PHE CB C N N 310 PHE CG C Y N 311 PHE CD1 C Y N 312 PHE CD2 C Y N 313 PHE CE1 C Y N 314 PHE CE2 C Y N 315 PHE CZ C Y N 316 PHE OXT O N N 317 PHE H H N N 318 PHE H2 H N N 319 PHE HA H N N 320 PHE HB2 H N N 321 PHE HB3 H N N 322 PHE HD1 H N N 323 PHE HD2 H N N 324 PHE HE1 H N N 325 PHE HE2 H N N 326 PHE HZ H N N 327 PHE HXT H N N 328 PRO N N N N 329 PRO CA C N S 330 PRO C C N N 331 PRO O O N N 332 PRO CB C N N 333 PRO CG C N N 334 PRO CD C N N 335 PRO OXT O N N 336 PRO H H N N 337 PRO HA H N N 338 PRO HB2 H N N 339 PRO HB3 H N N 340 PRO HG2 H N N 341 PRO HG3 H N N 342 PRO HD2 H N N 343 PRO HD3 H N N 344 PRO HXT H N N 345 SEP N N N N 346 SEP CA C N S 347 SEP CB C N N 348 SEP OG O N N 349 SEP C C N N 350 SEP O O N N 351 SEP OXT O N N 352 SEP P P N N 353 SEP O1P O N N 354 SEP O2P O N N 355 SEP O3P O N N 356 SEP H H N N 357 SEP H2 H N N 358 SEP HA H N N 359 SEP HB2 H N N 360 SEP HB3 H N N 361 SEP HXT H N N 362 SEP HOP2 H N N 363 SEP HOP3 H N N 364 SER N N N N 365 SER CA C N S 366 SER C C N N 367 SER O O N N 368 SER CB C N N 369 SER OG O N N 370 SER OXT O N N 371 SER H H N N 372 SER H2 H N N 373 SER HA H N N 374 SER HB2 H N N 375 SER HB3 H N N 376 SER HG H N N 377 SER HXT H N N 378 THR N N N N 379 THR CA C N S 380 THR C C N N 381 THR O O N N 382 THR CB C N R 383 THR OG1 O N N 384 THR CG2 C N N 385 THR OXT O N N 386 THR H H N N 387 THR H2 H N N 388 THR HA H N N 389 THR HB H N N 390 THR HG1 H N N 391 THR HG21 H N N 392 THR HG22 H N N 393 THR HG23 H N N 394 THR HXT H N N 395 TRP N N N N 396 TRP CA C N S 397 TRP C C N N 398 TRP O O N N 399 TRP CB C N N 400 TRP CG C Y N 401 TRP CD1 C Y N 402 TRP CD2 C Y N 403 TRP NE1 N Y N 404 TRP CE2 C Y N 405 TRP CE3 C Y N 406 TRP CZ2 C Y N 407 TRP CZ3 C Y N 408 TRP CH2 C Y N 409 TRP OXT O N N 410 TRP H H N N 411 TRP H2 H N N 412 TRP HA H N N 413 TRP HB2 H N N 414 TRP HB3 H N N 415 TRP HD1 H N N 416 TRP HE1 H N N 417 TRP HE3 H N N 418 TRP HZ2 H N N 419 TRP HZ3 H N N 420 TRP HH2 H N N 421 TRP HXT H N N 422 TYR N N N N 423 TYR CA C N S 424 TYR C C N N 425 TYR O O N N 426 TYR CB C N N 427 TYR CG C Y N 428 TYR CD1 C Y N 429 TYR CD2 C Y N 430 TYR CE1 C Y N 431 TYR CE2 C Y N 432 TYR CZ C Y N 433 TYR OH O N N 434 TYR OXT O N N 435 TYR H H N N 436 TYR H2 H N N 437 TYR HA H N N 438 TYR HB2 H N N 439 TYR HB3 H N N 440 TYR HD1 H N N 441 TYR HD2 H N N 442 TYR HE1 H N N 443 TYR HE2 H N N 444 TYR HH H N N 445 TYR HXT H N N 446 VAL N N N N 447 VAL CA C N S 448 VAL C C N N 449 VAL O O N N 450 VAL CB C N N 451 VAL CG1 C N N 452 VAL CG2 C N N 453 VAL OXT O N N 454 VAL H H N N 455 VAL H2 H N N 456 VAL HA H N N 457 VAL HB H N N 458 VAL HG11 H N N 459 VAL HG12 H N N 460 VAL HG13 H N N 461 VAL HG21 H N N 462 VAL HG22 H N N 463 VAL HG23 H N N 464 VAL HXT H N N 465 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 CYS N CA sing N N 84 CYS N H sing N N 85 CYS N H2 sing N N 86 CYS CA C sing N N 87 CYS CA CB sing N N 88 CYS CA HA sing N N 89 CYS C O doub N N 90 CYS C OXT sing N N 91 CYS CB SG sing N N 92 CYS CB HB2 sing N N 93 CYS CB HB3 sing N N 94 CYS SG HG sing N N 95 CYS OXT HXT sing N N 96 GLN N CA sing N N 97 GLN N H sing N N 98 GLN N H2 sing N N 99 GLN CA C sing N N 100 GLN CA CB sing N N 101 GLN CA HA sing N N 102 GLN C O doub N N 103 GLN C OXT sing N N 104 GLN CB CG sing N N 105 GLN CB HB2 sing N N 106 GLN CB HB3 sing N N 107 GLN CG CD sing N N 108 GLN CG HG2 sing N N 109 GLN CG HG3 sing N N 110 GLN CD OE1 doub N N 111 GLN CD NE2 sing N N 112 GLN NE2 HE21 sing N N 113 GLN NE2 HE22 sing N N 114 GLN OXT HXT sing N N 115 GLU N CA sing N N 116 GLU N H sing N N 117 GLU N H2 sing N N 118 GLU CA C sing N N 119 GLU CA CB sing N N 120 GLU CA HA sing N N 121 GLU C O doub N N 122 GLU C OXT sing N N 123 GLU CB CG sing N N 124 GLU CB HB2 sing N N 125 GLU CB HB3 sing N N 126 GLU CG CD sing N N 127 GLU CG HG2 sing N N 128 GLU CG HG3 sing N N 129 GLU CD OE1 doub N N 130 GLU CD OE2 sing N N 131 GLU OE2 HE2 sing N N 132 GLU OXT HXT sing N N 133 GLY N CA sing N N 134 GLY N H sing N N 135 GLY N H2 sing N N 136 GLY CA C sing N N 137 GLY CA HA2 sing N N 138 GLY CA HA3 sing N N 139 GLY C O doub N N 140 GLY C OXT sing N N 141 GLY OXT HXT sing N N 142 HIS N CA sing N N 143 HIS N H sing N N 144 HIS N H2 sing N N 145 HIS CA C sing N N 146 HIS CA CB sing N N 147 HIS CA HA sing N N 148 HIS C O doub N N 149 HIS C OXT sing N N 150 HIS CB CG sing N N 151 HIS CB HB2 sing N N 152 HIS CB HB3 sing N N 153 HIS CG ND1 sing Y N 154 HIS CG CD2 doub Y N 155 HIS ND1 CE1 doub Y N 156 HIS ND1 HD1 sing N N 157 HIS CD2 NE2 sing Y N 158 HIS CD2 HD2 sing N N 159 HIS CE1 NE2 sing Y N 160 HIS CE1 HE1 sing N N 161 HIS NE2 HE2 sing N N 162 HIS OXT HXT sing N N 163 HOH O H1 sing N N 164 HOH O H2 sing N N 165 ILE N CA sing N N 166 ILE N H sing N N 167 ILE N H2 sing N N 168 ILE CA C sing N N 169 ILE CA CB sing N N 170 ILE CA HA sing N N 171 ILE C O doub N N 172 ILE C OXT sing N N 173 ILE CB CG1 sing N N 174 ILE CB CG2 sing N N 175 ILE CB HB sing N N 176 ILE CG1 CD1 sing N N 177 ILE CG1 HG12 sing N N 178 ILE CG1 HG13 sing N N 179 ILE CG2 HG21 sing N N 180 ILE CG2 HG22 sing N N 181 ILE CG2 HG23 sing N N 182 ILE CD1 HD11 sing N N 183 ILE CD1 HD12 sing N N 184 ILE CD1 HD13 sing N N 185 ILE OXT HXT sing N N 186 K7N N19 C18 sing N N 187 K7N C15 N16 doub Y N 188 K7N C15 N14 sing Y N 189 K7N C17 N14 sing N N 190 K7N C17 C18 sing N N 191 K7N N16 C12 sing Y N 192 K7N N14 C13 sing Y N 193 K7N C12 C13 doub Y N 194 K7N C12 C11 sing N N 195 K7N S10 C11 sing Y N 196 K7N S10 C09 sing Y N 197 K7N N22 C20 sing N N 198 K7N C11 C07 doub Y N 199 K7N C09 C20 sing N N 200 K7N C09 C08 doub Y N 201 K7N C20 N21 doub N N 202 K7N C07 C08 sing Y N 203 K7N C07 C04 sing N N 204 K7N C05 C04 doub Y N 205 K7N C05 C06 sing Y N 206 K7N C04 C03 sing Y N 207 K7N C06 C01 doub Y N 208 K7N C03 C02 doub Y N 209 K7N C01 C02 sing Y N 210 K7N C13 H131 sing N N 211 K7N C15 H151 sing N N 212 K7N C17 H171 sing N N 213 K7N C17 H172 sing N N 214 K7N C01 H011 sing N N 215 K7N C02 H021 sing N N 216 K7N C03 H031 sing N N 217 K7N C05 H051 sing N N 218 K7N C06 H061 sing N N 219 K7N C08 H081 sing N N 220 K7N C18 H181 sing N N 221 K7N C18 H182 sing N N 222 K7N N19 H191 sing N N 223 K7N N19 H192 sing N N 224 K7N N21 H211 sing N N 225 K7N N22 H222 sing N N 226 K7N N22 H221 sing N N 227 LEU N CA sing N N 228 LEU N H sing N N 229 LEU N H2 sing N N 230 LEU CA C sing N N 231 LEU CA CB sing N N 232 LEU CA HA sing N N 233 LEU C O doub N N 234 LEU C OXT sing N N 235 LEU CB CG sing N N 236 LEU CB HB2 sing N N 237 LEU CB HB3 sing N N 238 LEU CG CD1 sing N N 239 LEU CG CD2 sing N N 240 LEU CG HG sing N N 241 LEU CD1 HD11 sing N N 242 LEU CD1 HD12 sing N N 243 LEU CD1 HD13 sing N N 244 LEU CD2 HD21 sing N N 245 LEU CD2 HD22 sing N N 246 LEU CD2 HD23 sing N N 247 LEU OXT HXT sing N N 248 LYS N CA sing N N 249 LYS N H sing N N 250 LYS N H2 sing N N 251 LYS CA C sing N N 252 LYS CA CB sing N N 253 LYS CA HA sing N N 254 LYS C O doub N N 255 LYS C OXT sing N N 256 LYS CB CG sing N N 257 LYS CB HB2 sing N N 258 LYS CB HB3 sing N N 259 LYS CG CD sing N N 260 LYS CG HG2 sing N N 261 LYS CG HG3 sing N N 262 LYS CD CE sing N N 263 LYS CD HD2 sing N N 264 LYS CD HD3 sing N N 265 LYS CE NZ sing N N 266 LYS CE HE2 sing N N 267 LYS CE HE3 sing N N 268 LYS NZ HZ1 sing N N 269 LYS NZ HZ2 sing N N 270 LYS NZ HZ3 sing N N 271 LYS OXT HXT sing N N 272 MET N CA sing N N 273 MET N H sing N N 274 MET N H2 sing N N 275 MET CA C sing N N 276 MET CA CB sing N N 277 MET CA HA sing N N 278 MET C O doub N N 279 MET C OXT sing N N 280 MET CB CG sing N N 281 MET CB HB2 sing N N 282 MET CB HB3 sing N N 283 MET CG SD sing N N 284 MET CG HG2 sing N N 285 MET CG HG3 sing N N 286 MET SD CE sing N N 287 MET CE HE1 sing N N 288 MET CE HE2 sing N N 289 MET CE HE3 sing N N 290 MET OXT HXT sing N N 291 PHE N CA sing N N 292 PHE N H sing N N 293 PHE N H2 sing N N 294 PHE CA C sing N N 295 PHE CA CB sing N N 296 PHE CA HA sing N N 297 PHE C O doub N N 298 PHE C OXT sing N N 299 PHE CB CG sing N N 300 PHE CB HB2 sing N N 301 PHE CB HB3 sing N N 302 PHE CG CD1 doub Y N 303 PHE CG CD2 sing Y N 304 PHE CD1 CE1 sing Y N 305 PHE CD1 HD1 sing N N 306 PHE CD2 CE2 doub Y N 307 PHE CD2 HD2 sing N N 308 PHE CE1 CZ doub Y N 309 PHE CE1 HE1 sing N N 310 PHE CE2 CZ sing Y N 311 PHE CE2 HE2 sing N N 312 PHE CZ HZ sing N N 313 PHE OXT HXT sing N N 314 PRO N CA sing N N 315 PRO N CD sing N N 316 PRO N H sing N N 317 PRO CA C sing N N 318 PRO CA CB sing N N 319 PRO CA HA sing N N 320 PRO C O doub N N 321 PRO C OXT sing N N 322 PRO CB CG sing N N 323 PRO CB HB2 sing N N 324 PRO CB HB3 sing N N 325 PRO CG CD sing N N 326 PRO CG HG2 sing N N 327 PRO CG HG3 sing N N 328 PRO CD HD2 sing N N 329 PRO CD HD3 sing N N 330 PRO OXT HXT sing N N 331 SEP N CA sing N N 332 SEP N H sing N N 333 SEP N H2 sing N N 334 SEP CA CB sing N N 335 SEP CA C sing N N 336 SEP CA HA sing N N 337 SEP CB OG sing N N 338 SEP CB HB2 sing N N 339 SEP CB HB3 sing N N 340 SEP OG P sing N N 341 SEP C O doub N N 342 SEP C OXT sing N N 343 SEP OXT HXT sing N N 344 SEP P O1P doub N N 345 SEP P O2P sing N N 346 SEP P O3P sing N N 347 SEP O2P HOP2 sing N N 348 SEP O3P HOP3 sing N N 349 SER N CA sing N N 350 SER N H sing N N 351 SER N H2 sing N N 352 SER CA C sing N N 353 SER CA CB sing N N 354 SER CA HA sing N N 355 SER C O doub N N 356 SER C OXT sing N N 357 SER CB OG sing N N 358 SER CB HB2 sing N N 359 SER CB HB3 sing N N 360 SER OG HG sing N N 361 SER OXT HXT sing N N 362 THR N CA sing N N 363 THR N H sing N N 364 THR N H2 sing N N 365 THR CA C sing N N 366 THR CA CB sing N N 367 THR CA HA sing N N 368 THR C O doub N N 369 THR C OXT sing N N 370 THR CB OG1 sing N N 371 THR CB CG2 sing N N 372 THR CB HB sing N N 373 THR OG1 HG1 sing N N 374 THR CG2 HG21 sing N N 375 THR CG2 HG22 sing N N 376 THR CG2 HG23 sing N N 377 THR OXT HXT sing N N 378 TRP N CA sing N N 379 TRP N H sing N N 380 TRP N H2 sing N N 381 TRP CA C sing N N 382 TRP CA CB sing N N 383 TRP CA HA sing N N 384 TRP C O doub N N 385 TRP C OXT sing N N 386 TRP CB CG sing N N 387 TRP CB HB2 sing N N 388 TRP CB HB3 sing N N 389 TRP CG CD1 doub Y N 390 TRP CG CD2 sing Y N 391 TRP CD1 NE1 sing Y N 392 TRP CD1 HD1 sing N N 393 TRP CD2 CE2 doub Y N 394 TRP CD2 CE3 sing Y N 395 TRP NE1 CE2 sing Y N 396 TRP NE1 HE1 sing N N 397 TRP CE2 CZ2 sing Y N 398 TRP CE3 CZ3 doub Y N 399 TRP CE3 HE3 sing N N 400 TRP CZ2 CH2 doub Y N 401 TRP CZ2 HZ2 sing N N 402 TRP CZ3 CH2 sing Y N 403 TRP CZ3 HZ3 sing N N 404 TRP CH2 HH2 sing N N 405 TRP OXT HXT sing N N 406 TYR N CA sing N N 407 TYR N H sing N N 408 TYR N H2 sing N N 409 TYR CA C sing N N 410 TYR CA CB sing N N 411 TYR CA HA sing N N 412 TYR C O doub N N 413 TYR C OXT sing N N 414 TYR CB CG sing N N 415 TYR CB HB2 sing N N 416 TYR CB HB3 sing N N 417 TYR CG CD1 doub Y N 418 TYR CG CD2 sing Y N 419 TYR CD1 CE1 sing Y N 420 TYR CD1 HD1 sing N N 421 TYR CD2 CE2 doub Y N 422 TYR CD2 HD2 sing N N 423 TYR CE1 CZ doub Y N 424 TYR CE1 HE1 sing N N 425 TYR CE2 CZ sing Y N 426 TYR CE2 HE2 sing N N 427 TYR CZ OH sing N N 428 TYR OH HH sing N N 429 TYR OXT HXT sing N N 430 VAL N CA sing N N 431 VAL N H sing N N 432 VAL N H2 sing N N 433 VAL CA C sing N N 434 VAL CA CB sing N N 435 VAL CA HA sing N N 436 VAL C O doub N N 437 VAL C OXT sing N N 438 VAL CB CG1 sing N N 439 VAL CB CG2 sing N N 440 VAL CB HB sing N N 441 VAL CG1 HG11 sing N N 442 VAL CG1 HG12 sing N N 443 VAL CG1 HG13 sing N N 444 VAL CG2 HG21 sing N N 445 VAL CG2 HG22 sing N N 446 VAL CG2 HG23 sing N N 447 VAL OXT HXT sing N N 448 # _pdbx_audit_support.funding_organization 'H2020 Marie Curie Actions of the European Commission' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number 675179 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id K7N _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id K7N _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4JC3 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7NND _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012220 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008961 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015948 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 1.04373 23.83732 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? ? ? ? ? ? ? ? MG2+ ? ? 9.95820 ? 3.10187 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_